input stream - Page 270

SQL University: What and why of database refactoring

- by Mladen Prajdic

This is a post for a great idea called SQL University started by Jorge Segarra also famously known as SqlChicken on Twitter. It’s a collection of blog posts on different database related topics contributed by several smart people all over the world. So this week is mine and we’ll be talking about database testing and refactoring. In 3 posts we’ll cover: SQLU part 1 - What and why of database testing SQLU part 2 - What and why of database refactoring SQLU part 3 - Tools of the trade This is a second part of the series and in it we’ll take a look at what database refactoring is and why do it. Why refactor a database To know why refactor we first have to know what refactoring actually is. Code refactoring is a process where we change module internals in a way that does not change that module’s input/output behavior. For successful refactoring there is one crucial thing we absolutely must have: Tests. Automated unit tests are the only guarantee we have that we haven’t broken the input/output behavior before refactoring. If you haven’t go back ad read my post on the matter. Then start writing them. Next thing you need is a code module. Those are views, UDFs and stored procedures. By having direct table access we can kiss fast and sweet refactoring good bye. One more point to have a database abstraction layer. And no, ORM’s don’t fall into that category. But also know that refactoring is NOT adding new functionality to your code. Many have fallen into this trap. Don’t be one of them and resist the lure of the dark side. And it’s a strong lure. We developers in general love to add new stuff to our code, but hate fixing our own mistakes or changing existing code for no apparent reason. To be a good refactorer one needs discipline and focus. Now we know that refactoring is all about changing inner workings of existing code. This can be due to performance optimizations, changing internal code workflows or some other reason. This is a typical black box scenario to the outside world. If we upgrade the car engine it still has to drive on the road (preferably faster) and not fly (no matter how cool that would be). Also be aware that white box tests will break when we refactor. What to refactor in a database Refactoring databases doesn’t happen that often but when it does it can include a lot of stuff. Let us look at a few common cases. Adding or removing database schema objects Adding, removing or changing table columns in any way, adding constraints, keys, etc… All of these can be counted as internal changes not visible to the data consumer. But each of these carries a potential input/output behavior change. Dropping a column can result in views not working anymore or stored procedure logic crashing. Adding a unique constraint shows duplicated data that shouldn’t exist. Foreign keys break a truncate table command executed from an application that runs once a month. All these scenarios are very real and can happen. With the proper database abstraction layer fully covered with black box tests we can make sure something like that does not happen (hopefully at all). Changing physical structures Physical structures include heaps, indexes and partitions. We can pretty much add or remove those without changing the data returned by the database. But the performance can be affected. So here we use our performance tests. We do have them, right? Just by adding a single index we can achieve orders of magnitude performance improvement. Won’t that make users happy? But what if that index causes our write operations to crawl to a stop. again we have to test this. There are a lot of things to think about and have tests for. Without tests we can’t do successful refactoring! Fixing bad code We all have some bad code in our systems. We usually refer to that code as code smell as they violate good coding practices. Examples of such code smells are SQL injection, use of SELECT *, scalar UDFs or cursors, etc… Each of those is huge code smell and can result in major code changes. Take SELECT * from example. If we remove a column from a table the client using that SELECT * statement won’t have a clue about that until it runs. Then it will gracefully crash and burn. Not to mention the widely unknown SELECT * view refresh problem that Tomas LaRock (@SQLRockstar on Twitter) and Colin Stasiuk (@BenchmarkIT on Twitter) talk about in detail. Go read about it, it’s informative. Refactoring this includes replacing the * with column names and most likely change to application using the database. Breaking apart huge stored procedures Have you ever seen seen a stored procedure that was 2000 lines long? I have. It’s not pretty. It hurts the eyes and sucks the will to live the next 10 minutes. They are a maintenance nightmare and turn into things no one dares to touch. I’m willing to bet that 100% of time they don’t have a single test on them. Large stored procedures (and functions) are a clear sign that they contain business logic. General opinion on good database coding practices says that business logic has no business in the database. That’s the applications part. Refactoring such behemoths requires writing lots of edge case tests for the stored procedure input/output behavior and then start to refactor it. First we split the logic inside into smaller parts like new stored procedures and UDFs. Those then get called from the master stored procedure. Once we’ve successfully modularized the database code it’s best to transfer that logic into the applications consuming it. This only leaves the stored procedure with common data manipulation logic. Of course this isn’t always possible so having a plethora of performance and behavior unit tests is absolutely necessary to confirm we’ve actually improved the codebase in some way. Refactoring is not a popular chore amongst developers or managers. The former don’t like fixing old code, the latter can’t see the financial benefit. Remember how we talked about being lousy at estimating future costs in the previous post? But there comes a time when it must be done. Hopefully I’ve given you some ideas how to get started. In the last post of the series we’ll take a look at the tools to use and an example of testing and refactoring.

Read the article

Oracle Enterprise Manager Ops Center : Using Operational Profiles to Install Packages and other Content

- by LeonShaner

Oracle Enterprise Manager Ops Center provides numerous ways to deploy content, such as through OS Update Profiles, or as part of an OS Provisioning plan or combinations of those and other "Install Software" capabilities of Deployment Plans. This short "how-to" blog will highlight an alternative way to deploy content using Operational Profiles. Usually we think of Operational Profiles as a way to execute a simple "one-time" script to perform a basic system administration function, which can optionally be based on user input; however, Operational Profiles can be much more powerful than that. There is often more to performing an action than merely running a script -- sometimes configuration files, packages, binaries, and other scripts, etc. are needed to perform the action, and sometimes the user would like to leave such content on the system for later use. For shell scripts and other content written to be generic enough to work on any flavor of UNIX, converting the same scripts and configuration files into Solaris 10 SVR4 package, Solaris 11 IPS package, and/or a Linux RPM's might be seen as three times the work, for little appreciable gain. That is where using an Operational Profile to deploy simple scripts and other generic content can be very helpful. The approach is so powerful, that pretty much any kind of content can be deployed using an Operational Profile, provided the files involved are not overly large, and it is not necessary to convert the content into UNIX variant-specific formats. The basic formula for deploying content with an Operational Profile is as follows: Begin with a traditional script header, which is a UNIX shell script that will be responsible for decoding and extracting content, copying files into the right places, and executing any other scripts and commands needed to install and configure that content. Include steps to make the script platform-aware, to do the right thing for a given UNIX variant, or a "sorry" message if the operator has somehow tried to run the Operational Profile on a system where the script is not designed to run. Ops Center can constrain execution by target type, so such checks at this level are an added safeguard, but also useful with the generic target type of "Operating System" where the admin wants the script to "do the right thing," whatever the UNIX variant. Include helpful output to show script progress, and any other informational messages that can help the admin determine what has gone wrong in the case of a problem in script execution. Such messages will be shown in the job execution log. Include necessary "clean up" steps for normal and error exit conditions Set non-zero exit codes when appropriate -- a non-zero exit code will cause an Operational Profile job to be marked failed, which is the admin's cue to look into the job details for diagnostic messages in the output from the script. That first bullet deserves some explanation. If Operational Profiles are usually simple "one-time" scripts and binary content is not allowed, then how does the actual content, packages, binaries, and other scripts get delivered along with the script? More specifically, how does one include such content without needing to first create some kind of traditional package? All that is required is to simply encode the content and append it to the end of the Operational Profile. The header portion of the Operational Profile will need to contain the commands to decode the embedded content that has been appended to the bottom of the script. The header code can do whatever else is needed, and finally clean up any intermediate files that were created during the decoding and extraction of the content. One way to encode binary and other content for inclusion in a script is to use the "uuencode" utility to convert the content into simple base64 ASCII text -- a form that is suitable to be appended to an Operational Profile. The behavior of the "uudecode" utility is such that it will skip over any parts of the input that do not fit the uuencoded "begin" and "end" clauses. For that reason, your header script will be skipped over, and uudecode will find your embedded content, that you will uuencode and paste at the end of the Operational Profile. You can have as many "begin" / "end" clauses as you need -- just separate each embedded file by an empty line between "begin" and "end" clauses. Example: Install SUNWsneep and set the system serial number Script: deploySUNWsneep.sh ( <- right-click / save to download) Highlights: #!/bin/sh # Required variables: OC_SERIAL="$OC_SERIAL" # The user-supplied serial number for the asset ... Above is a good practice, showing right up front what kind of input the Operational Profile will require. The right-hand side where $OC_SERIAL appears in this example will be filled in by Ops Center based on the user input at deployment time. The script goes on to restrict the use of the program to the intended OS type (Solaris 10 or older, in this example, but other content might be suitable for Solaris 11, or Linux -- it depends on the content and the script that will handle it). A temporary working directory is created, and then we have the command that decodes the embedded content from "self" which in scripting terms is $0 (a variable that expands to the name of the currently executing script): # Pass myself through uudecode, which will extract content to the current dir uudecode $0 At that point, whatever content was appended in uuencoded form at the end of the script has been written out to the current directory. In this example that yields a file, SUNWsneep.7.0.zip, which the rest of the script proceeds to unzip, and pkgadd, followed by running "/opt/SUNWsneep/bin/sneep -s $OC_SERIAL" which is the command that stores the system serial for future use by other programs such as Explorer. Don't get hung up on the example having used a pkgadd command. The content started as a zip file and it could have been a tar.gz, or any other file. This approach simply decodes the file. The header portion of the script has to make sense of the file and do the right thing (e.g. it's up to you). The script goes on to clean up after itself, whether or not the above was successful. Errors are echo'd by the script and a non-zero exit code is set where appropriate. Second to last, we have: # just in case, exit explicitly, so that uuencoded content will not cause error OPCleanUP exit # The rest of the script is ignored, except by uudecode # # UUencoded content follows # # e.g. for each file needed, # $ uuencode -m {source} {source} > {target}.uu5 # then paste the {target}.uu5 files below # they will be extracted into the workding dir at $TDIR # The commentary above also describes how to encode the content. Finally we have the uuencoded content: begin-base64 444 SUNWsneep.7.0.zip UEsDBBQAAAAIAPsRy0Di3vnukAAAAMcAAAAKABUAcmVhZG1lLnR4dFVUCQADOqnVT7up ... VXgAAFBLBQYAAAAAAgACAJEAAADTNwEAAAA= ==== That last line of "====" is the base64 uuencode equivalent of a blank line, followed by "end" and as mentioned you can have as many begin/end clauses as you need. Just separate each embedded file by a blank line after each ==== and before each begin-base64. Deploying the example Operational Profile looks like this (where I have pasted the system serial number into the required field): The job succeeded, but here is an example of the kind of diagnostic messages that the example script produces, and how Ops Center displays them in the job details: This same general approach could be used to deploy Explorer, and other useful utilities and scripts. Please let us know what you think? Until next time...\Leon-- Leon Shaner | Senior IT/Product ArchitectSystems Management | Ops Center Engineering @ Oracle The views expressed on this [blog; Web site] are my own and do not necessarily reflect the views of Oracle. For more information, please go to Oracle Enterprise Manager web page or follow us at : Twitter | Facebook | YouTube | Linkedin | Newsletter

Read the article

Recursion in the form of a Recursive Func<T, T>

- by ToStringTheory

I gotta admit, I am kind of surprised that I didn’t realize I could do this sooner. I recently had a problem which required a recursive function call to come up with the answer. After some time messing around with a recursive method, and creating an API that I was not happy with, I was able to create an API that I enjoy, and seems intuitive. Introduction To bring it to a simple example, consider the summation to n: A mathematically identical formula is: In a .NET function, this can be represented by a function: Func<int, int> summation = x => x*(x+1)/2 Calling summation with an input integer will yield the summation to that number: var sum10 = summation(4); //sum10 would be equal to 10 But what if I wanted to get a second level summation… First some to n, and then use that argument as the input to the same function, to find the second level summation: So as an easy example, calculate the summation to 3, which yields 6. Then calculate the summation to 6 which yields 21. Represented as a mathematical formula - So what if I wanted to represent this as .NET functions. I can always do: //using the summation formula from above var sum3 = summation(3); //sets sum3 to 6 var sum3_2 = summation(sum3); //sets sum3 to 21 I could always create a while loop to perform the calculations too: Func<int, int> summation = x => x*(x+1)/2; //for the interests of a smaller example, using shorthand int sumResultTo = 3; int level = 2; while(level-- > 0) { sumResultTo = summation(sumResultTo); } //sumResultTo is equal to 21 now. Or express it as a for-loop, method calls, etc… I really didn’t like any of the options that I tried. Then it dawned on me – since I was using a Func<T, T> anyways, why not use the Func’s output from one call as the input as another directly. Some Code So, I decided that I wanted a recursion class. Something that I would be generic and reusable in case I ever wanted to do something like this again. It is limited to only the Func<T1, T2> level of Func, and T1 must be the same as T2. The first thing in this class is a private field for the function: private readonly Func<T, T> _functionToRecurse; So, I since I want the function to be unchangeable, I have defined it as readonly. Therefore my constructor looks like: public Recursion(Func<T, T> functionToRecurse) { if (functionToRecurse == null) { throw new ArgumentNullException("functionToRecurse", "The function to recurse can not be null"); } _functionToRecurse = functionToRecurse; } Simple enough. If you have any questions, feel free to post them in the comments, and I will be sure to answer them. Next, I want enough. If be able to get the result of a function dependent on how many levels of recursion: private Func<T, T> GetXLevel(int level) { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } if (level == 1) return _functionToRecurse; return _GetXLevel(level - 1, _functionToRecurse); } So, if you pass in 1 for the level, you get just the Func<T,T> back. If you say that you want to go deeper down the rabbit hole, it calls a method which accepts the level it is at, and the function which it needs to use to recurse further: private Func<T, T> _GetXLevel(int level, Func<T, T> prevFunc) { if (level == 1) return y => prevFunc(_functionToRecurse(y)); return _GetXLevel(level - 1, y => prevFunc(_functionToRecurse(y))); } That is really all that is needed for this class. If I exposed the GetXLevel function publicly, I could use that to get the function for a level, and pass in the argument.. But I wanted something better. So, I used the ‘this’ array operator for the class: public Func<T,T> this[int level] { get { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } return this.GetXLevel(level); } } So, using the same example above of finding the second recursion of the summation of 3: var summator = new Recursion<int>(x => (x * (x + 1)) / 2); var sum_3_level2 = summator[2](3); //yields 21 You can even find just store the delegate to the second level summation, and use it multiple times: var summator = new Recursion<int>(x => (x * (x + 1)) / 2); var sum_level2 = summator[2]; var sum_3_level2 = sum_level2(3); //yields 21 var sum_4_level2 = sum_level2(4); //yields 55 var sum_5_level2 = sum_level2(5); //yields 120 Full Code Don’t think I was just going to hold off on the full file together and make you do the hard work… Copy this into a new class file: public class Recursion<T> { private readonly Func<T, T> _functionToRecurse; public Recursion(Func<T, T> functionToRecurse) { if (functionToRecurse == null) { throw new ArgumentNullException("functionToRecurse", "The function to recurse can not be null"); } _functionToRecurse = functionToRecurse; } public Func<T,T> this[int level] { get { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } return this.GetXLevel(level); } } private Func<T, T> GetXLevel(int level) { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } if (level == 1) return _functionToRecurse; return _GetXLevel(level - 1, _functionToRecurse); } private Func<T, T> _GetXLevel(int level, Func<T, T> prevFunc) { if (level == 1) return y => prevFunc(_functionToRecurse(y)); return _GetXLevel(level - 1, y => prevFunc(_functionToRecurse(y))); } } Conclusion The great thing about this class, is that it can be used with any function with same input/output parameters. I strived to find an implementation that I found clean and useful, and I finally settled on this. If you have feedback – good or bad, I would love to hear it!

Read the article

Parse a text file into multiple text file

- by Vijay Kumar Singh

I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\$",""); b[i][j]=b[i][j].replaceAll("\$",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

Read the article

Is there any better way for creating a dynamic HTML table without using any javascript library like

- by piemesons

Dont worry we dont need to find out any bug in this code.. Its working perfectly.:-P My boss came to me and said "Hey just tell me whats the best of way of writing code for a dynamic HTML table (add row, delete row, update row).No need to add any CSS. Just javascript. No Jquery library etc. I was confused that in the middle of the project why he asking for some stupid exercise like this. What ever i wrote the following code and mailed him and after 15 mins i got a mail from him. " I was expecting much better code from a guy like you. Anyways good job monkey.(And with a picture of monkey as attachment.) thats was the mail. Line by line. I want to reply him but before that i want to know about the quality of my code. Is this really shitty...!!! Or he was just making fun of mine. I dont think that code is really shitty. Still correct me if you can.Code is working perfectly fine. Just copy paste it in a HTML file. <html> <head> <title> Exercise CSS </title> <script type="text/javascript"> function add_row() { var table = document.getElementById('table'); var rowCount = table.rows.length; var row = table.insertRow(rowCount); var cell1 = row.insertCell(0); var element1 = document.createElement("input"); element1.type = "text"; cell1.appendChild(element1); var cell2 = row.insertCell(1); var element2 = document.createElement("input"); element2.type = "text"; cell2.appendChild(element2); var cell3 = row.insertCell(2); cell3.innerHTML = ' <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span>'; cell3.setAttribute("style", "display:none;"); var cell4 = row.insertCell(3); cell4.innerHTML = '<span onClick="save(this)">Save</span>'; } function save(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML=elTableCells[0].firstChild.value; elTableCells[1].innerHTML=elTableCells[1].firstChild.value; elTableCells[2].setAttribute("style", "display:block;"); elTableCells[3].setAttribute("style", "display:none;"); } function edit(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML='<input type="text" value="'+elTableCells[0].innerHTML+'">'; elTableCells[1].innerHTML='<input type="text" value="'+elTableCells[1].innerHTML+'">'; elTableCells[2].setAttribute("style", "display:none;"); elTableCells[3].setAttribute("style", "display:block;"); } function delete_row(e) { e.parentNode.parentNode.parentNode.removeChild(e.parentNode.parentNode); } </script> </head> <body > <div id="display"> <table id='table'> <tr id='id'> <td> Piemesons </td> <td> 23 </td> <td > <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span> </td> <td style="display:none;"> <span onClick="save(this)">Save</span> </td> </tr> </table> <input type="button" value="Add new row" onClick="add_row();" /> </div> </body>

Read the article

how to generate tinymce to ajax generated textarea

- by Jai_pans

Hi, i have a image multi-uloader script which also each item uploaded was preview 1st b4 it submitted and each images has its following textarea which are also generated by javascript and my problem is i want to use the tinymce editor to each textarea generated by the ajax. Any help will be appreciated.. here is my script function fileQueueError(file, errorCode, message) { try { var imageName = "error.gif"; var errorName = ""; if (errorCode === SWFUpload.errorCode_QUEUE_LIMIT_EXCEEDED) { errorName = "You have attempted to queue too many files."; } if (errorName !== "") { alert(errorName); return; } switch (errorCode) { case SWFUpload.QUEUE_ERROR.ZERO_BYTE_FILE: imageName = "zerobyte.gif"; break; case SWFUpload.QUEUE_ERROR.FILE_EXCEEDS_SIZE_LIMIT: imageName = "toobig.gif"; break; case SWFUpload.QUEUE_ERROR.ZERO_BYTE_FILE: case SWFUpload.QUEUE_ERROR.INVALID_FILETYPE: default: alert(message); break; } addImage("images/" + imageName); } catch (ex) { this.debug(ex); } } function fileDialogComplete(numFilesSelected, numFilesQueued) { try { if (numFilesQueued 0) { this.startUpload(); } } catch (ex) { this.debug(ex); } } function uploadProgress(file, bytesLoaded) { try { var percent = Math.ceil((bytesLoaded / file.size) * 100); var progress = new FileProgress(file, this.customSettings.upload_target); progress.setProgress(percent); if (percent === 100) { progress.setStatus("Creating thumbnail..."); progress.toggleCancel(false, this); } else { progress.setStatus("Uploading..."); progress.toggleCancel(true, this); } } catch (ex) { this.debug(ex); } } function uploadSuccess(file, serverData) { try { var progress = new FileProgress(file, this.customSettings.upload_target); if (serverData.substring(0, 7) === "FILEID:") { addRow("tableID","thumbnail.php?id=" + serverData.substring(7),file.name); //setup(); //generateTinyMCE('itemdescription[]'); progress.setStatus("Thumbnail Created."); progress.toggleCancel(false); } else { addImage("images/error.gif"); progress.setStatus("Error."); progress.toggleCancel(false); alert(serverData); } } catch (ex) { this.debug(ex); } } function uploadComplete(file) { try { /* I want the next upload to continue automatically so I'll call startUpload here */ if (this.getStats().files_queued 0) { this.startUpload(); } else { var progress = new FileProgress(file, this.customSettings.upload_target); progress.setComplete(); progress.setStatus("All images received."); progress.toggleCancel(false); } } catch (ex) { this.debug(ex); } } function uploadError(file, errorCode, message) { var imageName = "error.gif"; var progress; try { switch (errorCode) { case SWFUpload.UPLOAD_ERROR.FILE_CANCELLED: try { progress = new FileProgress(file, this.customSettings.upload_target); progress.setCancelled(); progress.setStatus("Cancelled"); progress.toggleCancel(false); } catch (ex1) { this.debug(ex1); } break; case SWFUpload.UPLOAD_ERROR.UPLOAD_STOPPED: try { progress = new FileProgress(file, this.customSettings.upload_target); progress.setCancelled(); progress.setStatus("Stopped"); progress.toggleCancel(true); } catch (ex2) { this.debug(ex2); } case SWFUpload.UPLOAD_ERROR.UPLOAD_LIMIT_EXCEEDED: imageName = "uploadlimit.gif"; break; default: alert(message); break; } addImage("images/" + imageName); } catch (ex3) { this.debug(ex3); } } function addRow(tableID,src,filename) { var table = document.getElementById(tableID); var rowCount = table.rows.length; var row = table.insertRow(rowCount); rowCount + 1; row.id = "row"+rowCount; var cell0 = row.insertCell(0); cell0.innerHTML = rowCount; cell0.style.background = "#FFFFFF"; var cell1 = row.insertCell(1); cell1.align = "center"; cell1.style.background = "#FFFFFF"; var imahe = document.createElement("img"); imahe.setAttribute("src",src); var hidden = document.createElement("input"); hidden.setAttribute("type","hidden"); hidden.setAttribute("name","filename[]"); hidden.setAttribute("value",filename); /*var hidden2 = document.createElement("input"); hidden2.setAttribute("type","hidden"); hidden2.setAttribute("name","filename[]"); hidden2.setAttribute("value",filename); cell1.appendChild(hidden2);*/ cell1.appendChild(hidden); cell1.appendChild(imahe); var cell2 = row.insertCell(2); cell2.align = "left"; cell2.valign = "top"; cell2.style.background = "#FFFFFF"; //tr1.appendChild(td1); var div2 = document.createElement("div"); div2.style.padding ="0 0 0 10px"; div2.style.width = "400px"; var alink = document.createElement("a"); //alink.style.margin="40px 0 0 0"; alink.href ="#"; alink.innerHTML ="Cancel"; alink.onclick= function () { document.getElementById(row.id).style.display='none'; document.getElementById(textfield.id).disabled='disabled'; }; var div = document.createElement("div"); div.style.margin="10px 0"; div.appendChild(alink); var textfield = document.createElement("input"); textfield.id = "file"+rowCount; textfield.type = "text"; textfield.name = "itemname[]"; textfield.style.margin = "10px 0"; textfield.style.width = "400px"; textfield.value = "Item Name"; textfield.onclick= function(){ //textfield.value=""; if(textfield.value=="Item Name") textfield.value=""; if(desc.innerHTML=="") desc.innerHTML ="Item Description"; if(price.value=="") price.value="Item Price"; } var desc = document.createElement("textarea"); desc.name = "itemdescription[]"; desc.cols = "80"; desc.rows = "4"; desc.innerHTML = "Item Description"; desc.onclick = function(){ if(desc.innerHTML== "Item Description") desc.innerHTML = ""; if(textfield.value=="Item name" || textfield.value=="") textfield.value="Item Name"; if(price.value=="") price.value="Item Price"; } var price = document.createElement("input"); price.id = "file"+rowCount; price.type = "text"; price.name = "itemprice[]"; price.style.margin = "10px 0"; price.style.width = "400px"; price.value = "Item Price"; price.onclick= function(){ if(price.value=="Item Price") price.value=""; if(desc.innerHTML=="") desc.innerHTML ="Item Description"; if(textfield.value=="") textfield.value="Item Name"; } var span = document.createElement("span"); span.innerHTML = "View"; span.style.width = "auto"; span.style.padding = "10px 0"; var view = document.createElement("input"); view.id = "file"+rowCount; view.type = "checkbox"; view.name = "publicview[]"; view.value = "y"; view.checked = "checked"; var div3 = document.createElement("div"); div3.appendChild(span); div3.appendChild(view); var div4 = document.createElement("div"); div4.style.padding = "10px 0"; var span2 = document.createElement("span"); span2.innerHTML = "Default Display"; span2.style.width = "auto"; span2.style.padding = "10px 0"; var radio = document.createElement("input"); radio.type = "radio"; radio.name = "setdefault"; radio.value = "y"; div4.appendChild(span2); div4.appendChild(radio); div2.appendChild(div); //div2.appendChild(label); //div2.appendChild(table); div2.appendChild(textfield); div2.appendChild(desc); div2.appendChild(price); div2.appendChild(div3); div2.appendChild(div4); cell2.appendChild(div2); } function addImage(src,val_id) { var newImg = document.createElement("img"); newImg.style.margin = "5px 50px 5px 5px"; newImg.style.display= "inline"; newImg.id=val_id; document.getElementById("thumbnails").appendChild(newImg); if (newImg.filters) { try { newImg.filters.item("DXImageTransform.Microsoft.Alpha").opacity = 0; } catch (e) { // If it is not set initially, the browser will throw an error. This will set it if it is not set yet. newImg.style.filter = 'progid:DXImageTransform.Microsoft.Alpha(opacity=' + 0 + ')'; } } else { newImg.style.opacity = 0; } newImg.onload = function () { fadeIn(newImg, 0); }; newImg.src = src; } function fadeIn(element, opacity) { var reduceOpacityBy = 5; var rate = 30; // 15 fps if (opacity < 100) { opacity += reduceOpacityBy; if (opacity > 100) { opacity = 100; } if (element.filters) { try { element.filters.item("DXImageTransform.Microsoft.Alpha").opacity = opacity; } catch (e) { // If it is not set initially, the browser will throw an error. This will set it if it is not set yet. element.style.filter = 'progid:DXImageTransform.Microsoft.Alpha(opacity=' + opacity + ')'; } } else { element.style.opacity = opacity / 100; } } if (opacity < 100) { setTimeout(function () { fadeIn(element, opacity); }, rate); } } /* ************************************** * FileProgress Object * Control object for displaying file info * ************************************** */ function FileProgress(file, targetID) { this.fileProgressID = "divFileProgress"; this.fileProgressWrapper = document.getElementById(this.fileProgressID); if (!this.fileProgressWrapper) { this.fileProgressWrapper = document.createElement("div"); this.fileProgressWrapper.className = "progressWrapper"; this.fileProgressWrapper.id = this.fileProgressID; this.fileProgressElement = document.createElement("div"); this.fileProgressElement.className = "progressContainer"; var progressCancel = document.createElement("a"); progressCancel.className = "progressCancel"; progressCancel.href = "#"; progressCancel.style.visibility = "hidden"; progressCancel.appendChild(document.createTextNode(" ")); var progressText = document.createElement("div"); progressText.className = "progressName"; progressText.appendChild(document.createTextNode(file.name)); var progressBar = document.createElement("div"); progressBar.className = "progressBarInProgress"; var progressStatus = document.createElement("div"); progressStatus.className = "progressBarStatus"; progressStatus.innerHTML = " "; this.fileProgressElement.appendChild(progressCancel); this.fileProgressElement.appendChild(progressText); this.fileProgressElement.appendChild(progressStatus); this.fileProgressElement.appendChild(progressBar); this.fileProgressWrapper.appendChild(this.fileProgressElement); document.getElementById(targetID).appendChild(this.fileProgressWrapper); fadeIn(this.fileProgressWrapper, 0); } else { this.fileProgressElement = this.fileProgressWrapper.firstChild; this.fileProgressElement.childNodes[1].firstChild.nodeValue = file.name; } this.height = this.fileProgressWrapper.offsetHeight; } FileProgress.prototype.setProgress = function (percentage) { this.fileProgressElement.className = "progressContainer green"; this.fileProgressElement.childNodes[3].className = "progressBarInProgress"; this.fileProgressElement.childNodes[3].style.width = percentage + "%"; }; FileProgress.prototype.setComplete = function () { this.fileProgressElement.className = "progressContainer blue"; this.fileProgressElement.childNodes[3].className = "progressBarComplete"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setError = function () { this.fileProgressElement.className = "progressContainer red"; this.fileProgressElement.childNodes[3].className = "progressBarError"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setCancelled = function () { this.fileProgressElement.className = "progressContainer"; this.fileProgressElement.childNodes[3].className = "progressBarError"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setStatus = function (status) { this.fileProgressElement.childNodes[2].innerHTML = status; }; FileProgress.prototype.toggleCancel = function (show, swfuploadInstance) { this.fileProgressElement.childNodes[0].style.visibility = show ? "visible" : "hidden"; if (swfuploadInstance) { var fileID = this.fileProgressID; this.fileProgressElement.childNodes[0].onclick = function () { swfuploadInstance.cancelUpload(fileID); return false; }; } }; i am using a swfuploader an i jst added a input fields and a textarea when it preview the images which ready to be uploaded and from my html i have this script var swfu; window.onload = function () { swfu = new SWFUpload({ // Backend Settings upload_url: "../we_modules/upload.php", // Relative to the SWF file or absolute post_params: {"PHPSESSID": ""}, // File Upload Settings file_size_limit : "20 MB", // 2MB file_types : "*.*", //file_types : "", file_types_description : "jpg", file_upload_limit : "0", file_queue_limit : "0", // Event Handler Settings - these functions as defined in Handlers.js // The handlers are not part of SWFUpload but are part of my website and control how // my website reacts to the SWFUpload events. //file_queued_handler : fileQueued, file_queue_error_handler : fileQueueError, file_dialog_complete_handler : fileDialogComplete, upload_progress_handler : uploadProgress, upload_error_handler : uploadError, upload_success_handler : uploadSuccess, upload_complete_handler : uploadComplete, // Button Settings button_image_url : "../we_modules/images/SmallSpyGlassWithTransperancy_17x18.png", // Relative to the SWF file button_placeholder_id : "spanButtonPlaceholder", button_width: 180, button_height: 18, button_text : 'Select Files(2 MB Max)', button_text_style : '.button { font-family: Helvetica, Arial, sans-serif; font-size: 12pt;cursor:pointer } .buttonSmall { font-size: 10pt; }', button_text_top_padding: 0, button_text_left_padding: 18, button_window_mode: SWFUpload.WINDOW_MODE.TRANSPARENT, button_cursor: SWFUpload.CURSOR.HAND, // Flash Settings flash_url : "../swfupload/swfupload.swf", custom_settings : { upload_target : "divFileProgressContainer" }, // Debug Settings debug: false }); }; where should i put on the tinymce function as you mention below?

Read the article

What's the best/most efficent way to create a semi-intelligent AI for a tic tac toe game?

- by Link

basically I am attempting to make a a efficient/smallish C game of Tic-Tac-Toe. I have implemented everything other then the AI for the computer so far. my squares are basically structs in an array with an assigned value based on the square. For example s[1].value = 1; therefore it's a x, and then a value of 3 would be a o. My question is whats the best way to create a semi-decent game playing AI for my tic-tac-toe game? I don't really want to use minimax, since It's not what I need. So how do I avoid a a lot of if statments and make it more efficient. Here is the rest of my code: #include <stdio.h> #include <stdlib.h> #include <string.h> #include <time.h> struct state{ // defined int state; // 0 is tie, 1 is user loss, 2 is user win, 3 is ongoing game int moves; }; struct square{ // one square of the board int value; // 1 is x, 3 is o char sign; // no space used }; struct square s[9]; //set up the struct struct state gamestate = {0,0}; //nothing void setUpGame(){ // setup the game int i = 0; for(i = 0; i < 9; i++){ s[i].value = 0; s[i].sign = ' '; } gamestate.moves=0; printf("\nHi user! You're \"x\"! I'm \"o\"! Good Luck :)\n"); } void displayBoard(){// displays the game board printf("\n %c | %c | %c\n", s[6].sign, s[7].sign, s[8].sign); printf("-----------\n"); printf(" %c | %c | %c\n", s[3].sign, s[4].sign, s[5].sign); printf("-----------\n"); printf(" %c | %c | %c\n\n", s[0].sign, s[1].sign, s[2].sign); } void getHumanMove(){ // get move from human int i; while(1){ printf(">>:"); char line[255]; // input the move to play fgets(line, sizeof(line), stdin); while(sscanf(line, "%d", &i) != 1) { //1 match of defined specifier on input line printf("Sorry, that's not a valid move!\n"); fgets(line, sizeof(line), stdin); } if(s[i-1].value != 0){printf("Sorry, That moves already been taken!\n\n");continue;} break; } s[i-1].value = 1; s[i-1].sign = 'x'; gamestate.moves++; } int sum(int x, int y, int z){return(x*y*z);} void getCompMove(){ // get the move from the computer } void checkWinner(){ // check the winner int i; for(i = 6; i < 9; i++){ // check cols if((sum(s[i].value,s[i-3].value,s[i-6].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[i].value,s[i-3].value,s[i-6].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } for(i = 0; i < 7; i+=3){ // check rows if((sum(s[i].value,s[i+1].value,s[i+2].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[i].value,s[i+1].value,s[i+2].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } if((sum(s[0].value,s[4].value,s[8].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[0].value,s[4].value,s[8].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} if((sum(s[2].value,s[4].value,s[6].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[2].value,s[4].value,s[6].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } void playGame(){ // start playing the game gamestate.state = 3; //set-up the gamestate srand(time(NULL)); int temp = (rand()%2) + 1; if(temp == 2){ // if two comp goes first temp = (rand()%2) + 1; if(temp == 2){ s[4].value = 2; s[4].sign = 'o'; gamestate.moves++; }else{ s[2].value = 2; s[2].sign = 'o'; gamestate.moves++; } } displayBoard(); while(gamestate.state == 3){ if(gamestate.moves<10); getHumanMove(); if(gamestate.moves<10); getCompMove(); checkWinner(); if(gamestate.state == 3 && gamestate.moves==9){ printf("The game is a tie :p\n"); break; } displayBoard(); } } int main(int argc, const char *argv[]){ printf("Welcome to Tic Tac Toe\nby The Elite Noob\nEnter 1-9 To play a move, standard numpad\n1 is bottom-left, 9 is top-right\n"); while(1){ // while game is being played printf("\nPress 1 to play a new game, or any other number to exit;\n>>:"); char line[255]; // input whether or not to play the game fgets(line, sizeof(line), stdin); int choice; // user's choice about playing or not while(sscanf(line, "%d", &choice) != 1) { //1 match of defined specifier on input line printf("Sorry, that's not a valid option!\n"); fgets(line, sizeof(line), stdin); } if(choice == 1){ setUpGame(); // set's up the game playGame(); // Play a Game }else {break;} // exit the application } printf("\nThank's For playing!\nHave a good Day!\n"); return 0; }

Read the article

Panel is not displaying in JFrame

- by mallikarjun

I created a chat panel and added to Jframe but the panel is not displaying. But my sop in the chat panel are displaying in the console. Any one please let me know what could be the problem My Frame public class MyFrame extends JFrame { MyPanel chatClient; String input; public MyFrame() { input = (String)JOptionPane.showInputDialog(null, "Name:", "Connect to chat server", JOptionPane.QUESTION_MESSAGE, null,null, "Test"); input=input.trim(); chatClient = new MyPanel("localhost",input); setVisible(true); setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); add(chatClient); } public static void main(String...args){ new MyFrame(); } } MyPanel: public class MyPanel extends JPanel{ ChatClient chatClient; public MyPanel(String host, String uid) { chatClient= new ChatClient(host,uid); add(chatClient.getChatPanel()); this.setVisible(true); } } chat panel: public class ChatClient { Client client; String name; ChatPanel chatPanel; String hostid; public ChatClient(String host,String uid){ client = new Client(); client.start(); System.out.println("in constructor"); Network.register(client); client.addListener(new Listener(){ public void connected(Connection connection){ System.out.println("in client connected method"); Network.RegisterName registerName = new Network.RegisterName(); registerName.name=name; client.sendTCP(registerName); } public void received(Connection connection,Object object){ System.out.println("in client received method"); if (object instanceof Network.UpdateNames) { Network.UpdateNames updateNames = (Network.UpdateNames)object; //chatFrame.setNames(updateNames.names); System.out.println("got it message"); return; } if (object instanceof Network.ChatMessage) { Network.ChatMessage chatMessage = (Network.ChatMessage)object; //chatFrame.addMessage(chatMessage.text); System.out.println("send it message"); return; } } }); // end of listner name=uid.trim(); hostid=host.trim(); chatPanel = new ChatPanel(hostid,name); chatPanel.setSendListener(new Runnable(){ public void run(){ Network.ChatMessage chatMessage = new Network.ChatMessage(); chatMessage.chatMessage=chatPanel.getSendText(); client.sendTCP(chatMessage); } }); new Thread("connect"){ public void run(){ try{ client.connect(5000, hostid,Network.port); }catch(IOException e){ e.printStackTrace(); } } }.start(); }//end of constructor static public class ChatPanel extends JPanel{ CardLayout cardLayout; JList messageList,nameList; JTextField sendText; JButton sendButton; JPanel topPanel,bottomPanel,panel; public ChatPanel(String host,String user){ setSize(600, 200); this.setVisible(true); System.out.println("Chat panel "+host+"user: "+user); { panel = new JPanel(new BorderLayout()); { topPanel = new JPanel(new GridLayout(1,2)); panel.add(topPanel); { topPanel.add(new JScrollPane(messageList=new JList())); messageList.setModel(new DefaultListModel()); } { topPanel.add(new JScrollPane(nameList=new JList())); nameList.setModel(new DefaultListModel()); } DefaultListSelectionModel disableSelections = new DefaultListSelectionModel() { public void setSelectionInterval (int index0, int index1) { } }; messageList.setSelectionModel(disableSelections); nameList.setSelectionMode(ListSelectionModel.SINGLE_SELECTION); } { bottomPanel = new JPanel(new GridBagLayout()); panel.add(bottomPanel,BorderLayout.SOUTH); bottomPanel.add(sendText=new JTextField(),new GridBagConstraints(0,0,1,1,1,0,GridBagConstraints.CENTER,GridBagConstraints.BOTH,new Insets(0,0,0,0),0,0)); bottomPanel.add(sendButton=new JButton(),new GridBagConstraints(1,0,1,1,0,0,GridBagConstraints.CENTER,0,new Insets(0,0,0,0),0,0)); } } sendText.addActionListener(new ActionListener(){ public void actionPerformed(ActionEvent e){ sendButton.doClick(); } }); } public void setSendListener (final Runnable listener) { sendButton.addActionListener(new ActionListener() { public void actionPerformed (ActionEvent evt) { if (getSendText().length() == 0) return; listener.run(); sendText.setText(""); sendText.requestFocus(); } }); } public String getSendText () { return sendText.getText().trim(); } public void setNames (final String[] names) { EventQueue.invokeLater(new Runnable(){ public void run(){ DefaultListModel model = (DefaultListModel)nameList.getModel(); model.removeAllElements(); for(String name:names) model.addElement(name); } }); } public void addMessage (final String message) { EventQueue.invokeLater(new Runnable() { public void run () { DefaultListModel model = (DefaultListModel)messageList.getModel(); model.addElement(message); messageList.ensureIndexIsVisible(model.size() - 1); } }); } } public JPanel getChatPanel(){ return chatPanel; } }

Read the article

PROBLEM: PHP strip_tags & multi-dimensional array form parameter

- by Tunji Gbadamosi

I'm having problems stripping the tags from the textual inputs retrieved from my form so as to do something with them in checkout.php. The input is stored in a multi-dimensional array. Here's my form: echo '<form name="choose" action="checkout.php" method="post" onsubmit="return validate_second_form(this);">'; echo '<input type="hidden" name="hidden_value" value="'.$no_guests.'" />'; if($no_guests >= 1){ echo '<div class="volunteer">'; echo '<fieldset>'; echo '<legend>Volunteer:</legend>'; echo '<label>Table:</label>'; echo '<select name="volunteer_table">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="volunteer_seat">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; for($i=0;$i<$no_guests;$i++){ $guest = "guest_".$i; echo '<div class="'.$guest.'">'; echo '<fieldset>'; echo '<legend>Guest '.$i.':</legend>'; echo '<label>First Name:</label>'; echo '<input type="text" name="guest['.$i.']['.$first_name.']" id="fn'.$i.'">'; echo '<label>Surname:</label>'; echo '<input type="text" name="guest['.$i.']['.$surname.']" id="surname'.$i.'"><br><br>'; echo '<label>Date of Birth:</label> <br>'; echo '<label>Day:</label>'; echo '<select name="guest['.$i.'][dob_day]">'; for($j=1;$j<32;$j++){ echo"<option value='$j'>$j</option>"; } echo '</select>'; echo '<label>Month:</label>'; echo '<select name="guest['.$i.'][dob_month]">'; for($j=0;$j<sizeof($month);$j++){ $value = ($j + 1); echo"<option value='$value'>$month[$j]</option>"; } echo '</select>'; echo '<label>Year:</label>'; echo '<select name="guest['.$i.'][dob_year]">'; for($j=1900;$j<$year_limit;$j++){ echo"<option value='$j'>$j</option>"; } echo '</select> <br><br>'; echo '<label>Sex:</label>'; echo '<select name="guest['.$i.']['.$sex.']">'; echo '<option>Female</option>'; echo '<option>Male</option>'; echo '</select><br><br>'; echo '<label>Table:</label>'; echo '<select name="guest['.$i.']['.$table.']">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="guest['.$i.']['.$seat_no.']">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; } } else{ echo '<div id="volunteer">'; echo '<fieldset>'; echo '<legend>Volunteer:</legend>'; echo '<label>Table:</label>'; echo '<select name="volunteer['.$table.']">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="volunteer['.$seat_no.']">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; } echo '<input type="submit" value="Submit form">'; echo '</form>'; here's checkout.php: if(isset($_POST['guest'])){ foreach($_POST['guest'] as $guest){ $guest['first_name'] = strip_tags($guest['first_name']); $guest['surname'] = strip_tags($guest['surname']); } //$_SESSION['guest'] = $guests; }

Read the article

Saving a Join Model

- by Thorpe Obazee

I've been reading the cookbook for a while now and still don't get how I'm supposed to do this: My original problem was this: A related Model isn't being validated From RabidFire's commment: If you want to count the number of Category models that a new Post is associated with (on save), then you need to do this in the beforeSave function as I've mentioned. As you've currently set up your models, you don't need to use the multiple rule anywhere. If you really, really want to validate against a list of Category IDs for some reason, then create a join model, and validate category_id with the multiple rule there. Now, I have these models and are now validating. The problem now is that data isn't being saved in the Join Table: class Post extends AppModel { var $name = 'Post'; var $hasMany = array( 'CategoryPost' => array( 'className' => 'CategoryPost' ) ); var $belongsTo = array( 'Page' => array( 'className' => 'Page' ) ); class Category extends AppModel { var $name = 'Category'; var $hasMany = array( 'CategoryPost' => array( 'className' => 'CategoryPost' ) ); class CategoryPost extends AppModel { var $name = 'CategoryPost'; var $validate = array( 'category_id' => array( 'rule' => array('multiple', array('in' => array(1, 2, 3, 4))), 'required' => FALSE, 'message' => 'Please select one, two or three options' ) ); var $belongsTo = array( 'Post' => array( 'className' => 'Post' ), 'Category' => array( 'className' => 'Category' ) ); This is the new Form: <div id="content-wrap"> <div id="main"> <h2>Add Post</h2> <?php echo $this->Session->flash();?> <div> <?php echo $this->Form->create('Post'); echo $this->Form->input('Post.title'); echo $this->Form->input('CategoryPost.category_id', array('multiple' => 'checkbox')); echo $this->Form->input('Post.body', array('rows' => '3')); echo $this->Form->input('Page.meta_keywords'); echo $this->Form->input('Page.meta_description'); echo $this->Form->end('Save Post'); ?> </div>  </div> The data I am producing from the form is as follows: Array ( [Post] => Array ( [title] => 1234 [body] => 1234 ) [CategoryPost] => Array ( [category_id] => Array ( [0] => 1 [1] => 2 ) ) [Page] => Array ( [meta_keywords] => 1234 [meta_description] => 1234 [title] => 1234 [layout] => index ) ) UPDATE: controller action //Controller action function admin_add() { // pr(Debugger::trace()); $this->set('categories', $this->Post->CategoryPost->Category->find('list')); if ( ! empty($this->data)) { $this->data['Page']['title'] = $this->data['Post']['title']; $this->data['Page']['layout'] = 'index'; debug($this->data); if ($this->Post->saveAll($this->data)) { $this->Session->setFlash('Your post has been saved', 'flash_good'); $this->redirect($this->here); } } } UPDATE #2: Should I just do this manually? The problem is that the join tables doesn't have things saved in it. Is there something I'm missing? UPDATE #3 RabidFire gave me a solution. I already did this before and am quite surprised as so why it didn't work. Thus, me asking here. The reason I think there is something wrong. I don't know where: Post beforeSave: function beforeSave() { if (empty($this->id)) { $this->data[$this->name]['uri'] = $this->getUniqueUrl($this->data[$this->name]['title']); } if (isset($this->data['CategoryPost']['category_id']) && is_array($this->data['CategoryPost']['category_id'])) { echo 'test'; $categoryPosts = array(); foreach ($this->data['CategoryPost']['category_id'] as $categoryId) { $categoryPost = array( 'category_id' => $categoryId ); array_push($categoryPosts, $categoryPost); } $this->data['CategoryPost'] = $categoryPosts; } debug($this->data); // Gives RabidFire's correct array for saving. return true; } My Post action: function admin_add() { // pr(Debugger::trace()); $this->set('categories', $this->Post->CategoryPost->Category->find('list')); if ( ! empty($this->data)) { $this->data['Page']['title'] = $this->data['Post']['title']; $this->data['Page']['layout'] = 'index'; debug($this->data); // First debug is giving the correct array as above. if ($this->Post->saveAll($this->data)) { debug($this->data); // STILL gives the above array. which shouldn't be because of the beforeSave in the Post Model // $this->Session->setFlash('Your post has been saved', 'flash_good'); // $this->redirect($this->here); } } }

Read the article

jQuery getting these functions to work together

- by brett

I'm new to jQuery and have tried looking around for an answer on how to do this. I have 2 functions and I would like both to work together. The one function is submitHandler and its used to hide a form and at the same time add a class to a hidden element to unhide it - ie a thank you for submitting h1. The other function is to grab the input data and display it onsubmit in the form. So the problem is that I can get that one to work but then the other doesnt. Ie on form submit I can see the data input but not the h1 Thank you message. Here are the functions: SubmitHandler: submitHandler: function() { $("#content").empty(); $("#content").append( "<p>If you want to be kept in the loop...</p>" + "<p>Or you can contact...</p>" ); $('h1.success_').removeClass('success_').addClass('success_form'); $('#contactform').hide(); }, onsubmit="return inputdata()" function inputdata(){ var usr = document.getElementById('contactname').value; var eml = document.getElementById('email').value; var msg = document.getElementById('message').value; document.getElementById('out').innerHTML = usr + " " + eml + msg; document.getElementById('out').style.display = "block"; return true; }, The form uses PHP and jQuery - I dont know about AJAX but after some reading even less sure. Please help me out I dont know what I'm doing and at the moment I am learning but its a long road for me still. Thank you The form: <form method="post" action="<?php echo $_SERVER['PHP_SELF']; ?>" id="contactform" onsubmit="return inputdata()"> <div class="_required"><p class="label_left">Name*</p><input type="text" size="50" name="contactname" id="contactname" value="" class="required" /></div><br/><br/> <div class="_required"><p class="label_left">E-mail address*</p><input type="text" size="50" name="email" id="email" value="" class="required email" /></div><br/><br/> <p class="label_left">Message</p><textarea rows="5" cols="50" name="message" id="message" class="required"></textarea><br/> <input type="submit" value="submit" name="submit" id="submit" /> </form> The PHP bit: <?php $subject = "Website Contact Form Enquiry"; //If the form is submitted if(isset($_POST['submit'])) { //Check to make sure that the name field is not empty if(trim($_POST['contactname']) == '') { $hasError = true; } else { $name = trim($_POST['contactname']); } //Check to make sure sure that a valid email address is submitted if(trim($_POST['email']) == '') { $hasError = true; } else if (!eregi("^[A-Z0-9._%-]+@[A-Z0-9._%-]+\.[A-Z]{2,4}$", trim($_POST['email']))) { $hasError = true; } else { $email = trim($_POST['email']); } //Check to make sure comments were entered if(trim($_POST['message']) == '') { $hasError = true; } else { if(function_exists('stripslashes')) { $comments = stripslashes(trim($_POST['message'])); } else { $comments = trim($_POST['message']); } } //If there is no error, send the email if(!isset($hasError)) { $emailTo = '[email protected]'; //Put your own email address here $body = "Name: $name \n\nEmail: $email \n\nComments:\n $comments"; $headers = 'From: My Site <'.$emailTo.'>' . "\r\n" . 'Reply-To: ' . $email; mail($emailTo, $subject, $body, $headers); $emailSent = true; } } ? The Jquery Validate bit: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, Here is the full jQuery bit: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, submitHandler: function() { $('h1.success_').removeClass('success_').addClass('success_form'); $("#content").empty(); $("#content").append('#sadhu'); $('#contactform').hide(); }, }); }); Latest edit - Looks like this: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, function submitHandler() { $('h1.success_').removeClass('success_').addClass('success_form'); $("#content").empty(); $("#content").append('#sadhu'); $('#contactform').hide(); }, function inputdata() { var usr = document.getElementById('contactname').value; var eml = document.getElementById('email').value; var msg = document.getElementById('message').value; document.getElementById('out').innerHTML = usr + " " + eml + msg; document.getElementById('out').style.display = "block"; }, $(document).ready(function(){ $('#contactForm').submit(function() { inputdata(); submitHandler(); }); }); });

Read the article

how to validate the form using jquery

- by kumar

I have this Fieldset values.. <fieldset class="clearfix" id="fieldset-exception"> <legend>Mass Edit Exception Information</legend> <div id="#error-msg-ID" class="ui-widget hide"> <div class="ui-state-highlight ui-corner-all"> <p><span style="float: left; margin-right: 0.3em;" class="ui-icon ui-icon-info"></span> <span></span></p> </div> </div> <div class="fiveper"> <label for="ExceptionStatus"> Status: <span> </span> </label> <label for="ResolutionCode"> Resolution: <span> <%=Html.DropDownListFor(model => model.Exception.ResolutionCode, new SelectList(Model.LookupCodes["C_EXCPT_RESL"], "Key", "Value"))%> </span> </label> <label for="ReasonCode"> Reason: <span><%=Html.DropDownListFor(model => model.Exception.ReasonCode, new SelectList(Model.LookupCodes["C_EXCPT_RSN"], "Key", "Value"))%></span> </label> <label for="ExceptionStatus"> Action Taken: <span><%=Html.DropDownListFor(model => model.Exception.ActionCode, new SelectList(Model.LookupCodes["C_EXCPT_ACT"], "Key", "Value"))%></span> </label> </div> <div class="fiveper"> <label for="FollowupDate"> Follow-up: <span><input type="text" id="exc-flwup" name="fdate" /></span> <%--<%=Html.EditorFor(model=>model.Exception.FollowupDate) %>--%> </label> <label for="IOL"> Inquiry #: <%=Html.TextBox("Inquiry", ViewData["inq"] ?? "")%> </label> <label>Comment</label> <span> <%=Html.TextArea("value", ViewData["Comnt"] ?? "")%> <%=Html.ValidationMessage("value")%> </span> </div> <br /> <br /> <div> <input type="submit" class="button" value="Save" /> </div> </fieldset> before submiting I need to do some time of validation..below validation not working for me is that right what I am doing here? These all fieds user is entering from UI.. thanks <script type="text/javascript"> $(document).ready(function() { $('#btnSelectAll').click(function() { $('#EditExceptions input[name=chk]').attr('checked', true); }); $('#btnCancel').click(function() { $('#EditExceptions input[name=chk]').attr('checked',false); }); function validate_excpt(formData, jqForm, options) { var form = jqForm[0]; **if (form.e_Exception_ResolutionCode.value && !form.e_Exception_ReasonCode.value) { alert('All Resolution Codes need a Reason Code.'); return false; }** } // post-submit callback function showResponse(responseText, statusText, xhr, $form) { if (responseText[0].substring(0, 16) != "System.Exception") { $('#error-msg-ID span:last').html('<strong>Update successful.</strong>'); $().ShowDialog('Success', 'Update successful'); } else { $('#error-msg-ID span:last').html('<strong>Update failed.</strong> ' + responseText[0].substring(0, 48)); $().ShowDialog('Failed', 'Update failed'); } $('#error-msg-ID').removeClass('hide'); $('#gui-stat-').html(responseText[1]); } $('#exc-').ajaxForm({ beforeSubmit: validate_excpt, success: showResponse, dataType: 'json' }); $('.button').button(); $("input[id^='exc-flwup']").datepicker({ duration: '', showTime: true, constrainInput: true, stepMinutes: 30, stepHours: 1, altTimeField: '', time24h: true, minDate: 0 }); $('#ui-timepicker-div').bgiframe(); }); </script>

Read the article

Json / Jsonp not connecting to php (Phonegap + jquerymobile)

- by Madhulika Mukherjee

I am trying to make - an android WEB application with phonegap layout with JqueryMobile What Im doing - An html form that takes ID, name, and address as input 'Serialize's this data using ajax makes a json object out of it Should send it to a file called 'connection.php' Where, this data is put into a database (MySql) Other details - My server is localhost, Im using xampp I have already created a database and table using phpmyadmin The problem - My html file, where my json object is created, does not connect to the php file which is hosted by my localhost Here is my COMPLETE html file: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01//EN" "http://www.w3.org/TR/html4/strict.dtd"> <html> <head>  <meta name="viewport" content="width=default-width; user-scalable=no" /> <meta http-equiv="Content-type" content="text/html;charset=utf-8"> <title>Trial app</title> <link rel="stylesheet" href="thestylesheet.css" type="text/css"> <script type="text/javascript" charset="utf-8" src="javascript1.js"></script> <script type="text/javascript" charset="utf-8" src="javascript2.js"></script> <script type="text/javascript" charset="utf-8" src="cordova-1.8.0.js"></script> <script> $(document).ready(function () { $("#btn").click( function() { alert('hello hello'); $.ajax({ url: "connection.php", type: "POST", data: { id: $('#id').val(), name: $('#name').val(), Address: $('#Address').val() }, datatype: "json", success: function (status) { if (status.success == false) { alert("Failure!"); } else { alert("Success!"); } } }); }); }); </script> </head> <body> <div data-role="header"> <h1>Heading of the app</h1> </div> <div data-role="content"> <form id="target" method="post"> <label for="id"> <input type="text" id="id" placeholder="ID"> </label> <label for="name"> <input type="text" id="name" placeholder="Name"> </label> <label for="Address"> <input type="text" id="Address" placeholder="Address"> </label> <div id="btn" data-role="button" data-icon="star" data-theme="e">Add record</div>  </form> </div> </body> </html> And here is my 'connection.php' hosted by my localhost <?php header('Content-type: application/json'); $server = "localhost"; $username = "root"; $password = ""; $database = "jqueryex"; $con = mysql_connect($server, $username, $password); if($con) { echo "Connected to database!"; } else { echo "Could not connect!"; } //or die ("Could not connect: " . mysql_error()); mysql_select_db($database, $con); /* CREATE TABLE `sample` ( `id` int(11) unsigned NOT NULL AUTO_INCREMENT, `name` varchar(45) DEFAULT NULL, `Address` varchar(45) DEFAULT NULL, PRIMARY KEY (`id`) ) */ $id= json_decode($_POST['id']); $name = json_decode($_POST['name']); $Address = json_decode($_POST['Address']); $sql = "INSERT INTO sample (id, name, Address) "; $sql .= "VALUES ($id, '$name', '$Address')"; if (!mysql_query($sql, $con)) { die('Error: ' . mysql_error()); } else { echo "Comment added"; } mysql_close($con); ?> My doubts: No entry is made in my table 'sample' when i view it in phpmyadmin So obviously, i see no success messages either I dont get any errors, not from ajax and neither from the php file. Stuff Im suspecting: Should i be using jsonp instead of json? Im new to this. Is there a problem with my php file? Perhaps I need to include some more javascript files in my html file? I assume this is a very simple problem so please help me out! I think there is just some conceptual error, as i have only just started with jquery, ajax, and json. Thank you.

Read the article

Jquery returns index -1 always

- by jfreak53

This is my index code that I use to return the buttons parent div's index: j('#optionform').index( j(this).parent() ) I'm trying to find out the DIV index of the button clicked, so I can remove the DIV. The HTML layout is like so: <form id="optionform" onsubmit="return false;"> <label><input type="checkbox" id="s_name" value="s_name"> Survey Name </label> <label><input type="checkbox" id="s_type" value="s_type"> Survey Type </label><br> Filter Results:<br> <div id="template" style="display: none;"> Column: <select id="fcolumn[]"> <option></option> <option value="s_name">Survey Name</option> <option value="s_type">Survey Type</option> </select><br> Filter Type: <select id="ftype[]"> <option></option> <option value="=">Equals</option> <option value="LIKE">Like</option> </select><br> Filter content: <input type="text" id="fcontent[]"><br> <img src="images/add.png" width="32px" onclick="addTemp(); return false;"> <img src="images/delete.png" width="32px" onclick="alert(j(this).attr('src')); remTemp(j('#optionform').index( j(this).parent() )); return false;"> </div> <div class="template" style="display: block;"> Column: <select id="fcolumn[]"> <option></option> <option value="s_name">Survey Name</option> <option value="s_type">Survey Type</option> </select><br> Filter Type: <select id="ftype[]"> <option></option> <option value="=">Equals</option> <option value="LIKE">Like</option> </select><br> Filter content: <input type="text" id="fcontent[]"><br> <img src="images/add.png" width="32px" onclick="addTemp(); return false;"> <img src="images/delete.png" width="32px" onclick="alert(j(this).attr('src')); remTemp(j('#optionform').index( j(this).parent() )); return false;"> </div> <div class="template" style="display: block;"> Column: <select id="fcolumn[]"> <option></option> <option value="s_name">Survey Name</option> <option value="s_type">Survey Type</option> </select><br> Filter Type: <select id="ftype[]"> <option></option> <option value="=">Equals</option> <option value="LIKE">Like</option> </select><br> Filter content: <input type="text" id="fcontent[]"><br> <img src="images/add.png" width="32px" onclick="addTemp(); return false;"> <img src="images/delete.png" width="32px" onclick="alert(j(this).attr('src')); remTemp(j('#optionform').index( j(this).parent() )); return false;"> </div> </form> But it always returns -1 in the index.

Read the article

Mistake in display and insert methods (double-ended queue)

- by MANAL

1) My problem when i make remove from right or left program will be remove true but when i call diplay method the content wrong like this I insert 12 43 65 23 and when make remove from left program will remove 12 but when call display method show like this 12 43 65 and when make remove from right program will remove 23 but when call display method show like this 12 43 Why ?????? ); and when i try to make insert after remove write this Can not insert right because the queue is full . first remove right and then u can insert right where is the problem ?? Please Help me please 2) My code FIRST CLASS class dqueue { private int fullsize; //number of all cells private int item_num; // number of busy cells only private int front,rear; public int j; private double [] dqarr; //========================================== public dqueue(int s) //constructor { fullsize = s; front = 0; rear = -1; item_num = 0; dqarr = new double[fullsize]; } //========================================== public void insert(double data) { if (rear == fullsize-1) rear = -1; rear++; dqarr[rear] = data; item_num++; } public double removeLeft() // take item from front of queue { double temp = dqarr[front++]; // get value and incr front if(front == fullsize) front = 0; item_num --; // one less item return temp; } public double removeRight() // take item from rear of queue { double temp = dqarr[rear--]; // get value and decr rear if(rear == -1) // rear = item_num -1; item_num --; // one less item return temp; } //========================================= public void display () //display items { for (int j=0;j<item_num;j++) // for every element System.out.print(dqarr[j] +" " ); // display it System.out.println(""); } //========================================= public int size() //number of items in queue { return item_num; } //========================================== public boolean isEmpty() // true if queue is empty { return (item_num ==0); } } SECOND CLASS import java.util.Scanner; class dqueuetest { public static void main(String[] args) { Scanner input = new Scanner(System.in); System.out.println(" ***** Welcome here***** "); System.out.println(" ***** Mind Of Programming Group***** "); System.out.println(" _____________________________________________ "); System.out.println("enter size of your dqueue"); int size = input.nextInt(); dqueue mydq = new dqueue(size); System.out.println(""); System.out.println("enter your itemes"); //===================================== for(int i = 0;i<=size-1;i++) { System.out.printf("item %d:",i+1); double item = input.nextDouble(); mydq.insert(item); System.out.println(""); } //===================================== int queue =size ; int c = 0 ; while (c != 6) { System.out.println(""); System.out.println("************************************************"); System.out.println(" MAIN MENUE"); System.out.println("1- INSERT RIGHT "); System.out.println("2- REMOVE LEFT"); System.out.println("3- REMOVE RIGHT"); System.out.println("4- DISPLAY"); System.out.println("5- SIZE"); System.out.println("6- EXIT"); System.out.println("************************************************"); System.out.println("choose your operation by number(1-6)"); c = input.nextInt(); switch (c) { case 1: if (queue == size) System.out.print("Can not insert right because the queue is full . first remove right and then u can insert right "); else { System.out.print("enter your item: "); double item = input.nextDouble(); mydq.insert(item);} break; case 2: System.out.println("REMOVE FROM REAR :"); if( !mydq.isEmpty() ) { double item = mydq.removeLeft(); System.out.print(item + "\t"); } // end while System.out.println(""); mydq.display(); break; case 3: System.out.println("REMOVE FROM FRONT :"); if( !mydq.isEmpty() ) { double item = mydq.removeRight(); System.out.print(item + "\t"); } // end while System.out.println(""); mydq.display(); break; case 4: System.out.println("The items in Queue are :"); mydq.display(); break; case 5: System.out.println("The Size of the Queue is :"+mydq.size()); break; case 6: System.out.println("Good Bye"); break; default: System.out.println("wrong chiose enter again"); } //end switch } //end while } // end main }//end class

Read the article

strange behavior while including a class in php

- by user1864539

I'm experiencing a strange behavior with PHP. Basically I want to require a class within a PHP script. I know it is straight forward and I did it before but when I do so, it change the behavior of my jquery (1.8.3) ajax response. I'm running a wamp setup and my PHP version is 5.4.6. Here is a sample as for my index.html head (omitting the jquery js include) <script> $(document).ready(function(){ $('#submit').click(function(){ var action = $('#form').attr('action'); var form_data = { fname: $('#fname').val(), lname: $('#lname').val(), phone: $('#phone').val(), email: $('#email').val(), is_ajax: 1 }; $.ajax({ type: $('#form').attr('method'), url: action, data: form_data, success: function(response){ switch(response){ case 'ok': var msg = 'data saved'; break; case 'ko': var msg = 'Oops something wrong happen'; break; default: var msg = 'misc:<br/>'+response; break; } $('#message').html(msg); } }); return false; }); }); </script> body <div id="message"></div> <form id="form" action="handler.php" method="post"> <p> <input type="text" name="fname" id="fname" placeholder="fname"> <input type="text" name="lname" id="lname" placeholder="lname"> </p> <p> <input type="text" name="phone" id="phone" placeholder="phone"> <input type="text" name="email" id="email" placeholder="email"> </p> <input type="submit" name="submit" value="submit" id="submit"> </form> And as for the handler.php file: <?php require('class/Container.php'); $filename = 'xml/memory.xml'; $is_ajax = $_REQUEST['is_ajax']; if(isset($is_ajax) && $is_ajax){ $fname = $_REQUEST['fname']; $lname = $_REQUEST['lname']; $phone = $_REQUEST['phone']; $email = $_REQUEST['email']; $obj = new Container; $obj->insertData('fname',$fname); $obj->insertData('lname',$lname); $obj->insertData('phone',$phone); $obj->insertData('email',$email); $tmp = $obj->give(); $result = $tmp['_obj']; /* Push data inside array */ $array = array(); foreach($result as $key => $value){ array_push($array,$key,$value); } $xml = simplexml_load_file($filename); // check if there is any data in if(count($xml->elements->data) == 0){ // if not, create the structure $xml->elements->addChild('data',''); } // proceed now that we do have the structure if(count($xml->elements->data) == 1){ foreach($result as $key => $value){ $xml->elements->data->addChild($key,$value); } $xml->saveXML($filename); echo 'ok'; }else{ echo 'ko'; } } ? The Container class: <?php class Container{ private $_obj; public function __construct(){ $this->_obj = array(); } public function addData($data = array()){ if(!empty($data)){ $oldData = $this->_obj; $data = array_merge($oldData,$data); $this->_obj = $data; } } public function removeData($key){ if(!empty($key)){ $oldData = $this->_obj; unset($oldData[$key]); $this->_obj = $oldData; } } public function outputData(){ return $this->_obj; } public function give(){ return get_object_vars($this); } public function insertData($key,$value){ $this->_obj[$key] = $value; } } ? The strange thing is that my result always fall under the default switch statement and the ajax response fit both present statement. I noticed then if I just paste the Container class on the top of the handler.php file, everything works properly but it kind of defeat what I try to achieve. I tried different way to include the Container class but it seem to be than the issue is specific to this current scenario. I'm still learning PHP and my guess is that I'm missing something really basic. I also search on stackoverflow regarding the issue I'm experiencing as well as PHP.net, without success. Regards,

Read the article

$.post is not working

- by BEBO

i am trying to post data to Mysql using jquery $.post and php page. my code is not running and nothing is added to the mysql table. I am not sure if the path i am creating is wrong but any help would be appreciated. Jquery location: f_js/tasks/TaskTest.js <script type="text/javascript"> $(document).ready(function(){ $("#AddTask").click(function(){ var acct = $('#acct').val(); var quicktask = $('#quicktask').val(); var user = $('#user').val(); $.post('addTask.php',{acct:acct,quicktask:quicktask,user:user}, function(data){ $('#result').fadeIn('slow').html(data); }); }); }); </script> addTask.php (runs the jqeury code) <?php include 'dbconnect.php'; include 'sessions.php'; $acct = $_POST['acct']; $task = $_POST['quicktask']; $taskstatus = 'Active'; //get task Creator $user = $_POST['user']; //query task creator from users table $allusers = mysql_query("SELECT * FROM users WHERE username = '$user'"); while ($rows = mysql_fetch_array($allusers)) { //get first and last name for task creator $taskOwner = $rows['user_firstname']; $taskOwnerLast = $rows['user_lastname']; $taskOwnerFull = $taskOwner." ".$taskOwnerLast; mysql_query("INSERT INTO tasks (taskresource, tasktitle, taskdetail, taskstatus, taskowner, taskOwnerFullName) VALUES ('$acct', '$task', '$task', '$taskstatus', '$user', '$taskOwnerFull' )"); echo "inserted"; } ?> Accountview.php finally the front page <html> <div class="input-cont "> <input type="text" class="form-control col-lg-12" placeholder="Add a quick Task..." name ="quicktask" id="quicktask"> </div> <div class="form-group"> <div class="pull-right chat-features"> <a href="javascript:;"> <i class="icon-camera"></i> </a> <a href="javascript:;"> <i class="icon-link"></i> </a> <input type="button" class="btn btn-danger" name="AddTask" id="AddTask" value="Add" /> <input type="hidden" name="acct" id="acct" value="<?php echo $_REQUEST['acctname']?>"/> <input type="hidden" name="user" id="user" value="<?php $username = $_SESSION['username']; echo $username?>"/> <div id="result">result</div> </div> </div>  <script src="js/jquery.js"></script> <script src="f_js/tasks/TaskTest.js"></script>  <script src="js/common-scripts.js"></script> <script type="text/javascript" src="assets/gritter/js/jquery.gritter.js"></script> <script src="js/gritter.js" type="text/javascript"></script> <script> </html> Firebug reponse: Response Headers Connection Keep-Alive Content-Length 0 Content-Type text/html Date Fri, 08 Nov 2013 21:48:50 GMT Keep-Alive timeout=5, max=100 Server Apache/2.4.4 (Win32) OpenSSL/0.9.8y PHP/5.4.16 X-Powered-By PHP/5.4.16 refresh 5; URL=index.php Request Headers Accept */* Accept-Encoding gzip, deflate Accept-Language en-US,en;q=0.5 Content-Length 13 Content-Type application/x-www-form-urlencoded; charset=UTF-8 Cookie PHPSESSID=6gufl3guiiddreg8cdlc0htnc6 Host localhost Referer http://localhost/betahtml/AccountView.php?acctname=client%201 User-Agent Mozilla/5.0 (Windows NT 6.3; WOW64; rv:25.0) Gecko/20100101 Firefox/25.0 X-Requested-With XMLHttpRequest

Read the article

How to delete object with a mouse click ?

- by Meko

Hi all. I made a simple FlowChat Editor that creates rectangles and triangles and connects them to each other and shows the way from up to down. I can move this elements on screen too. I am now trying to create a button to delete the element which I clicked. There is problem that I can delete MyTriangle objects, but I can't delete MyRectangle objects. It deletes but not object which I clicked. I delete from first object to last. Here is my code: if (deleteObj) { if (rectsList.size() != 0) { for (int i = 0; i < rectsList.size(); i++) { MyRect rect = (MyRect) rectsList.get(i); if (e.getX() <= rect.c.x + 50 && e.getX() >= rect.c.x - 50 && e.getY() <= rect.c.y + 15 && e.getY() >= rect.c.y - 15) { rectsList.remove(rect); System.out.println("This is REctangle DELETED\n"); } } } if (triangleList.size() != 0) { for (int j = 0; j < triangleList.size(); j++) { MyTriangle trian = (MyTriangle) triangleList.get(j); if (e.getX() <= trian.c.x + 20 && e.getX() >= trian.c.x - 20 && e.getY() <= trian.c.y + 20 && e.getY() >= trian.c.y - 20) { triangleList.remove(trian); System.out.println("This is Triangle Deleted\n"); } } } Edit Here MyRectangle and MyTriangle classes public class MyRect extends Ellipse2D.Double { Point c; Point in; Point out; int posX; int posY; int width = 100; int height = 30; int count; public MyRect(Point center, Point input, Point output,int counter) { c = center; in = input; out = output; count=counter; } void drawMe(Graphics g) { // in.x=c.x+20; int posX = c.x; int posY = c.y; int posInX = in.x; int posInY = in.y; int posOutX = out.x; int posOutY = out.y; g.setColor(Color.MAGENTA); g.drawString(" S "+count ,posX-5, posY+5); g.setColor(Color.black); g.drawRect(posX-50, posY-15, width, height); g.setColor(Color.green); g.drawRect(posInX-3, posInY-9, 6, 6); g.setColor(Color.blue); g.drawRect(posOutX-3, posOutY+3, 6, 6); } } public class MyTriangle { Point c; Point in ; Point outYES ; Point outNO ; int posX; int posY; int count; public MyTriangle(Point center,Point input,Point outputYES,Point outputNO,int counter) { c = center; in = input; outYES = outputYES; outNO = outputNO; count=counter; } void drawMe(Graphics g) { int posX = c.x; int posY = c.y; int posInX=in.x; int posInY=in.y; int posOutYESX=outYES.x; int posOutYESY=outYES.y; int posOutNOX=outNO.x; int posOutNOY=outNO.y; int[] xPoints = {posX - 50, posX, posX + 50, posX}; int[] yPoints = {posY, posY - 30, posY, posY + 30}; g.setColor(Color.MAGENTA); g.drawString(" T "+count,posX-5, posY+5); g.setColor(Color.black); g.drawPolygon(xPoints, yPoints, 4); // draw input g.setColor(Color.green); g.drawRect(posInX-3,posInY-9, 6, 6); g.setColor(Color.blue); g.drawRect(posOutYESX-9,posOutYESY-3 , 6, 6); g.setColor(Color.red); g.drawRect(posOutNOX-3,posOutNOY+3 , 6, 6); } }

Read the article

Mistake in dispaly and insert method (double - ended queue)

- by MANAL

1) My problem when i make remove from right or left program will be remove true but when i call diplay method the content wrong like this I insert 12 43 65 23 and when make remove from left program will remove 12 but when call display method show like this 12 43 65 and when make remove from right program will remove 23 but when call display method show like this 12 43 Why ?????? ); and when i try to make insert after remove write this Can not insert right because the queue is full . first remove right and then u can insert right where is the problem ?? Please Help me please 2) My code FIRST CLASS class dqueue { private int fullsize; //number of all cells private int item_num; // number of busy cells only private int front,rear; public int j; private double [] dqarr; //========================================== public dqueue(int s) //constructor { fullsize = s; front = 0; rear = -1; item_num = 0; dqarr = new double[fullsize]; } //========================================== public void insert(double data) { if (rear == fullsize-1) rear = -1; rear++; dqarr[rear] = data; item_num++; } public double removeLeft() // take item from front of queue { double temp = dqarr[front++]; // get value and incr front if(front == fullsize) front = 0; item_num --; // one less item return temp; } public double removeRight() // take item from rear of queue { double temp = dqarr[rear--]; // get value and decr rear if(rear == -1) // rear = item_num -1; item_num --; // one less item return temp; } //========================================= public void display () //display items { for (int j=0;j //========================================= public int size() //number of items in queue { return item_num; } //========================================== public boolean isEmpty() // true if queue is empty { return (item_num ==0); } } SECOND CLASS import java.util.Scanner; class dqueuetest { public static void main(String[] args) { Scanner input = new Scanner(System.in); System.out.println(" Welcome here** "); System.out.println(" * Mind Of Programming Group*** "); System.out.println(" _________________________ "); System.out.println("enter size of your dqueue"); int size = input.nextInt(); dqueue mydq = new dqueue(size); System.out.println(""); System.out.println("enter your itemes"); //===================================== for(int i = 0;i<=size-1;i++) { System.out.printf("item %d:",i+1); double item = input.nextDouble(); mydq.insert(item); System.out.println(""); } //===================================== int queue =size ; int c = 0 ; while (c != 6) { System.out.println(""); System.out.println("**************************"); System.out.println(" MAIN MENUE"); System.out.println("1- INSERT RIGHT "); System.out.println("2- REMOVE LEFT"); System.out.println("3- REMOVE RIGHT"); System.out.println("4- DISPLAY"); System.out.println("5- SIZE"); System.out.println("6- EXIT"); System.out.println("**************************"); System.out.println("choose your operation by number(1-6)"); c = input.nextInt(); switch (c) { case 1: if (queue == size) System.out.print("Can not insert right because the queue is full . first remove right and then u can insert right "); else { System.out.print("enter your item: "); double item = input.nextDouble(); mydq.insert(item);} break; case 2: System.out.println("REMOVE FROM REAR :"); if( !mydq.isEmpty() ) { double item = mydq.removeLeft(); System.out.print(item + "\t"); } // end while System.out.println(""); mydq.display(); break; case 3: System.out.println("REMOVE FROM FRONT :"); if( !mydq.isEmpty() ) { double item = mydq.removeRight(); System.out.print(item + "\t"); } // end while System.out.println(""); mydq.display(); break; case 4: System.out.println("The items in Queue are :"); mydq.display(); break; case 5: System.out.println("The Size of the Queue is :"+mydq.size()); break; case 6: System.out.println("Good Bye"); break; default: System.out.println("wrong chiose enter again"); } //end switch } //end while } // end main }//end class

Read the article

Backbone.js Model validation fails to prevent Model from saving

- by Benjen

I have defined a validate method for a Backbone.js Model. The problem is that even if validation fails (i.e. the Model.validate method returns a value) the post/put request is still sent to the server. This contradicts what is explained in the Backbone.js documentation. I cannot understand what I am doing wrong. The following is the Model definition: /** * Model - Contact */ var Contact = Backbone.Model.extend({ urlRoot: '/contacts.json', idAttribute: '_id', defaults: function() { return { surname: '', given_name: '', org: '', phone: new Array(), email: new Array(), address: new Array({ street: '', district: '', city: '', country: '', postcode: '' }) }; } validate: function(attributes) { if (typeof attributes.validationDisabled === 'undefined') { var errors = new Array(); // Validate surname. if (_.isEmpty(attributes.surname) === true) { errors.push({ type: 'form', attribute: 'surname', message: 'Please enter a surname.' }); } // Validate emails. if (_.isEmpty(attributes.email) === false) { var emailRegex = /^[a-z0-9._%+-]+@[a-z0-9.-]+\.[a-z]{2,6}$/i; // Stores indexes of email values which fail validation. var emailIndex = new Array(); _.each(attributes.email, function(email, index) { if (emailRegex.test(email.value) === false) { emailIndex.push(index); } }); // Create error message. if (emailIndex.length > 0) { errors.push({ type: 'form', attribute: 'email', index: emailIndex, message: 'Please enter valid email address.' }); } } if (errors.length > 0) { console.log('Form validation failed.'); return errors; } } } }); Here is the View which calls the Model.save() method (see: method saveContact() below). Note that other methods belonging to this View have not been included below for reasons of brevity. /** * View - Edit contact form */ var EditContactFormView = Backbone.View.extend({ initialize: function() { _.bindAll(this, 'createDialog', 'formError', 'render', 'saveContact', 'updateContact'); // Add templates. this._editFormTemplate = _.template($('#edit-contact-form-tpl').html()); this._emailFieldTemplate = _.template($('#email-field-tpl').html()); this._phoneFieldTemplate = _.template($('#phone-field-tpl').html()); // Get URI of current page. this.currentPageUri = this.options.currentPageUri; // Create array to hold references to all subviews. this.subViews = new Array(); // Set options for new or existing contact. this.model = this.options.model; // Bind with Model validation error event. this.model.on('error', this.formError); this.render(); } /** * Deals with form validation errors */ formError: function(model, error) { console.log(error); }, saveContact: function(event) { var self = this; // Prevent submit event trigger from firing. event.preventDefault(); // Trigger form submit event. eventAggregator.trigger('submit:contactEditForm'); // Update model with form values. this.updateContact(); // Enable validation for Model. Done by unsetting validationDisabled // attribute. This setting was formerly applied to prevent validation // on Model.fetch() events. See this.model.validate(). this.model.unset('validationDisabled'); // Save contact to database. this.model.save(this.model.attributes, { success: function(model, response) { if (typeof response.flash !== 'undefined') { Messenger.trigger('new:messages', response.flash); } }, error: function(model, response) { console.log(response); throw error = new Error('Error occured while trying to save contact.'); } }, { wait: true }); }, /** * Extract form values and update Contact. */ updateContact: function() { this.model.set('surname', this.$('#surname-field').val()); this.model.set('given_name', this.$('#given-name-field').val()); this.model.set('org', this.$('#org-field').val()); // Extract address form values. var address = new Array({ street: this.$('input[name="street"]').val(), district: this.$('input[name="district"]').val(), city: this.$('input[name="city"]').val(), country: this.$('input[name="country"]').val(), postcode: this.$('input[name="postcode"]').val() }); this.model.set('address', address); } });

Read the article

jquery .append() not working for my html

- by user1056998

I have a program which appends an input(type="hidden") using jquery, to an html so that when I click the submit button, it passes the value to a php file and I can process it. However, it seems that the hidden type is not really being appended to the html nor it is being passed to the php file. I already used method="get" to see the values in the address bar and print_r to see the values being catched but there's nothing. To check if my form is actually passing a value, I added a <input type="hidden" name="absent[]" value="testing" /> in the HTML and the value got passed but the ones in the jquery aren't. Here are my files: jquery: $(function(){ $("td").click(function(){ if($(this).hasClass("on")) { alert("Already marked absent"); } else { $(this).addClass("on"); var currentCellText = $(this).text(); var temp = $(this).attr('id'); $("#collect").append("<input type='hidden' name='absent[]' value = '" + temp + "'/>" + currentCellText); alert(temp); } }); $("#clicky").click(function(){ $("td").removeClass("on"); $("#collect").text(''); $("#collect").append("Absentees: <br>") alert(temp); }); }); Here is the html part: <?php session_start(); include 'connectdb.php'; $classID = $_SESSION['csID']; $classQry = "SELECT e.csID, c.subjCode, c.section, b.subj_name, e.studentID, CONCAT(s.lname, ', ' , s.fname)name FROM ENROLLMENT e, CLASS_SCHEDULE c, STUDENT s, SUBJECT b WHERE e.csID = c.csID AND c.csID = '" . $classID . "' AND c.subjCode = b.subjCode AND e.studentID = s.studentID ORDER BY e.sort;"; $doClassQry = mysql_query($classQry); echo "<table id='tableone'>"; while($x = mysql_fetch_array($doClassQry)) { $subject = $x['subj_name']; $subjCode = $x['subjCode']; $section = $x['section']; $studentArr[] = $x['name']; $studentID[] = $x['studentID']; } echo "<thead>"; echo "<tr><th colspan = 7>" . "This is your class: " . $subjCode . " " . $section . " : " . $subject . "</th></tr>"; echo "</thead>"; echo "<tbody>"; echo "<tr>"; for($i = 0; $i < mysql_num_rows($doClassQry); $i++) { if($i % 7 == 0) { echo "</tr><tr><td id = '". $studentID[$i] . " '>" . $studentArr[$i] . "</td>"; } else { echo "<td id = '". $studentID[$i] . " '>" . $studentArr[$i] . "</td>"; } } echo "</tr>"; echo "</tbody>"; echo "</table>"; ?> Here's the html part with the form: <form name="save" action="saveTest.php" method="post"> <div id="submitt"> <input type="hidden" name="absent[]" value="testing"/> <input type="submit" value="submit"/> </div> </form> And here's the php part which processes the form (saveTest.php): <?php $absent = $_POST['absent']; //echo "absnt" . $absent[] . "<br>"; echo count($absent) . "<br>"; //print_r($_POST) . "<br>"; ?>

Read the article

C# creating a queue to handle jobs triggered by FileSystemWatcher

- by John S

I have built a small tray app that will watch a folder and when a new file is added it runs a job. The job is to watch for video files and convert them to .mp4 using handBrakeCli. I have all this logic worked out. The problem I run into is that if there is more than one file I want it to queue the job til the prior one is complete. I am fairly new to c# and I am not sure of the best way to handle this. one idea is to create a queue somehow, a file to store the commands in order maybe, then execute the next one after the process is complete. We are dealing with large movie files here so it can take a while. I am doing this on a quad core with 8gb of RAM and it seems to generally take about 30mins to complete a full length movie. here is the code I have so far. there are some bits in here that are for future functionality so it refers to some classes that you wont see but it doesnt matter as they arent used here. any suggestions are welcome. using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using System.IO; using System.Diagnostics; using System.Threading; namespace movie_converter { public partial class Form1 : Form { public Form1() { InitializeComponent(); } string hbCli; string cmd; string file; string strfilter = "*.*"; string[] filter = new string[3] { ".mkv", ".avi", ".wmv" }; //static list of types List<string> Ext = new List<string>(); //list of extensions to watch (dynamic) NotifyIcon notifyIcon = new System.Windows.Forms.NotifyIcon(); private void SetUpTrayIcon() { notifyIcon.BalloonTipText = "Movie Converter is running minimized."; notifyIcon.BalloonTipTitle = "I'm still here"; notifyIcon.Text = "John's movie converter"; notifyIcon.Icon = new Icon(@"C:\\Users\\John\\Pictures\\appicon.ico"); notifyIcon.Click += new EventHandler(notifyIcon_Click); if (notifyIcon != null) { notifyIcon.Visible = true; notifyIcon.ShowBalloonTip(2000); } } private void Form_Resize(object sender, EventArgs e) { if (WindowState == FormWindowState.Minimized) { this.Hide(); SetUpTrayIcon(); } } private void notifyIcon_Click(object sender, EventArgs e) { this.Show(); this.WindowState = FormWindowState.Normal; notifyIcon.Visible = false; } public void Watcher() { FileSystemWatcher watcher = new FileSystemWatcher(); watcher.Path = textBox1.Text + "\\"; //path to watch watcher.Filter = strfilter; //what types to look for set to * and i will filter later as it cant accept an array watcher.NotifyFilter = NotifyFilters.FileName | NotifyFilters.DirectoryName; //properties to look at watcher.IncludeSubdirectories = true; //scan subdirs watcher.Created += new FileSystemEventHandler(OnChanged); //TODO: make this only run if the files are of a certain type watcher.EnableRaisingEvents = true; // start the watcher } static bool IsFileLocked(FileInfo file) { FileStream stream = null; try { stream = file.Open(FileMode.Open, FileAccess.ReadWrite, FileShare.None); } catch (IOException) { //the file is unavailable because it is: //still being written to //or being processed by another thread //or does not exist (has already been processed) return true; } finally { if (stream != null) stream.Close(); } //file is not locked return false; } // Define the event handlers. private void OnChanged(object source, FileSystemEventArgs e) { string sFile = e.FullPath; //check that file is available FileInfo fileInfo = new FileInfo(sFile); while (IsFileLocked(fileInfo)) { Thread.Sleep(500); } if (System.Diagnostics.Process.GetProcessesByName("HandBrakeCLI").Length != 0) { Thread.Sleep(500); } else { //hbOptions hbCl = new hbOptions(); //hbCli = hbCl.HbCliOptions(); if (textBox3.Text != "") { hbCli = textBox3.Text.ToString(); } else { hbCli = "-e x264 -q 20 -B 160"; } string t = e.Name; string s = t.Substring(0, t.Length - 4); //TODO: fix this its not reliable file = e.FullPath; string opath = textBox1.Text.ToString(); cmd = "-i \"" + file + "\" -o \"" + opath + "\\" + s + ".mp4\" " + hbCli; try { for (int i = 0; i < Ext.Count(); i++) { if (e.Name.Contains(Ext[i])) { Process hb = new Process(); hb.StartInfo.FileName = "D:\\Apps\\Handbrake\\Install\\Handbrake\\HandBrakeCLI.exe"; hb.StartInfo.Arguments = cmd; notifyIcon.BalloonTipTitle = "Now Converting"; notifyIcon.BalloonTipText = file; notifyIcon.ShowBalloonTip(2000); hb.Start(); } } } catch (Exception ex) { MessageBox.Show(ex.Message); } } } private void button1_Click(object sender, EventArgs e) //ok button { //add each array item to the list for (int i = 0; i < filter.Count(); i++) { Ext.Add(filter[i]); } if (textBox1.Text != "" && textBox1.Text.Length > 2) { Watcher(); //call watcher to run } this.WindowState = FormWindowState.Minimized; } private void button2_Click(object sender, EventArgs e) //browse button { //broswe button DialogResult result = folderBrowserDialog1.ShowDialog(); if (result == DialogResult.OK) { textBox1.Text = folderBrowserDialog1.SelectedPath; } } private void button3_Click(object sender, EventArgs e) //commands button { Process np = new Process(); np.StartInfo.FileName = "notepad.exe"; np.StartInfo.Arguments = "hbCLI.txt"; np.Start(); } private void button4_Click(object sender, EventArgs e) //options button { hbOptions options = new hbOptions(); options.ShowDialog(); } private void button5_Click(object sender, EventArgs e) //exit button { this.Close(); } private void Form1_Load(object sender, EventArgs e) { this.Resize += Form_Resize; } } }

Read the article

Implementation of ZipCrypto / Zip 2.0 encryption in java

- by gomesla

I'm trying o implement the zipcrypto / zip 2.0 encryption algoritm to deal with encrypted zip files as discussed in http://www.pkware.com/documents/casestudies/APPNOTE.TXT I believe I've followed the specs but just can't seem to get it working. I'm fairly sure the issue has to do with my interpretation of the crc algorithm. The documentation states CRC-32: (4 bytes) The CRC-32 algorithm was generously contributed by David Schwaderer and can be found in his excellent book "C Programmers Guide to NetBIOS" published by Howard W. Sams & Co. Inc. The 'magic number' for the CRC is 0xdebb20e3. The proper CRC pre and post conditioning is used, meaning that the CRC register is pre-conditioned with all ones (a starting value of 0xffffffff) and the value is post-conditioned by taking the one's complement of the CRC residual. Here is the snippet that I'm using for the crc32 public class PKZIPCRC32 { private static final int CRC32_POLYNOMIAL = 0xdebb20e3; private int crc = 0xffffffff; private int CRCTable[]; public PKZIPCRC32() { buildCRCTable(); } private void buildCRCTable() { int i, j; CRCTable = new int[256]; for (i = 0; i <= 255; i++) { crc = i; for (j = 8; j > 0; j--) if ((crc & 1) == 1) crc = (crc >>> 1) ^ CRC32_POLYNOMIAL; else crc >>>= 1; CRCTable[i] = crc; } } private int crc32(byte buffer[], int start, int count, int lastcrc) { int temp1, temp2; int i = start; crc = lastcrc; while (count-- != 0) { temp1 = crc >>> 8; temp2 = CRCTable[(crc ^ buffer[i++]) & 0xFF]; crc = temp1 ^ temp2; } return crc; } public int crc32(int crc, byte buffer) { return crc32(new byte[] { buffer }, 0, 1, crc); } } Below is my complete code. Can anyone see what I'm doing wrong. package org.apache.commons.compress.archivers.zip; import java.io.IOException; import java.io.InputStream; public class ZipCryptoInputStream extends InputStream { public class PKZIPCRC32 { private static final int CRC32_POLYNOMIAL = 0xdebb20e3; private int crc = 0xffffffff; private int CRCTable[]; public PKZIPCRC32() { buildCRCTable(); } private void buildCRCTable() { int i, j; CRCTable = new int[256]; for (i = 0; i <= 255; i++) { crc = i; for (j = 8; j > 0; j--) if ((crc & 1) == 1) crc = (crc >>> 1) ^ CRC32_POLYNOMIAL; else crc >>>= 1; CRCTable[i] = crc; } } private int crc32(byte buffer[], int start, int count, int lastcrc) { int temp1, temp2; int i = start; crc = lastcrc; while (count-- != 0) { temp1 = crc >>> 8; temp2 = CRCTable[(crc ^ buffer[i++]) & 0xFF]; crc = temp1 ^ temp2; } return crc; } public int crc32(int crc, byte buffer) { return crc32(new byte[] { buffer }, 0, 1, crc); } } private static final long ENCRYPTION_KEY_1 = 0x12345678; private static final long ENCRYPTION_KEY_2 = 0x23456789; private static final long ENCRYPTION_KEY_3 = 0x34567890; private InputStream baseInputStream = null; private final PKZIPCRC32 checksumEngine = new PKZIPCRC32(); private long[] keys = null; public ZipCryptoInputStream(ZipArchiveEntry zipEntry, InputStream inputStream, String passwd) throws Exception { baseInputStream = inputStream; // Decryption // ---------- // PKZIP encrypts the compressed data stream. Encrypted files must // be decrypted before they can be extracted. // // Each encrypted file has an extra 12 bytes stored at the start of // the data area defining the encryption header for that file. The // encryption header is originally set to random values, and then // itself encrypted, using three, 32-bit keys. The key values are // initialized using the supplied encryption password. After each byte // is encrypted, the keys are then updated using pseudo-random number // generation techniques in combination with the same CRC-32 algorithm // used in PKZIP and described elsewhere in this document. // // The following is the basic steps required to decrypt a file: // // 1) Initialize the three 32-bit keys with the password. // 2) Read and decrypt the 12-byte encryption header, further // initializing the encryption keys. // 3) Read and decrypt the compressed data stream using the // encryption keys. // Step 1 - Initializing the encryption keys // ----------------------------------------- // // Key(0) <- 305419896 // Key(1) <- 591751049 // Key(2) <- 878082192 // // loop for i <- 0 to length(password)-1 // update_keys(password(i)) // end loop // // Where update_keys() is defined as: // // update_keys(char): // Key(0) <- crc32(key(0),char) // Key(1) <- Key(1) + (Key(0) & 000000ffH) // Key(1) <- Key(1) * 134775813 + 1 // Key(2) <- crc32(key(2),key(1) >> 24) // end update_keys // // Where crc32(old_crc,char) is a routine that given a CRC value and a // character, returns an updated CRC value after applying the CRC-32 // algorithm described elsewhere in this document. keys = new long[] { ENCRYPTION_KEY_1, ENCRYPTION_KEY_2, ENCRYPTION_KEY_3 }; for (int i = 0; i < passwd.length(); ++i) { update_keys((byte) passwd.charAt(i)); } // Step 2 - Decrypting the encryption header // ----------------------------------------- // // The purpose of this step is to further initialize the encryption // keys, based on random data, to render a plaintext attack on the // data ineffective. // // Read the 12-byte encryption header into Buffer, in locations // Buffer(0) thru Buffer(11). // // loop for i <- 0 to 11 // C <- buffer(i) ^ decrypt_byte() // update_keys(C) // buffer(i) <- C // end loop // // Where decrypt_byte() is defined as: // // unsigned char decrypt_byte() // local unsigned short temp // temp <- Key(2) | 2 // decrypt_byte <- (temp * (temp ^ 1)) >> 8 // end decrypt_byte // // After the header is decrypted, the last 1 or 2 bytes in Buffer // should be the high-order word/byte of the CRC for the file being // decrypted, stored in Intel low-byte/high-byte order. Versions of // PKZIP prior to 2.0 used a 2 byte CRC check; a 1 byte CRC check is // used on versions after 2.0. This can be used to test if the password // supplied is correct or not. byte[] encryptionHeader = new byte[12]; baseInputStream.read(encryptionHeader); for (int i = 0; i < encryptionHeader.length; i++) { encryptionHeader[i] ^= decrypt_byte(); update_keys(encryptionHeader[i]); } } protected byte decrypt_byte() { byte temp = (byte) (keys[2] | 2); return (byte) ((temp * (temp ^ 1)) >> 8); } @Override public int read() throws IOException { // // Step 3 - Decrypting the compressed data stream // ---------------------------------------------- // // The compressed data stream can be decrypted as follows: // // loop until done // read a character into C // Temp <- C ^ decrypt_byte() // update_keys(temp) // output Temp // end loop int read = baseInputStream.read(); read ^= decrypt_byte(); update_keys((byte) read); return read; } private final void update_keys(byte ch) { keys[0] = checksumEngine.crc32((int) keys[0], ch); keys[1] = keys[1] + (byte) keys[0]; keys[1] = keys[1] * 134775813 + 1; keys[2] = checksumEngine.crc32((int) keys[2], (byte) (keys[1] >> 24)); } }

Read the article

.NET file Decryption - Bad Data

- by Jon

I am in the process of rewriting an old application. The old app stored data in a scoreboard file that was encrypted with the following code: private const String SSecretKey = @"?B?n?Mj?"; public DataTable GetScoreboardFromFile() { FileInfo f = new FileInfo(scoreBoardLocation); if (!f.Exists) { return setupNewScoreBoard(); } DESCryptoServiceProvider DES = new DESCryptoServiceProvider(); //A 64 bit key and IV is required for this provider. //Set secret key For DES algorithm. DES.Key = ASCIIEncoding.ASCII.GetBytes(SSecretKey); //Set initialization vector. DES.IV = ASCIIEncoding.ASCII.GetBytes(SSecretKey); //Create a file stream to read the encrypted file back. FileStream fsread = new FileStream(scoreBoardLocation, FileMode.Open, FileAccess.Read); //Create a DES decryptor from the DES instance. ICryptoTransform desdecrypt = DES.CreateDecryptor(); //Create crypto stream set to read and do a //DES decryption transform on incoming bytes. CryptoStream cryptostreamDecr = new CryptoStream(fsread, desdecrypt, CryptoStreamMode.Read); DataTable dTable = new DataTable("scoreboard"); dTable.ReadXml(new StreamReader(cryptostreamDecr)); cryptostreamDecr.Close(); fsread.Close(); return dTable; } This works fine. I have copied the code into my new app so that I can create a legacy loader and convert the data into the new format. The problem is I get a "Bad Data" error: System.Security.Cryptography.CryptographicException was unhandled Message="Bad Data.\r\n" Source="mscorlib" The error fires at this line: dTable.ReadXml(new StreamReader(cryptostreamDecr)); The encrypted file was created today on the same machine with the old code. I guess that maybe the encryption / decryption process uses the application name / file or something and therefore means I can not open it. Does anyone have an idea as to: A) Be able explain why this isn't working? B) Offer a solution that would allow me to be able to open files that were created with the legacy application and be able to convert them please? Here is the whole class that deals with loading and saving the scoreboard: using System; using System.Collections.Generic; using System.Text; using System.Security.Cryptography; using System.Runtime.InteropServices; using System.IO; using System.Data; using System.Xml; using System.Threading; namespace JawBreaker { [Serializable] class ScoreBoardLoader { private Jawbreaker jawbreaker; private String sSecretKey = @"?B?n?Mj?"; private String scoreBoardFileLocation = ""; private bool keepScoreBoardUpdated = true; private int intTimer = 180000; public ScoreBoardLoader(Jawbreaker jawbreaker, String scoreBoardFileLocation) { this.jawbreaker = jawbreaker; this.scoreBoardFileLocation = scoreBoardFileLocation; } // Call this function to remove the key from memory after use for security [System.Runtime.InteropServices.DllImport("KERNEL32.DLL", EntryPoint = "RtlZeroMemory")] public static extern bool ZeroMemory(IntPtr Destination, int Length); // Function to Generate a 64 bits Key. private string GenerateKey() { // Create an instance of Symetric Algorithm. Key and IV is generated automatically. DESCryptoServiceProvider desCrypto = (DESCryptoServiceProvider)DESCryptoServiceProvider.Create(); // Use the Automatically generated key for Encryption. return ASCIIEncoding.ASCII.GetString(desCrypto.Key); } public void writeScoreboardToFile() { DataTable tempScoreBoard = getScoreboardFromFile(); //add in the new scores to the end of the file. for (int i = 0; i < jawbreaker.Scoreboard.Rows.Count; i++) { DataRow row = tempScoreBoard.NewRow(); row.ItemArray = jawbreaker.Scoreboard.Rows[i].ItemArray; tempScoreBoard.Rows.Add(row); } //before it is written back to the file make sure we update the sync info if (jawbreaker.SyncScoreboard) { //connect to webservice, login and update all the scores that have not been synced. for (int i = 0; i < tempScoreBoard.Rows.Count; i++) { try { //check to see if that row has been synced to the server if (!Boolean.Parse(tempScoreBoard.Rows[i].ItemArray[7].ToString())) { //sync info to server //update the row to say that it has been updated object[] tempArray = tempScoreBoard.Rows[i].ItemArray; tempArray[7] = true; tempScoreBoard.Rows[i].ItemArray = tempArray; tempScoreBoard.AcceptChanges(); } } catch (Exception ex) { jawbreaker.writeErrorToLog("ERROR OCCURED DURING SYNC TO SERVER UPDATE: " + ex.Message); } } } FileStream fsEncrypted = new FileStream(scoreBoardFileLocation, FileMode.Create, FileAccess.Write); DESCryptoServiceProvider DES = new DESCryptoServiceProvider(); DES.Key = ASCIIEncoding.ASCII.GetBytes(sSecretKey); DES.IV = ASCIIEncoding.ASCII.GetBytes(sSecretKey); ICryptoTransform desencrypt = DES.CreateEncryptor(); CryptoStream cryptostream = new CryptoStream(fsEncrypted, desencrypt, CryptoStreamMode.Write); MemoryStream ms = new MemoryStream(); tempScoreBoard.WriteXml(ms, XmlWriteMode.WriteSchema); ms.Position = 0; byte[] bitarray = new byte[ms.Length]; ms.Read(bitarray, 0, bitarray.Length); cryptostream.Write(bitarray, 0, bitarray.Length); cryptostream.Close(); ms.Close(); //now the scores have been added to the file remove them from the datatable jawbreaker.Scoreboard.Rows.Clear(); } public void startPeriodicScoreboardWriteToFile() { while (keepScoreBoardUpdated) { //three minute sleep. Thread.Sleep(intTimer); writeScoreboardToFile(); } } public void stopPeriodicScoreboardWriteToFile() { keepScoreBoardUpdated = false; } public int IntTimer { get { return intTimer; } set { intTimer = value; } } public DataTable getScoreboardFromFile() { FileInfo f = new FileInfo(scoreBoardFileLocation); if (!f.Exists) { jawbreaker.writeInfoToLog("Scoreboard not there so creating new one"); return setupNewScoreBoard(); } else { DESCryptoServiceProvider DES = new DESCryptoServiceProvider(); //A 64 bit key and IV is required for this provider. //Set secret key For DES algorithm. DES.Key = ASCIIEncoding.ASCII.GetBytes(sSecretKey); //Set initialization vector. DES.IV = ASCIIEncoding.ASCII.GetBytes(sSecretKey); //Create a file stream to read the encrypted file back. FileStream fsread = new FileStream(scoreBoardFileLocation, FileMode.Open, FileAccess.Read); //Create a DES decryptor from the DES instance. ICryptoTransform desdecrypt = DES.CreateDecryptor(); //Create crypto stream set to read and do a //DES decryption transform on incoming bytes. CryptoStream cryptostreamDecr = new CryptoStream(fsread, desdecrypt, CryptoStreamMode.Read); DataTable dTable = new DataTable("scoreboard"); dTable.ReadXml(new StreamReader(cryptostreamDecr)); cryptostreamDecr.Close(); fsread.Close(); return dTable; } } public DataTable setupNewScoreBoard() { //scoreboard info into dataset DataTable scoreboard = new DataTable("scoreboard"); scoreboard.Columns.Add(new DataColumn("playername", System.Type.GetType("System.String"))); scoreboard.Columns.Add(new DataColumn("score", System.Type.GetType("System.Int32"))); scoreboard.Columns.Add(new DataColumn("ballnumber", System.Type.GetType("System.Int32"))); scoreboard.Columns.Add(new DataColumn("xsize", System.Type.GetType("System.Int32"))); scoreboard.Columns.Add(new DataColumn("ysize", System.Type.GetType("System.Int32"))); scoreboard.Columns.Add(new DataColumn("gametype", System.Type.GetType("System.String"))); scoreboard.Columns.Add(new DataColumn("date", System.Type.GetType("System.DateTime"))); scoreboard.Columns.Add(new DataColumn("synced", System.Type.GetType("System.Boolean"))); scoreboard.AcceptChanges(); return scoreboard; } private void Run() { // For additional security Pin the key. GCHandle gch = GCHandle.Alloc(sSecretKey, GCHandleType.Pinned); // Remove the Key from memory. ZeroMemory(gch.AddrOfPinnedObject(), sSecretKey.Length * 2); gch.Free(); } } }

Read the article

Communicating between C# application and Android app via bluetooth

- by Akki

The android application acts as a server in this case. I have a main activity which creates a Thread to handle serverSocket and a different thread to handle the socket connection. I am using a uuid common to C# and android. I am using 32feet bluetooth library for C#. The errors i am facing are 1) My logcat shows this debug log Error while doing socket.connect()1 java.io.IOException: File descriptor in bad state Message: File descriptor in bad state Localized Message: File descriptor in bad state Received : Testing Connection Count of Thread is : 1 2) When i try to send something via C# app the second time, this exception is thrown: A first chance exception of type 'System.InvalidOperationException' occurred in System.dll System.InvalidOperationException: BeginConnect cannot be called while another asynchronous operation is in progress on the same Socket. at System.Net.Sockets.Socket.DoBeginConnect(EndPoint endPointSnapshot, SocketAddress socketAddress, LazyAsyncResult asyncResult) at System.Net.Sockets.Socket.BeginConnect(EndPoint remoteEP, AsyncCallback callback, Object state) at InTheHand.Net.Bluetooth.Msft.SocketBluetoothClient.BeginConnect(BluetoothEndPoint remoteEP, AsyncCallback requestCallback, Object state) at InTheHand.Net.Sockets.BluetoothClient.BeginConnect(BluetoothEndPoint remoteEP, AsyncCallback requestCallback, Object state) at InTheHand.Net.Sockets.BluetoothClient.BeginConnect(BluetoothAddress address, Guid service, AsyncCallback requestCallback, Object state) at BTSyncClient.Form1.connect() in c:\users\----\documents\visual studio 2010\Projects\TestClient\TestClient\Form1.cs:line 154 I only know android application programming and i designed the C# by learning bit and pieces. FYI, My android phone is galaxy s with ICS running on it.Please point out my mistakes.. Source codes : C# Code using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using System.Threading; using System.Net.Sockets; using InTheHand.Net.Bluetooth; using InTheHand.Windows.Forms; using InTheHand.Net.Sockets; using InTheHand.Net; namespace BTSyncClient { public partial class Form1 : Form { BluetoothClient myself; BluetoothDeviceInfo bTServerDevice; private Guid uuid = Guid.Parse("00001101-0000-1000-8000-00805F9B34FB"); bool isConnected; public Form1() { InitializeComponent(); if (BluetoothRadio.IsSupported) { myself = new BluetoothClient(); } } private void Form1_Load(object sender, EventArgs e) { } private void button1_Click(object sender, EventArgs e) { connect(); } private void Form1_FormClosing(object sender, FormClosingEventArgs e) { try { myself.GetStream().Close(); myself.Dispose(); } catch (Exception ex) { Console.Out.WriteLine(ex); } } private void button2_Click(object sender, EventArgs e) { SelectBluetoothDeviceDialog dialog = new SelectBluetoothDeviceDialog(); DialogResult result = dialog.ShowDialog(this); if(result.Equals(DialogResult.OK)){ bTServerDevice = dialog.SelectedDevice; } } private void callback(IAsyncResult ar) { String msg = (String)ar.AsyncState; if (ar.IsCompleted) { isConnected = myself.Connected; if (myself.Connected) { UTF8Encoding encoder = new UTF8Encoding(); NetworkStream stream = myself.GetStream(); if (!stream.CanWrite) { MessageBox.Show("Stream is not Writable"); } System.IO.StreamWriter mywriter = new System.IO.StreamWriter(stream, Encoding.UTF8); mywriter.WriteLine(msg); mywriter.Flush(); } else MessageBox.Show("Damn thing isnt connected"); } } private void connect() { try { if (bTServerDevice != null) { myself.BeginConnect(bTServerDevice.DeviceAddress, uuid, new AsyncCallback(callback) , message.Text); } } catch (Exception e) { Console.Out.WriteLine(e); } } } } Server Thread import java.io.IOException; import java.util.UUID; import android.bluetooth.BluetoothAdapter; import android.bluetooth.BluetoothServerSocket; import android.bluetooth.BluetoothSocket; import android.util.Log; public class ServerSocketThread extends Thread { private static final String TAG = "TestApp"; private BluetoothAdapter btAdapter; private BluetoothServerSocket serverSocket; private boolean stopMe; private static final UUID uuid = UUID.fromString("00001101-0000-1000-8000-00805F9B34FB"); //private static final UUID uuid = UUID.fromString("6e58c9d5-b0b6-4009-ad9b-fd9481aef9b3"); private static final String SERVICE_NAME = "TestService"; public ServerSocketThread() { stopMe = false; btAdapter = BluetoothAdapter.getDefaultAdapter(); try { serverSocket = btAdapter.listenUsingRfcommWithServiceRecord(SERVICE_NAME, uuid); } catch (IOException e) { Log.d(TAG,e.toString()); } } public void signalStop(){ stopMe = true; } public void run(){ Log.d(TAG,"In ServerThread"); BluetoothSocket socket = null; while(!stopMe){ try { socket = serverSocket.accept(); } catch (IOException e) { break; } if(socket != null){ AcceptThread newClientConnection = new AcceptThread(socket); newClientConnection.start(); } } Log.d(TAG,"Server Thread now dead"); } // Will cancel the listening socket and cause the thread to finish public void cancel(){ try { serverSocket.close(); } catch (IOException e) { } } } Accept Thread import java.io.IOException; import java.io.InputStream; import java.util.Scanner; import android.bluetooth.BluetoothSocket; import android.util.Log; public class AcceptThread extends Thread { private BluetoothSocket socket; private String TAG = "TestApp"; static int count = 0; public AcceptThread(BluetoothSocket Socket) { socket = Socket; } volatile boolean isError; String output; String error; public void run() { Log.d(TAG, "AcceptThread Started"); isError = false; try { socket.connect(); } catch (IOException e) { Log.d(TAG,"Error while doing socket.connect()"+ ++count); Log.d(TAG, e.toString()); Log.d(TAG,"Message: "+e.getLocalizedMessage()); Log.d(TAG,"Localized Message: "+e.getMessage()); isError = true; } InputStream in = null; try { in = socket.getInputStream(); } catch (IOException e) { Log.d(TAG,"Error while doing socket.getInputStream()"); Log.d(TAG, e.toString()); Log.d(TAG,"Message: "+e.getLocalizedMessage()); Log.d(TAG,"Localized Message: "+e.getMessage()); isError = true; } Scanner istream = new Scanner(in); if (istream.hasNextLine()) { Log.d(TAG, "Received : "+istream.nextLine()); Log.d(TAG,"Count of Thread is : " + count); } istream.close(); try { in.close(); } catch (IOException e) { Log.d(TAG,"Error while doing in.close()"); Log.d(TAG, e.toString()); Log.d(TAG,"Message: "+e.getLocalizedMessage()); Log.d(TAG,"Localized Message: "+e.getMessage()); isError = true; } try { socket.close(); } catch (IOException e) { Log.d(TAG,"Error while doing socket.close()"); Log.d(TAG, e.toString()); Log.d(TAG,"Message: "+e.getLocalizedMessage()); Log.d(TAG,"Localized Message: "+e.getMessage()); isError = true; } } }

Search Results

Search found 20978 results on 840 pages for 'input stream'.

Page 270/840 | < Previous Page | 266 267 268 269 270 271 272 273 274 275 276 277 | Next Page >

- by Mladen Prajdic

- by LeonShaner

- by ToStringTheory

- by Vijay Kumar Singh

- by piemesons

- by Jai_pans

- by Link

- by mallikarjun

- by Tunji Gbadamosi

- by Thorpe Obazee

- by brett

- by kumar

- by Madhulika Mukherjee

- by jfreak53

- by MANAL

- by user1864539

- by BEBO

- by Meko

- by MANAL

- by Benjen

- by user1056998

- by John S

- by gomesla

- by Jon

- by Akki

< Previous Page | 266 267 268 269 270 271 272 273 274 275 276 277 | Next Page >