Search Results

Search found 97982 results on 3920 pages for 'page file'.

Page 26/3920 | < Previous Page | 22 23 24 25 26 27 28 29 30 31 32 33  | Next Page >

  • How many custom tabs can I add to a Facebook page?

    - by Maxi Ferreira
    I'm building a web application to create custom tabs and add them to the user's Facebook fanpages. I know how the process of "installing" FB apps into FB pages so they show up as Page Tabs works, but the problem is the client wants to allow the user to create unlimited Page Tabs for a single FB Page. So I have basically two questions. 1 - Can I resue a single FB App to be included into the same page several times? If so, is there a way to know what is the "id" of that Page Tab? So, if I have my FB App to look for the Tab content in http://www.mywebapp.com/tab/, I know I get a signed_request with the App ID and the Page ID, but if that same App is installed several times into the same Page, I don't know what's the Tab the user have cliked on. I know it's a little big messy, and I don't think there's a way to do this. So my next question is probably more accurate. 2 - Is there a limit on how many Tabs can I add to a single Facebook page? This way, if there's a limit of, say, 12 Tabs, I can create 12 FB Tab Apps, store the ID's and then I know which Tab of which Page the user is currently viewing. Thanks in advice! Maxi

    Read the article

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • How to send web browser a loading page, then some time later a results page

    - by Kurt W. Leucht
    I've wasted at least a half day of my company's time searching the Internet for an answer and I'm getting wrapped around the axle here. I can't figure out the difference between all the different technology choices (long polling, ajax streaming, comet, XMPP, etc.) and I can't get a simple hello world example working on my PC. I am running Apache 2.2 and ActivePerl 5.10.0. JavaScript is completely acceptable for this solution. All I want to do is write a simple Perl CGI script that when accessed, it immediately returns some HTML that tells the user to wait or maybe sends an animated GIF. Then without any user intervention (no mouse clicks or anything) I want the CGI script to at some time later replace the wait message or the animated GIF with the actual results from their query. I know this is simple stuff and websites do it all the time using JavaScript, but I can't find a single working example that I can cut and paste onto my machine that will work in Perl. Here is my simple Hello World example that I've compiled from various Internet sources, but it doesn't seem to work. When I refresh this Perl CGI script in my web browser it prints nothing for 5 seconds, then it prints the PLEASE BE PATIENT web page, but not the results web page. So the Ajax XMLHttpRequest stuff obviously isn't working right. What am I doing wrong? #!C:\Perl\bin\perl.exe use CGI; use CGI::Carp qw/fatalsToBrowser warningsToBrowser/; sub Create_HTML { my $html = <<EOHTML; <html> <head> <meta http-equiv="pragma" content="no-cache" /> <meta http-equiv="expires" content="-1" /> <script type="text/javascript" > var xmlhttp=false; /*@cc_on @*/ /*@if (@_jscript_version >= 5) // JScript gives us Conditional compilation, we can cope with old IE versions. // and security blocked creation of the objects. try { xmlhttp = new ActiveXObject("Msxml2.XMLHTTP"); } catch (e) { try { xmlhttp = new ActiveXObject("Microsoft.XMLHTTP"); } catch (E) { xmlhttp = false; } } @end @*/ if (!xmlhttp && typeof XMLHttpRequest!='undefined') { try { xmlhttp = new XMLHttpRequest(); } catch (e) { xmlhttp=false; } } if (!xmlhttp && window.createRequest) { try { xmlhttp = window.createRequest(); } catch (e) { xmlhttp=false; } } </script> <title>Ajax Streaming Connection Demo</title> </head> <body> Some header text. <p> <div id="response">PLEASE BE PATIENT</div> <p> Some footer text. </body> </html> EOHTML return $html; } my $cgi = new CGI; print $cgi->header; print Create_HTML(); sleep(5); print "<script type=\"text/javascript\">\n"; print "\$('response').innerHTML = 'Here are your results!';\n"; print "</script>\n";

    Read the article

  • Google is displaying "Translate this page" based on a previously registered domain inbound links

    - by crnm
    I recently started a new project with a newly registered generic tld domain. As soon as Google started indexing the page, it displayed a "translate this page" in SERP's, which tries to translate the page to the language of a small Eastern European country from the language that the site actually uses. I tried everything to prevent this: language meta headers and attributes, localisation through Google Webmaster Tools...all to no avail - nothing helped. After a couple of weeks I spotted dozens of inbound links popping up in Google Webmaster Tools all coming from that small Eastern European country, from sub-pages that are not active anymore (either sending out 404's or 301's to the main page), and also had been written in that other language. So the domain had been registered before and as it looks, it did got a lot of possibly spam links in that language. I can't even ask the sites where those links should have been to remove them as they are not active anymore physically, just in Google Webmaster Tools and/or internal data masses... Now I'm at a loss about what to do? As my site is pretty new, it does not have many links pointing towards it in my targeted language. So those are probably not enough to convince Google of attaching the right language to it as Google ignores all other signals about the page language. I'm also unsure if I should use the "disavow" tool, or a reconsideration request...or what else to do about this miserable state. I never used these tools before so I don't have any experience with them. Somehow I have to convince Google about the right language of the page and also to not count/apply/whatever all those historical links from the previous owner. (The domain had been deleted without any traces in Google before I registered it) Has anyone here ever dealt with a similar "Translate this page" problem? (I've also looked at this thread: How can I prevent Google mistakenly offering to translate a page? but didn't find a solution there)

    Read the article

  • Html index page and files in that directory

    - by Frank
    On my web site, there is an index page, but if I take out that index page, users will see the files in that directory, for instance my site is : XYZ.com and I have a directory called "My_Dir", so when a user typed in "XYZ.com/My_Dir" he will see the index.html if there is one, but if it's not there, he will see a list of all my files inside "My_Dir", so is it safe to assume that with an index page in any of my sub directories, I can hide all the files in those directories from users, in other words if I have "123.txt, abc.html and index.html" in "My_Dir", users won't be able to see "123.txt, abc.html" because of the existence of "index.html" [ unless of course I mention those two files inside index.html ] ? Frank

    Read the article

  • remember the highlighted text in html page(add annotation to html page)

    - by ganapati hegde
    Hi, I have an HTML file, i am opening it with webkit,i want to develop an app, such that after opening it, i should be able to select some text and make it highlighted(say by pressing some button 'highlight text' ). And it should remember the highlighted text so that when i open it next time it should highlight the same text automatically...which information i got to store so that i can highlight the same in the next time ? any library is available which makes my work simple?

    Read the article

  • Page upload data again on page refresh in ASP.NET

    - by Etienne
    For some reason when the user click on the submit button and he re-fresh the page the same data get's uploaded again to my SQL Server 2005 database. I do not what this to happen........... Why is this happening? I am making use of a SQL Data Source!! My code Try 'See if user typed the correct code. If Me.txtSecurity.Text = Session("Captcha") Then If Session("NotifyMe") = "Yes" Then SendEmailNS() End If RaterRate.Insert() RaterRate.Update() DisableItems() lblResultNS.Text = "Thank you for leaving a comment" LoadCompanyList() LoadRateRecords() txtCommentNS.Text = "" txtSecurity.Text = "" lblResultNS.Focus() Else Session("Captcha") = GenerateCAPTCHACode() txtSecurity.Text = "" txtSecurity.Focus() Validator10.Validate() End If Catch ex As Exception lblResultNS.Visible = True lblResultNS.Text = ex.Message.ToString lblResultNS.Focus() End Try

    Read the article

  • Page Lifecycle - Using FindControl to reference a control created programatically during page load

    - by Jay Wilde
    Hi, I'm creating some text boxes on my form programatically which I need to reference later using FindControl. I've put the FindControl instruction in the page load method after the code which creates them but get an error: "Object reference not set to an instance of an object." I assume this is because the textbox controls are not created until later in the lifecycle and therefore cannot be referenced from within Page_Load. Can someone advise where in my code-behind I would need to place the FindControl instruction so that it can find these programatically created text boxes?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • MVVM using Page Navigation On Windows Mobile 7

    - by anon
    The Navigation framework in Windows Mobile 7 is a cut down version of what is in Silverlight. You can only navigate to a Uri and not pass in a view. Since the NavigationService is tied to the View, how do people get this to fit into MVVM. For example: public class ViewModel : IViewModel { private IUnityContainer container; private IView view; public ViewModel(IUnityContainer container, IView view) { this.container = container; this.view = view; } public ICommand GoToNextPageCommand { get { ... } } public IView { get { return this.view; } } public void GoToNextPage() { // What do I put here. } } public class View : PhoneApplicationPage, IView { ... public void SetModel(IViewModel model) { ... } } I am using the Unity IOC container. I have to resolve my view model first and then use the View property to get hold of the view and then show it. However using the NavigationService, I have to pass in a view Uri. There is no way for me to create the view model first. Is there a way to get around this.

    Read the article

  • I Can Not Use Session In Page _Load And I Got Bellow Error

    - by LostLord
    hi my dear friends .... why i got this error : (Object reference not set to an instance of an object.) when i put this code in my page_load.: protected void Page_Load(object sender, EventArgs e) { BackEndUtils.OverallLoader(); string Teststr = Session["Co_ID"].ToString(); } ========================================================================== this session is made when user logins to my web site and this session works in other areas... thanks for your attention

    Read the article

  • Printer Page Size Problem

    - by mRt
    I am trying to set a custom paper size by doing: Printer.Height = 2160 Printer.Width = 11900 But it doesn't seen to have any effect. After setting this up, i ask for that values and it returns the default ones. And this: Printer.PaperSize = 256 Returns an error... Any ideas??

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Django "Page not found" error page shows only one of two expected urls

    - by Frank V
    I'm working with Django, admittedly for the first time doing anything real. The URL config looks like the following: urlpatterns = patterns('my_site.core_prototype.views', (r'^newpost/$', 'newPost'), (r'^$', 'NewPostAndDisplayList'), # capture nothing... #more here... - perhaps the perma-links? ) This is in an app's url.py which is loaded from the project's url.py via: urlpatterns = patterns('', # only app for now. (r'^$', include('my_site.core_prototype.urls')), ) The problem is, when I receive a 404 attempting to utilize newpost, the error page only shows the ^$ -- it seems to ignore the newpost pattern... I'm sure the solution is probably stupid-simple but right now I'm missing it. Can someone help get me on the right track...

    Read the article

  • How do I add the following jscript and css code to my page

    - by rosted
    Hi every one, I'm a bit new to joomla and i'm, I'm trying to add the following function to my joomla site script Lights Out – Dimming/Covering Background Content with jQuery this function can be found on the following link http://buildinternet.com/2009/08/lights-out-dimmingcovering-background-content-with-jquery/ I have tried to include the code both the css and the java but i'm not able to add it on my article can any one please help Thanks

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

< Previous Page | 22 23 24 25 26 27 28 29 30 31 32 33  | Next Page >