Search Results

Search found 32970 results on 1319 pages for 'zend db select'.

Page 272/1319 | < Previous Page | 268 269 270 271 272 273 274 275 276 277 278 279  | Next Page >

  • Migrating data from Oracle database to Pervasive .DAT files

    - by kaychaks
    The requirement is to migrate some tables with data from a Oracle database server to Pervasive database's .DAT file. Then those .DAT files will be used by a Pervasive database server. The restriction is that Oracle DB can not directly migrate to the Pervasive DB. It has to generate the .DAT files and then the new .DAT files will replace the old one for the Pervasive DB which will then use them for the new data. I was trying this task with SSIS. Exporting the Oracle table to a delimited .txt file and then creating a .DAT file from that text file. I can export the data from Oracle to .txt but I am not finding any way to migrate .txt to Pervasive .DAT? Is this the right approach? If not then please help with my problem.

    Read the article

  • How to install pecl uploadprogress on Debian Lenny

    - by kidrobot
    I am getting this output/error for # pecl install uploadprogress downloading uploadprogress-1.0.1.tgz ... Starting to download uploadprogress-1.0.1.tgz (8,536 bytes) .....done: 8,536 bytes 4 source files, building running: phpize Configuring for: PHP Api Version: 20041225 Zend Module Api No: 20060613 Zend Extension Api No: 220060519 building in /var/tmp/pear-build-root/uploadprogress-1.0.1 running: /tmp/pear/temp/uploadprogress/configure checking for grep that handles long lines and -e... /bin/grep checking for egrep... /bin/grep -E checking for a sed that does not truncate output... /bin/sed checking for gcc... no checking for cc... no checking for cl.exe... no configure: error: no acceptable C compiler found in $PATH See `config.log' for more details. ERROR: `/tmp/pear/temp/uploadprogress/configure' failed php-pear is installed. I'm stumped.

    Read the article

  • Cannot install Pecl (Imagick) extension on Centos server - autoconf missing

    - by Stevo
    I'm trying to install the pecl extension Imagick on a centos server, but I'm getting an error about autoconf. Autoconf is installed, as is make and gcc. but it's complaining about the path: [root@server ~]# pecl install imagick downloading imagick-3.0.1.tgz ... Starting to download imagick-3.0.1.tgz (93,920 bytes) .....................done: 93,920 bytes 13 source files, building running: phpize Configuring for: PHP Api Version: 20090626 Zend Module Api No: 20090626 Zend Extension Api No: 220090626 /usr/bin/phpize: /var/tmp/imagick/build/shtool: /bin/sh: bad interpreter: Permission denied Cannot find autoconf. Please check your autoconf installation and the $PHP_AUTOCONF environment variable. Then, rerun this script. ERROR: `phpize' failed What should I do?

    Read the article

  • php5-fpm.sock file doesn't exist

    - by Caballero
    I've just compiled and installed PHP-FPM 5.5.5 following this tutorial. I have ignored the apache setup section, because I'm running nginx. Everything seems to be fine: php -v PHP 5.5.5 (cli) (built: Oct 18 2013 21:56:02) Copyright (c) 1997-2013 The PHP Group Zend Engine v2.5.0, Copyright (c) 1998-2013 Zend Technologies Problem is, I need to link it to my nginx conf via a socket, but /var/run/php5-fpm.sock file doesn't exist. How do I create it? The file /etc/php5/fpm/pool.d/www.conf does include the line listen = /var/run/php5-fpm.sock It is possible (though I'm not sure) that it's a leftover of an older php version 5.5.3 which was installed and removed via apt-get. I'm running Ubuntu 13.10 (Saucy Salamander)

    Read the article

  • DBD::mysql gives mysql_init not found

    - by highBandWidth
    I have to install a non-admin copy of mysql and perl module DBD::mysql in my home directory. I installed mysql in ~/software/db/mysql and this works since I can start and stop the server and go to the mysql prompt. Then, I downloaded the perl module and installed it using perl Makefile.PL PREFIX=~/myperl/ LIB=~/myperl/lib/lib64/perl5/ --mysql_config=/my_home/software/db/mysql/bin/mysql_config --libs=/myhome/software/db/mysql/lib/libmysqlclient.a make make install I did this to use the statically linked mysql client library. perl -MDBD::mysql -e 1 gives no errors. However, when I actually try to use the module, I get /usr/bin/perl: symbol lookup error: /myhome/myperl/lib/lib64/perl5/x86_64-linux-thread-multi/auto/DBD/mysql/mysql.so: undefined symbol: mysql_init

    Read the article

  • Updating PHP on a Plesk managed Server

    - by mblaettermann
    I just updated PHP and MySQl on my VPS with the current Versions from Atomic Repo. Everything worked out fine so far. From console I get the new PHP 5.3: [root@server phpMyAdmin]# php -v PHP 5.3.16 (cli) (built: Aug 20 2012 11:18:05) Copyright (c) 1997-2012 The PHP Group Zend Engine v2.3.0, Copyright (c) 1998-2012 Zend Technologies with the ionCube PHP Loader v4.0.5, Copyright (c) 2002-2011, by ionCube Ltd. But through Apache I still get the old version (5.1.6). The server is running some old version of crappy Plesk Panel. That gives me the option to choose between Apache Modul, fCGI and CGI-BIN. Any hints, how to update apache, so it will use the new PHP Version? EDIT: I just needed to restart httpd (/etc/init.d/httpd restart)

    Read the article

  • PID:4 using Port 80

    - by CyberOPS
    I was trying to install Zend Server CE on my computer but when I got to the point were I need to choose the port for my Web Server it says: "Web Server Port: 80 Occupied". So I decided to check what is using Port 80 with CMD by typing: "netstat -o -n -a | findstr 0.0:80": TCP 0.0.0.0:80 0.0.0.0:0 LISTENING 4 I check for PID:4 in Task Manager's Processes and Services. Seems PID 4 is "System". So, what I want to know is how can I stop "System" (PID:4) from using Port 80? INFO: I am using: Windows 7 64bit; Zend Server CE 5.5.0

    Read the article

  • zero downtime during database scheme upgrade on SQL 2008

    - by eject
    I have web application on IIS7 with SQL server 2008 as RDBMS. Need get 0 downtime during future upgrades of ASP.NET code and DB schema as well. I need to get right scenario for this. I have 2 web servers and 2 sql servers and one http load balancer whcih allows to switch web backend server for web requests. Main goal is to make 1st web server and DB server up and running, update code and db schema on 2nd server and then switch all the requests to 2nd server and then main problem - how to copy data from 1st database 2nd (which was changed during upgrade).

    Read the article

  • Setting up a server with only subdomains, any connection to top level goes to main server on another IP?

    - by Anagio
    I'm developing a web app where users will have their own sub-domain to login to and use the application. I'm running wordpress for the main website to manage the public / front end. Our application is developed in zend framework. The zf project is currently in a subfolder on the main server. I'd like to place the zend framework project onto another server (different IP) and keep it separate from the the wordpress front end www.domain.com site. The zf application server will run nginx. I'm not sure how to setup a server to run strictly sub domains. Setting up the virtual hosts in the configuration file is no problem. To give the users username.domain.com. But what about the main default configuration file? How would that be configured since the top level domain is technically another server (wordpress) on another IP?

    Read the article

  • Backup all plesk MySQL Databases to individual files

    - by Michael
    Hy, Because I'm new to shell scripting I need a hand. I currently backup all mydatabases to a single file, thing that makes the restore preaty hard. The second problem that my MySQL password dosen't work because of a Plesk bug and i get the password from "/etc/psa/.psa.shadow". Here is the code that I use to backup all my databases to a single file. mysqldump -uadmin -p`cat /etc/psa/.psa.shadow` --all-databases | bzip2 -c > /root/21.10.2013.sql.bz2 I found some scripts on the web that backup each database to individual files but I don't know how to make them work for my situation. Here is a example script: for db in $(mysql -e 'show databases' -s --skip-column-names); do mysqldump $db | gzip > "/backups/mysqldump-$(hostname)-$db-$(date +%Y-%m-%d-%H.%M.%S).gz"; done Can someone help me make the script above work for my situation? Requirements: Backup each database to individual file using plesk password location.

    Read the article

  • Is allowing remote Sql Server Management Studio safe?

    - by dave thieben
    I administer a website that runs on IIS on one box, and SQL Server 2008 Workgroup on another box. typically I remote into the DB box and run SSMS to work on the db, but I would like to be able to access the db directly with SSMS on my local box. I've seen the other questions about allowing remote access to the database, but my question is, is this safe? I'm concerned that I'm opening a hole in the firewall and potential for hack attempts. Is this just a bad idea in general?

    Read the article

  • htaccess not found

    - by clarkk
    I have installed a Apache 2 (from webmin) server on Debian 6.. I have setup a virtual host db.domain.com on the server which works fine, but .htaccess doesn't work if you get access from the ip address and the directory is listed if no index.php is found? db.domain.com -> 403 forbidden xxx.xxx.xxx.xxx -> gets access to the server Why is .htaccess omitted when you get access from the servers ip address? httpd.conf <Directory *> Options -Indexes FollowSymLinks </Directory> <VirtualHost *:80> ServerName db.domain.com DocumentRoot /var/www </VirtualHost> htaccess order deny,allow deny from all

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • MS Access 2007 end user access

    - by LtDan
    I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

    Read the article

  • sql server: losing identity column on export/import

    - by Y.G.J
    Recently I started dealing with SQL Server, my previous experience was in MS-Access. When I'm doing an import/export of a db, from the server to my computer or even in the server, all column with primary key loose the key. Identity is set to false and even bit is not set to the default. How can I can I use an import/export job to make an exact copy of the db and its data? I don't want to have to perform a backup and restore every time I want the same db somewhere else, for another project, etc. I have read about "edit mapping" and the checkbox but that did not helped with the identity specification... and what about the primary key of the tables and the rest of the things?

    Read the article

  • Apache timeouts and error log

    - by BlackFire27
    I have an error whenever I run my code for a certain time. I use a lot of loops and sql connections. I basically, put and take out links from my database. The problem is that there is some error thrown that I cant see, whenever I execute a long sql operation .. Note that the fault isnt the code. The code runs well, whenever there are a few links involved. But when there are over 200 links.. an error is thrown that I cants see. I tried to trace the error in a few places: C:\Program Files\Zend\ZendServer\logs\php_error.log C:\Program Files\Zend\phpMyAdmin\config.inc.php Edit Viewer in win xp I am running XP: Windows xp php version: 5.3.9-ZS5.6.0. Apache/2.2.21 Apacher version: (Win32) mod_ssl/2.2.21 OpenSSL/0.9.8o I cant trace the error at all, and why it happens. All I can suspect of, is that there is a server timeout..

    Read the article

  • minimum required bandwidth for remote database server

    - by user66734
    I want to build a small warehousing application for my company. We have a central warehouse which distributes to 8 sales points across the country. They insist on an in-house solution. I am thinking to setup a central mySQL db Linux server and have the branches connect to it to store sales. Queries to the db from the branches will be minimum, maybe 10 per hour. However I need all the branches to be able to store each sale data ( product ID, customer ID ) in the central db at peak time at most once every five minutes. My question is can I get away with simple 24mbps/768kbps DSL lines? If not what is the bandwith requirement? Can I rely on a load balancing router to combine additional lines if needed? Can you propose some server hardware specs?

    Read the article

  • RewriteMap syntax Regex

    - by ienabellamy
    in my .htaccess i've tons of directives, with same syntax: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 RewriteRule ^(.*)/PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 and everything works. Now, i created a RewriteMap in my because i need to increase velocity (20.000 redirect 301 in htaccess no good), so: RewriteEngine On RewriteMap redirects dbm=db:/var/www/html/presta152/prestashop/redirects.db RewriteCond ${redirects:$1} !="" RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] and my redirects.db is created by redirects.txt, that contains: /PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 /PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 this works if i try to call for example: www.site.com/PRODUCT_1.aspx i'm redirected... but if i try to call www.site.com/everythingpossibileinside/PRODUCT_1.aspx the redirect doesn't work. So, in my .htaccess this rule: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 works, but in my RewriteMap no. I think i must change this directive: RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] i tried, but unsuccessful. Thanks to all.

    Read the article

  • Two way replication

    - by Nidzaaaa
    I have a little problem... I have this case: -2 server instances -2 Databases -1 Table (5 columns) From server 1 I created publication to replicate all columns of table I have in 1. DB From server 2 I created subscription to pull all columns from table which is in server 1 DB But now, I need to publicate one columns of same table from server 2 to server 1 and also it has to be in same DB... I tried with using logic and creating publication for server 2 and subscription on server 1 but there is error appearing "You have selected the Publisher as a Subscriber and entered a subscription database that is the same as the publishing database. Select another subscription database." I hope someone understood my problem and have an answer for me, thanks in advance... p.s. Ask for more info if you need ...

    Read the article

  • Passing integer lists in a sql query, best practices

    - by Artiom Chilaru
    I'm currently looking at ways to pass lists of integers in a SQL query, and try to decide which of them is best in which situation, what are the benefots of each, and what are the pitfalls, what should be avoided :) Right now I know of 3 ways that we currently use in our application. 1) Table valued parameter: Create a new Table Valued Parameter in sql server: CREATE TYPE [dbo].[TVP_INT] AS TABLE( [ID] [int] NOT NULL ) Then run the query against it: using (var conn = new SqlConnection(DataContext.GetDefaultConnectionString)) { var comm = conn.CreateCommand(); comm.CommandType = CommandType.Text; comm.CommandText = @" UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN @values IDs ON DA.ID = IDs.ID"; comm.Parameters.Add(new SqlParameter("values", downloadResults.Select(d => d.ID).ToDataTable()) { TypeName = "TVP_INT" }); conn.Open(); comm.ExecuteScalar(); } The major disadvantages of this method is the fact that Linq doesn't support table valued params (if you create an SP with a TVP param, linq won't be able to run it) :( 2) Convert the list to Binary and use it in Linq! This is a bit better.. Create an SP, and you can run it within linq :) To do this, the SP will have an IMAGE parameter, and we'll be using a user defined function (udf) to convert this to a table.. We currently have implementations of this function written in C++ and in assembly, both have pretty much the same performance :) Basically, each integer is represented by 4 bytes, and passed to the SP. In .NET we have an extension method that convers an IEnumerable to a byte array The extension method: public static Byte[] ToBinary(this IEnumerable intList) { return ToBinaryEnum(intList).ToArray(); } private static IEnumerable<Byte> ToBinaryEnum(IEnumerable<Int32> intList) { IEnumerator<Int32> marker = intList.GetEnumerator(); while (marker.MoveNext()) { Byte[] result = BitConverter.GetBytes(marker.Current); Array.Reverse(result); foreach (byte b in result) yield return b; } } The SP: CREATE PROCEDURE [Accounts-UpdateImportAttempts] @values IMAGE AS BEGIN UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN dbo.udfIntegerArray(@values, 4) IDs ON DA.ID = IDs.Value4 END And we can use it by running the SP directly, or in any linq query we need using (var db = new DataContext()) { db.Accounts_UpdateImportAttempts(downloadResults.Select(d => d.ID).ToBinary()); // or var accounts = db.Accounts .Where(a => db.udfIntegerArray(downloadResults.Select(d => d.ID).ToBinary(), 4) .Select(i => i.Value4) .Contains(a.ID)); } This method has the benefit of using compiled queries in linq (which will have the same sql definition, and query plan, so will also be cached), and can be used in SPs as well. Both these methods are theoretically unlimited, so you can pass millions of ints at a time :) 3) The simple linq .Contains() It's a more simple approach, and is perfect in simple scenarios. But is of course limited by this. using (var db = new DataContext()) { var accounts = db.Accounts .Where(a => downloadResults.Select(d => d.ID).Contains(a.ID)); } The biggest drawback of this method is that each integer in the downloadResults variable will be passed as a separate int.. In this case, the query is limited by sql (max allowed parameters in a sql query, which is a couple of thousand, if I remember right). So I'd like to ask.. What do you think is the best of these, and what other methods and approaches have I missed?

    Read the article

  • Does anyone know how to appropriately deal with user timezones in rails 2.3?

    - by Amazing Jay
    We're building a rails app that needs to display dates (and more importantly, calculate them) in multiple timezones. Can anyone point me towards how to work with user timezones in rails 2.3(.5 or .8) The most inclusive article I've seen detailing how user time zones are supposed to work is here: http://wiki.rubyonrails.org/howtos/time-zones... although it is unclear when this was written or for what version of rails. Specifically it states that: "Time.zone - The time zone that is actually used for display purposes. This may be set manually to override config.time_zone on a per-request basis." Keys terms being "display purposes" and "per-request basis". Locally on my machine, this is true. However on production, neither are true. Setting Time.zone persists past the end of the request (to all subsequent requests) and also affects the way AR saves to the DB (basically treating any date as if it were already in UTC even when its not), thus saving completely inappropriate values. We run Ruby Enterprise Edition on production with passenger. If this is my problem, do we need to switch to JRuby or something else? To illustrate the problem I put the following actions in my ApplicationController right now: def test p_time = Time.now.utc s_time = Time.utc(p_time.year, p_time.month, p_time.day, p_time.hour) logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect logger.error p_time.inspect logger.error s_time.inspect jl = JunkLead.create! jl.date_at = s_time logger.error s_time.inspect logger.error jl.date_at.inspect jl.save! logger.error s_time.inspect logger.error jl.date_at.inspect render :nothing => true, :status => 200 end def test2 Time.zone = 'Mountain Time (US & Canada)' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end def test3 Time.zone = 'UTC' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end and they yield the following: Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:50) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:15:50 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 21ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test2 (for 98.202.196.203 at 2010-12-24 22:15:53) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Completed in 143ms (View: 1, DB: 3) | 200 OK [http://www.dealsthatmatter.com/test2] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:59) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Fri Dec 24 22:15:59 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Completed in 20ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test3 (for 98.202.196.203 at 2010-12-24 22:16:03) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Completed in 17ms (View: 0, DB: 2) | 200 OK [http://www.dealsthatmatter.com/test3] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:16:04) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:16:05 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 151ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] It should be clear above that the 2nd call to /test shows Time.zone set to Mountain, even though it shouldn't. Additionally, checking the database reveals that the test action when run after test2 saved a JunkLead record with a date of 2010-12-22 15:00:00, which is clearly wrong.

    Read the article

  • Dropdownlist post in ASP.NET MVC3 and Entity Framework Model

    - by Josh Blade
    I have 3 tables: RateProfile RateProfileID ProfileName Rate RateID RateProfileID PanelID Other stuff to update Panel PanelID PanelName I have models for each of these. I have an edit page using the RateProfile model. I display the information for RateProfile and also all of the Rates associated with it. This works fine and I can update it fine. However, I also added a dropdown so that I can filter Rates by PanelID. I need it to post back on change so that it can display the filtered rates. I'm using @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) for my dropdownlist. Whenever it posts back to my HttpPost Edit method though, it seems to be missing all information about the Rates navigation property. It's weird because I thought it would do exactly what the input/submit button that I have in the form does (which actually passes the entire model back to my HttpPost Edit action and does what I want it to do). The panelID is properly being passed to my HttpPost Edit method and on to the next view, but when I try to query the Model.Rates navigation property is null (only when the post comes from the dropdown. Everything works fine when the post comes from my submit input). Get Edit: public ActionResult Edit(int id, int panelID = 1) { RateProfile rateprofile = db.RateProfiles.Single(r => r.RateProfileID == id); var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; return View(rateprofile); } HttpPost Edit: [HttpPost] public ActionResult Edit(RateProfile rateprofile, int panelID) { var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; if (ModelState.IsValid) { db.Entry(rateprofile).State = EntityState.Modified; foreach (Rate dimerate in rateprofile.Rates) { db.Entry(dimerate).State = EntityState.Modified; } db.SaveChanges(); return View(rateprofile); } return View(rateprofile); } View: @model PDR.Models.RateProfile @using (Html.BeginForm(null,null,FormMethod.Post, new {id="RateForm"})) { <div> @Html.Label("Panel") @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) </div> @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();} @for (int i = 0; i < rates.Count; i++) { <tr> <td> @Html.HiddenFor(modelItem => rates[i].RateProfileID) @Html.HiddenFor(modelItem => rates[i].RateID) @Html.HiddenFor(modelItem => rates[i].PanelID) @Html.EditorFor(modelItem => rates[i].minCount) @Html.ValidationMessageFor(model => rates[i].minCount) </td> <td> @Html.EditorFor(modelItem => rates[i].maxCount) @Html.ValidationMessageFor(model => rates[i].maxCount) </td> <td> @Html.EditorFor(modelItem => rates[i].Amount) @Html.ValidationMessageFor(model => rates[i].Amount) </td> </tr> } <input type="submit" value="Save" /> } To summarize my problem, the below query in my view only works when the post comes from the submit button and not when it comes from my dropdownlist. @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();}

    Read the article

  • SQL SERVER – Introduction to Extended Events – Finding Long Running Queries

    - by pinaldave
    The job of an SQL Consultant is very interesting as always. The month before, I was busy doing query optimization and performance tuning projects for our clients, and this month, I am busy delivering my performance in Microsoft SQL Server 2005/2008 Query Optimization and & Performance Tuning Course. I recently read white paper about Extended Event by SQL Server MVP Jonathan Kehayias. You can read the white paper here: Using SQL Server 2008 Extended Events. I also read another appealing chapter by Jonathan in the book, SQLAuthority Book Review – Professional SQL Server 2008 Internals and Troubleshooting. After reading these excellent notes by Jonathan, I decided to upgrade my course and include Extended Event as one of the modules. This week, I have delivered Extended Events session two times and attendees really liked the said course. They really think Extended Events is one of the most powerful tools available. Extended Events can do many things. I suggest that you read the white paper I mentioned to learn more about this tool. Instead of writing a long theory, I am going to write a very quick script for Extended Events. This event session captures all the longest running queries ever since the event session was started. One of the many advantages of the Extended Events is that it can be configured very easily and it is a robust method to collect necessary information in terms of troubleshooting. There are many targets where you can store the information, which include XML file target, which I really like. In the following Events, we are writing the details of the event at two locations: 1) Ringer Buffer; and 2) XML file. It is not necessary to write at both places, either of the two will do. -- Extended Event for finding *long running query* IF EXISTS(SELECT * FROM sys.server_event_sessions WHERE name='LongRunningQuery') DROP EVENT SESSION LongRunningQuery ON SERVER GO -- Create Event CREATE EVENT SESSION LongRunningQuery ON SERVER -- Add event to capture event ADD EVENT sqlserver.sql_statement_completed ( -- Add action - event property ACTION (sqlserver.sql_text, sqlserver.tsql_stack) -- Predicate - time 1000 milisecond WHERE sqlserver.sql_statement_completed.duration > 1000 ) -- Add target for capturing the data - XML File ADD TARGET package0.asynchronous_file_target( SET filename='c:\LongRunningQuery.xet', metadatafile='c:\LongRunningQuery.xem'), -- Add target for capturing the data - Ring Bugger ADD TARGET package0.ring_buffer (SET max_memory = 4096) WITH (max_dispatch_latency = 1 seconds) GO -- Enable Event ALTER EVENT SESSION LongRunningQuery ON SERVER STATE=START GO -- Run long query (longer than 1000 ms) SELECT * FROM AdventureWorks.Sales.SalesOrderDetail ORDER BY UnitPriceDiscount DESC GO -- Stop the event ALTER EVENT SESSION LongRunningQuery ON SERVER STATE=STOP GO -- Read the data from Ring Buffer SELECT CAST(dt.target_data AS XML) AS xmlLockData FROM sys.dm_xe_session_targets dt JOIN sys.dm_xe_sessions ds ON ds.Address = dt.event_session_address JOIN sys.server_event_sessions ss ON ds.Name = ss.Name WHERE dt.target_name = 'ring_buffer' AND ds.Name = 'LongRunningQuery' GO -- Read the data from XML File SELECT event_data_XML.value('(event/data[1])[1]','VARCHAR(100)') AS Database_ID, event_data_XML.value('(event/data[2])[1]','INT') AS OBJECT_ID, event_data_XML.value('(event/data[3])[1]','INT') AS object_type, event_data_XML.value('(event/data[4])[1]','INT') AS cpu, event_data_XML.value('(event/data[5])[1]','INT') AS duration, event_data_XML.value('(event/data[6])[1]','INT') AS reads, event_data_XML.value('(event/data[7])[1]','INT') AS writes, event_data_XML.value('(event/action[1])[1]','VARCHAR(512)') AS sql_text, event_data_XML.value('(event/action[2])[1]','VARCHAR(512)') AS tsql_stack, CAST(event_data_XML.value('(event/action[2])[1]','VARCHAR(512)') AS XML).value('(frame/@handle)[1]','VARCHAR(50)') AS handle FROM ( SELECT CAST(event_data AS XML) event_data_XML, * FROM sys.fn_xe_file_target_read_file ('c:\LongRunningQuery*.xet', 'c:\LongRunningQuery*.xem', NULL, NULL)) T GO -- Clean up. Drop the event DROP EVENT SESSION LongRunningQuery ON SERVER GO Just run the above query, afterwards you will find following result set. This result set contains the query that was running over 1000 ms. In our example, I used the XML file, and it does not reset when SQL services or computers restarts (if you are using DMV, it will reset when SQL services restarts). This event session can be very helpful for troubleshooting. Let me know if you want me to write more about Extended Events. I am totally fascinated with this feature, so I’m planning to acquire more knowledge about it so I can determine its other usages. Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: Pinal Dave, SQL, SQL Authority, SQL Optimization, SQL Performance, SQL Query, SQL Scripts, SQL Server, SQL Tips and Tricks, SQL Training, SQLServer, T SQL, Technology Tagged: SQL Extended Events

    Read the article

  • php amqp error while running make

    - by Dmitriy Apollonin
    I'm trying to install php amqp according to this answer http://stackoverflow.com/a/9997263/2271028 but at the make command i see following: /bin/bash /var/www/rabbitmq-c/amqp-1.4.0/libtool --mode=compile cc -I. -I/var/www/rabbitmq-c/amqp-1.4.0 -DPHP_ATOM_INC -I/var/www/rabbitmq-c/amqp-1.4.0/include -I/var/www/rabbitmq-c/amqp-1.4.0/main -I/var/www/rabbitmq-c/amqp-1.4.0 -I/usr/include/php5 -I/usr/include/php5/main -I/usr/include/php5/TSRM -I/usr/include/php5/Zend -I/usr/include/php5/ext -I/usr/include/php5/ext/date/lib -DHAVE_CONFIG_H -g -O2 -c /var/www/rabbitmq-c/amqp-1.4.0/amqp.c -o amqp.lo libtool: compile: cc -I. -I/var/www/rabbitmq-c/amqp-1.4.0 -DPHP_ATOM_INC -I/var/www/rabbitmq-c/amqp-1.4.0/include -I/var/www/rabbitmq-c/amqp-1.4.0/main -I/var/www/rabbitmq-c/amqp-1.4.0 -I/usr/include/php5 -I/usr/include/php5/main -I/usr/include/php5/TSRM -I/usr/include/php5/Zend -I/usr/include/php5/ext -I/usr/include/php5/ext/date/lib -DHAVE_CONFIG_H -g -O2 -c /var/www/rabbitmq-c/amqp-1.4.0/amqp.c -fPIC -DPIC -o .libs/amqp.o In file included from /var/www/rabbitmq-c/amqp-1.4.0/amqp.c:46:0: /var/www/rabbitmq-c/amqp-1.4.0/php_amqp.h:303:2: error: unknown type name 'amqp_socket_t' /var/www/rabbitmq-c/amqp-1.4.0/amqp.c: In function 'amqp_error': /var/www/rabbitmq-c/amqp-1.4.0/amqp.c:616:4: warning: format '%s' expects argument of type 'char *', but argument 4 has type 'int' [-Wformat] make: *** [amqp.lo] Error 1 I see that there is some trouble with make, but can not resolve this problem. Any ideas? Thanks.

    Read the article

  • Looking into ASP.Net MVC 4.0 Mobile Development - part 1

    - by nikolaosk
    In this post I will be looking how ASP.Net MVC 4.0 helps us to create web solutions that target mobile devices.We all experience the magic that is the World Wide Web through mobile devices. Millions of people around the world, use tablets and smartphones to view the contents of websites,e-shops and portals.ASP.Net MVC 4.0 includes a new mobile project template and the ability to render a different set of views for different types of devices.There is a new feature that is called browser overriding which allows us to control exactly what a user is going to see from your web application regardless of what type of device he is using.In order to follow along this post you must have Visual Studio 2012 and .Net Framework 4.5 installed in your machine.Download and install VS 2012 using this link.My machine runs on Windows 8 and Visual Studio 2012 works just fine.It will work fine in Windows 7 as well so do not worry if you do not have the latest Microsoft operating system.1) Launch VS 2012 and create a new Web Forms application by going to File - >New Project - > ASP.Net MVC 4 Web Application and then click OKHave a look at the picture below  2) From the available templates select Mobile Application and then click OK.Have a look at the picture below 3) When I run the application I get the mobile view of the page. I would like to show you what a typical ASP.Net MVC 4.0 application looks like. So I will create a new simple ASP.Net MVC 4.0 Web Application. When I run the application I get the normal page view.Have a look at the picture below.On the left is the mobile view and on the right the normal view. As you can see we have more or less the same content in our mobile application (log in,register) compared with the normal ASP.Net MVC 4.0 application but it is optimised for mobile devices. 4) Let me explain how and when the mobile view is selected and finally rendered.There is a feature in MVC 4.0 that is called Display Modes and with this feature the runtime will select a view.If we have 2 views e.g contact.mobile.cshtml and contact.cshtml in our application the Controller at some point will instruct the runtime to select and render a view named contact.The runtime will look at the browser making the request and will determine if it is a mobile browser or a desktop browser. So if there is a request from my IPhone Safari browser for a particular site, if there is a mobile view the MVC 4.0 will select it and render it. If there is not a mobile view, the normal view will be rendered.5) In the  ASP.Net MVC 4.0 (Internet application) I created earlier (not the first project which was a mobile one) I can run it once more and see how it looks on the browser. If I want to view it with a mobile browser I must download one emulator like Opera Mobile.You can download Opera Mobile hereWhen I run the application I get the same view in both the desktop and the mobile browser. That was to be expected. Have a look at the picture below 6) Then I create another version of the _Layout.mobile.cshtml view in the Shared folder.I simply copy and paste the _Layout.cshtml  into the same folder and then rename it to _Layout.mobile.cshtml and then just alter the contents of the _Layout.mobile.cshtml.When I run again the application I get a different view on the desktop browser and a different one on the Opera mobile browser.Have a look at the picture below ?he Controller will instruct the ASP.Net runtime to select and render a view named _Layout.mobile.cshtml when the request will come from a mobile browser.?he runtime knows that a browser is a mobile one through the ASP.Net browser capability provider. Hope it helps!!!

    Read the article

< Previous Page | 268 269 270 271 272 273 274 275 276 277 278 279  | Next Page >