Search Results

Search found 2844 results on 114 pages for 'iterative conversion'.

Page 28/114 | < Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >

  • How can I convert a large number of Word documents to HTML as fast as possible?

    - by metal gear solid
    I have to convert 500 Microsoft Word 2003 files into HTML documents. What would be the shortest possible way? I'm not just talking about extension .doc to HTML. I want to convert word files's data into HTML tags. Word 2007 is installed in my system. Any suggestion which can help to accomplish this task quickly would be nice. If you will suggest any tool then that should not be commercial. Should be free or portable.

    Read the article

  • How can I get ffmpeg to convert a .mov to a .gif?

    - by user29336
    I'm trying to convert a .mov to a .gif and I'm not having success. Here's the error: ffmpeg -pix_fmt rgb24 -i yesbuddy.mov output.gif ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers built on Jun 12 2012 17:47:34 with clang 2.1 (tags/Apple/clang-163.7.1) configuration: --prefix=/usr/local/Cellar/ffmpeg/0.11.1 --enable-shared --enable-gpl --enable-version3 --enable-nonfree --enable-hardcoded-tables --enable-libfreetype --cc=/usr/bin/clang --enable-libx264 --enable-libfaac --enable-libmp3lame --enable-librtmp --enable-libtheora --enable-libvorbis --enable-libvpx --enable-libxvid --enable-libopencore-amrnb --enable-libopencore-amrwb --enable-libass --enable-libvo-aacenc --disable-ffplay libavutil 51. 54.100 / 51. 54.100 libavcodec 54. 23.100 / 54. 23.100 libavformat 54. 6.100 / 54. 6.100 libavdevice 54. 0.100 / 54. 0.100 libavfilter 2. 77.100 / 2. 77.100 libswscale 2. 1.100 / 2. 1.100 libswresample 0. 15.100 / 0. 15.100 libpostproc 52. 0.100 / 52. 0.100 Option pixel_format not found. If I leave out the -pix_fmt rgb24 part it complains. Thoughts on how to fix?

    Read the article

  • Converting Powerpoint to PDF solutions?

    - by OWiz
    I asked a version of this question earlier, but I'm in need of other solutions, so this is a more pointed question. I'm in need of a server-based solution for converting ppt files to pdf files. This solution can either sit on the current web server as a console command-triggered service, it can be integrated into the C# code of the web all, or it can be it's own server. It also can't be based off of Libreoffice or Openoffice, as those two have problems converting SmartArt. I'm currently using Libreoffice. I've tried Powerpoint console commands combined with a PDF driver but I can't get that to work from C#. I've tried a .vbs script, but that briefly opens the powerpoint window.

    Read the article

  • Batch convert of Word docs with images to HTML

    - by dylpickle
    OK, here is my situation: I made a knowledge base for a company, they have about 500 word documents with screenshots in them explaining procedures and such. I can easily paste the text into the cms wysiwyg editor on the knowledge base but the images need to be uploaded one at a time, then sized and placed in the article. Question: Is there any suggestions for an automatic method to to convert the documents to html with the appropriate image tags and links to the images in them, and export/package the images for ftp upload? I can already convert them to HTML automatically using a batch file and a program, but converting the images to the correct tags with href link, then exporting them for ftp is where i need some help. Might not even be possible, but if anyone has tried to do something like this I would like to here how you approached this.

    Read the article

  • How can I convert an avi to something ipod can view?

    - by chris
    My son received a DVD with some AVI files of his soccer game. (I think they're from a Sharp camcorder, but I'm not 100% sure of that). How can I convert them to a format that he can view on his ipod touch? I have a Mac, Linux and Windows machines available, so any platform-specific recommendations are welcome.

    Read the article

  • PDF - re/generate image using stream content

    - by tom_tap
    I have pdf file with 8 content streams (bytes) which behave like image layers (but they are not layers that I can turn off/on in Adobe Reader). I would like to extract these images separately, because they overlap each other (thus I am not able to "Take a Snapshot" or "Copy File to Clipboard"). So now I have these streams in below format: <Start Stream> q 599.7601 0 0 71.99921 5951.03423 4282.48177 cm /Im0 Do Q q 599.7601 0 0 71.99921 5951.03432 4210.48177 cm /Im1 Do Q q 599.7601 0 0 71.99921 5951.03441 4138.48177 cm /Im2 Do [...] My question is: how to use these data to generate or regenerate these images to be able to save it as raster or vector file? I have already tried pstoedit, but it doesn't work properly beacuse of these multi streams. Same with PDFedit.

    Read the article

  • 500 MB Avi video from CD lagging/glitching when reproduced

    - by Caki Esther
    I created an extra cd with Nero Burning that contains both audio tracks (I can hear them correctly) and a .avi presentation (pretty big one, 540 MB on a 700 MB cd). The audio is fine but the problem is that when the video is played from the cd (with whatever media player: Windows Media Player, VLC, etc..) it lags/glitches/stutters. I'd like the video to be smooth, how should I burn the video to reduce this effect? I mean: what kind of compression/format and why?

    Read the article

  • How to suppress the unsolicited footer when converting HTML -> PDF with Acrobat?

    - by gojira
    I often convert & combine (via contextmenu) HTML pages to PDF using Acrobat (not Acrobat Reader). I use Adobe Acrobat Pro 9 Extended, version 9.1.2. The converted PDFs always have the full path of the original file on the bottom of the PDF-page, also they have an additional header line with the document. I need to suppress that. I do not want the unsolicited header and footer in the resulting PDF files as they are a pain to reomve manually, with a certain page count per document it becomes impossible. Is it possible to suppres that and if, how?

    Read the article

  • How can I convert and repair MPEG-TS (DVB-S captures) for better playback?

    - by SofaKng
    I have a lot of MPEG-TS video files (H.264 video with AC3 or MP3 in a .TS container) captured from a DVB-S capture card. When I play these videos it's much slower to seek in the video (ie. skip 30 seconds, etc) than with other files. I'm not sure if the problem is the H.264 encoding (reference frame count?) or the MPEG-TS container, or if the MPEG-TS file contains sync errors, etc. Does anybody have a good workflow for converting and repairing these files?

    Read the article

  • Batch convert AppleWorks files into PDF within originating folder, delete original file?

    - by Manca Weeks
    Probably AppleScript is the way to go with this - I have found scripts online that do this, but snag on oversize printable area and put files in the same folder - I need files to stay in the folder the source came from. If the script also deleted the original AppleWorks file, that would be even better, but not required. I have tried the last script from this post: https://discussions.apple.com/message/10127260#10127260#10127260 Any suggestions would be much appreciated.

    Read the article

  • Flatten Word document

    - by user126389
    I have a document with some precise formatting, created in Word. This doc was converted to PDF for distribution. Now the original is lost, and reconverting to Word using a PDF to word add-on from Microsoft results in many text boxes in the new DOC file. How can I 'flatten' this to remove the text boxes and retain most of the formatting in order to update the contents? Recreating the original formatting would take a long time.

    Read the article

  • How to embed word doc as background picture of an Access report using .EMF or equivalent ?

    - by iDevlop
    My company's standard paper has logo, address and all the details in the right margin with a vertical blue line. I have that as a word template. I want to have the same thing as the background of my Invoices report. I managed to do that 5 years ago by saving to EMF format (vector format, prints out nicely) and putting the file as the background of the report. Now my company is moving, and I need to change the address on my invoices, but I can't find out how I did to convert the word doc to EMF. Any suggestion ? By EMF or another process, but I want to avoid BMP, which is huge and does not print nicely. Thanks !

    Read the article

  • Batch converting video from avc1 to xvid

    - by Tommy Brunn
    I need a way to batch convert 720p video files from avc1 to xvid in Ubuntu 10.04. I'm not terribly concerned about file size, but I do wish to retain the picture quality as much as possible. I believe the audio is encoded as aac, which is fine for my purposes. What would be the best and easiest way to do this? I've tried using Handbrake. During my first attempt, I had it using ffmpeg to convert to MPEG-4, but that just gave me a super-low quality video at twice the file size. Trying h.264 now, so we'll see how that works out. But just in case it doesn't pan out so well, what other ways do you recommend? I was thinking I'd write a bash script to reencode the files one by one, but the problem is that I have very little knowledge about codecs and containers and whatnot - so I wouldn't know what parameters I would pass ffmpeg/mencoder.

    Read the article

  • how to know if a video file can be played on a dvd player

    - by user23950
    Is there an application that can emulate a dvd player? I've converted a .mp4 video using allok video converter. And choose the output format to be xVid(.avi)<--that is exactly what is written on the application. I don't want to waste a blank dvd and try if it really can be played. So if you have tried this before please tell me if it works. And I have tried burning .avi files and it works because they are genuine avi files which I did not convert

    Read the article

  • ffmpeg - creating DNxHD MFX files with alphas

    - by Hugh
    I'm struggling with something in FFMpeg at the moment... I'm trying to make DNxHD 1080p/24, 36Mb/s MXF files from a sequence of PNG files. My current command-line is: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mxf -pix_fmt rgb32 -b 36Mb /tmp/temp.mxf To which ffmpeg gives me the output: Input #0, image2, from '/tmp/temp.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mxf, to '/tmp/temp.mxf': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 [mxf @ 0x1005800]unsupported video frame rate Could not write header for output file #0 (incorrect codec parameters ?) There are a few things in here that concern me: The output stream is insisting on being yuv422p, which doesn't support alpha. 24fps is an unsupported video frame rate? I've tried 23.976 too, and get the same thing. I then tried the same thing, but writing to a quicktime (still DNxHD, though) with: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mov -pix_fmt rgb32 -b 36Mb /tmp/temp.mov This gives me the output: Input #0, image2, from '/tmp/1274263259.28098.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mov, to '/tmp/1274263259.28098.mov': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 Press [q] to stop encoding frame= 39 fps= 9 q=1.0 Lsize= 7177kB time=1.62 bitrate=36180.8kbits/s video:7176kB audio:0kB global headers:0kB muxing overhead 0.013636% Which obviously works, to a certain extent, but still has the issue of being yuv422p, and therefore losing the alpha. If I'm going to QuickTime, then I can get what I need using Shake, but my main aim here is to be able to generate .mxf files. Any thoughts? Thanks

    Read the article

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

< Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >