Search Results

Search found 77212 results on 3089 pages for 'universal file format'.

Page 27/3089 | < Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • How to format HDD with MHDD Tool.

    - by PP
    I have copied MHDD application on a bootable CD and i wan to use it to low level format my HDD which had some bad sectors on it. so how can mark these badsecotrs using MHDD application? Pluse can i partition/format my HDD using MHDD because after low level format i want to setup window xp on that drive. can some one explain me step by step procedure to how to lovel format driven and partition/format it and then setup xp on that. Link to MHDD app. http://hddguru.com/content/en/software/2005.10.02-MHDD/ Thanks, PP.

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Which file format to use for simple video editoring

    - by Craig HB
    I've just bought a Sanyo VPC-CG10 camcorder which saves clips as MPEG-4 (specifically, High-Definition 720p MPEG-4 AVC/H.246) I want a simple, cheap way to edit the clips and as, I'm using Windows Vista, I though Windows Movie Maker would be a good choice. But you can't import mp4 files into Windows Movie Maker. I've tried various codecs, but I'm not sure what is the best format to convert to, so that I can edit the files in Windows Movie Maker. AVI, MPG, WMI... I'm not sure what format is best. Should I try to keep the movie clips in MPEG-4 and edit them in that format (and then which editor do I use?) or is there a better format that I should convert to before editing (and what format is that?) ?

    Read the article

  • Distortion in format of data in wordpad file when shifted from windows XP to winows 2007

    - by Harpreet
    I have many data files which were set to open in wordpad file in windows XP. Those files have a particular format for data, like following: Name of Data file No. of data columns Name of data in column_1 Name of data in column_2 . . . Name of data in column_n column_1 column_2 column_3 ... column_n Now my computer has been formatted and OS is changed to windows 2007, however when I open my data files in wordpad the above format of data is no more present. The format in wordpad in windows 2007 seems to be distorted. Does anyone knows what to do to restore the format as shown above, which is what the data used to look like in XP? I have attached the snap shot of the new distorted format of data as seen in wordpad in windows 2007. The snap shot shows 100 column names, however the data columns present are only 5 when it should be actually 100 data columns.

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Comments syntax for Idoc Script

    - by kyle.hatlestad
    Maybe this is widely known and I'm late to the party, but I just ran across the syntax for making comments in Idoc Script. It's been something I've been hoping to see for a long time. And it looks like it quietly snuck into the 10gR3 release. So for comments in Idoc Script, you simply [[% surround your comments in these symbols. %]] They can be on the same line or span multiple lines. If you look in the documentation, it still mentions making comments using the syntax. Well, that's certainly not an ideal approach. You're stuffing your comment into an actual variable, it's taking up memory, and you have to watch double-quotes in your comment. A perhaps better way in the old method is to start with my comments . Still not great, but now you're not assigning something to a variable and worrying about quotes. Unfortunately, this syntax only works in places that use the Idoc format. It can't be used in Idoc files that get indexed (.hcsp & .hcsf) and use the <!--$...--> format. For those, you'll need to continue using the older methods. While on the topic, I thought I would highlight a great plug-in to Notepad++ that Arnoud Koot here at Oracle wrote for Idoc Script. It does script highlighting as well as type-ahead/auto-completion for common variables, functions, and services. For some reason, I can never seem to remember if it's DOC_INFO_LATESTRELEASE or DOC_INFO_LATEST_RELEASE, so this certainly comes in handy. I've updated his plug-in to use this new comments syntax. You can download a copy of the plug-in here which includes installation instructions.

    Read the article

  • Does anybody know of existing code to read a mork file (Thunderbird Address Book)?

    - by bruceatk
    I have the need to read the Thunderbird address book on the fly. It is stored in a file format called Mork. Not a pleasant file format to read. I found a 1999 article explaining the file format. I would love to know if someone already has gone through this process and could make the code available. I found mork.pl by Jamie Zawinski (he worked on Netscape Navigator), but I was hoping for a .NET solution. I'm hoping StackOverflow will come to the rescue, because this just seems like a waste of my time to write something to read this file format when it should be so simple. I love the comments that Jamie put in his perl script. Here is my favorite part: # Let me make it clear that McCusker is a complete barking lunatic. # This is just about the stupidest file format I've ever seen.

    Read the article

  • Universal iPad App rejected because of launch crash that I can't reproduce

    - by Enrique R.
    Hello everyone, I'm very frustrated with this problem. After one week of waiting my universal iPad app has been rejected because "is crashing on launch on iPad running iPhone OS 3.2 and iPhone 3GS running iPhone OS 3.1.3 and Mac OS X 10.6.2." Unfortunately I can't replicate the problem, I've tested in debug and release modes and the app works just fine. I even created an ad-hoc configuration and test it in other devices and everything works fine. I should clarify that this is an update to a current iPhone application and I'm using the same distribution profile as the original iPhone app. Also, I checked everything before building the universal app following this entry: http://iphonedevelopment.blogspot.com/2010/04/converting-iphone-apps-to-universal.html Here are the crash logs that Apple sent me: Incident Identifier: 3E0D4A3B-2896-444D-BCBE-6C0CA1A66A90 CrashReporter Key: 18b5124ea5f657227c5f202a27ed707379b3e2e7 Process: Transfer [982] Path: /var/mobile/Applications/E9062465-7EA6-424C-9C61-D9DBCC7C915A/Transfer.app/Transfer Identifier: Transfer Version: ??? (???) Code Type: ARM (Native) Parent Process: launchd [1] Date/Time: 2010-05-04 15:35:57.399 -0700 OS Version: iPhone OS 3.1.3 (7E18) Report Version: 104 Exception Type: EXC_BAD_INSTRUCTION (SIGILL) Exception Codes: 0x00000001, 0x3eaa2188 Highlighted Thread: 0 Backtrace not available Unknown thread crashed with ARM Thread State: r0: 0x00002f90 r1: 0x00000000 r2: 0x385242d8 r3: 0x0000010d r4: 0x00000000 r5: 0x00000000 r6: 0x00000000 r7: 0x00000000 r8: 0x2ffffba0 r9: 0x2fffef90 r10: 0x00000000 r11: 0x00000000 ip: 0x0000000c sp: 0x2ffffba4 lr: 0x2fe08727 pc: 0x00002f94 cpsr: 0x40000010 Binary Images: 0x1000 - 0x25fff +Transfer armv7 /var/mobile/Applications/E9062465-7EA6-424C-9C61-D9DBCC7C915A/Transfer.app/Transfer 0x2fe00000 - 0x2fe24fff dyld armv7 /usr/lib/dyld .... And the one for the iPad: Incident Identifier: 3B170A28-C8E2-4018-8166-E69432A65070 CrashReporter Key: 4a0194e3f60559127faef2b014df605e4c47b981 Hardware Model: iPad1,1 Process: Transfer [533] Path: /var/mobile/Applications/400EE394-7BEE-45CA-942D-DBDC106360FF/Transfer.app/Transfer Identifier: Transfer Version: ??? (???) Code Type: ARM (Native) Parent Process: launchd [1] Date/Time: 2010-05-04 15:37:17.505 -0700 OS Version: iPhone OS 3.2 (7B367) Report Version: 104 Exception Type: 00000020 Exception Codes: 0x8badf00d Highlighted Thread: 0 Application Specific Information: com.erclab.iphone.photodownload failed to launch in time elapsed total CPU time (seconds): 1.150 (user 0.560, system 0.590), 6% CPU elapsed application CPU time (seconds): 0.150, 1% CPU Thread 0: 0 libobjc.A.dylib 0x33561996 0x33560000 + 6550 1 libobjc.A.dylib 0x33564986 0x33560000 + 18822 2 libobjc.A.dylib 0x33564cb2 0x33560000 + 19634 ... The app does not do anything other than loading a local HTML into a web view after the app it's launched so I don't understand why it says "failed to launch in time" Any help will be very much appreciated.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

< Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >