Search Results

Search found 3684 results on 148 pages for 'sequence logo'.

Page 29/148 | < Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >

  • Why is XML Deserilzation not throwing exceptions when it should.

    - by chobo2
    Hi Here is some dummy xml and dummy xml schema I made. schema <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.domain.com" xmlns="http://www.domain.com" elementFormDefault="qualified"> <xs:element name="vehicles"> <xs:complexType> <xs:sequence> <xs:element name="owner" minOccurs="1" maxOccurs="1"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="2" /> <xs:maxLength value="8" /> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="Car" minOccurs="1" maxOccurs="1"> <xs:complexType> <xs:sequence> <xs:element name="Information" type="CarInfo" minOccurs="0" maxOccurs="unbounded" /> </xs:sequence> </xs:complexType> </xs:element> <xs:element name="Truck"> <xs:complexType> <xs:sequence> <xs:element name="Information" type="CarInfo" minOccurs="0" maxOccurs="unbounded"/> </xs:sequence> </xs:complexType> </xs:element> <xs:element name="SUV"> <xs:complexType> <xs:sequence> <xs:element name="Information" type="CarInfo" minOccurs="0" maxOccurs="unbounded" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> <xs:complexType name="CarInfo"> <xs:sequence> <xs:element name="CarName"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="1"/> <xs:maxLength value="50"/> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="CarPassword"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="6"/> <xs:maxLength value="50"/> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="CarEmail"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:pattern value="\w+([-+.']\w+)*@\w+([-.]\w+)*\.\w+([-.]\w+)*"/> </xs:restriction> </xs:simpleType> </xs:element> </xs:sequence> </xs:complexType> </xs:schema> xml sample <?xml version="1.0" encoding="utf-8" ?> <vehicles> <owner>Car</owner> <Car> <Information> <CarName>Bob</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> <Information> <CarName>Bob2</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> </Car> <Truck> <Information> <CarName>Jim</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> <Information> <CarName>Jim2</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> </Truck> <SUV> <Information> <CarName>Jane</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> <Information> <CarName>Jane</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> </SUV> </vehicles> Serialization Class using System; using System.Collections.Generic; using System.Xml; using System.Xml.Serialization; [XmlRoot("vehicles")] public class MyClass { public MyClass() { Cars = new List<Information>(); Trucks = new List<Information>(); SUVs = new List<Information>(); } [XmlElement(ElementName = "owner")] public string Owner { get; set; } [XmlElement("Car")] public List<Information> Cars { get; set; } [XmlElement("Truck")] public List<Information> Trucks { get; set; } [XmlElement("SUV")] public List<Information> SUVs { get; set; } } public class CarInfo { public CarInfo() { Info = new List<Information>(); } [XmlElement("Information")] public List<Information> Info { get; set; } } public class Information { [XmlElement(ElementName = "CarName")] public string CarName { get; set; } [XmlElement("CarPassword")] public string CarPassword { get; set; } [XmlElement("CarEmail")] public string CarEmail { get; set; } } Now I think this should all validate. If not assume it is write as my real file does work and this is what this dummy one is based off. Now my problem is this. I want to enforce as much as I can from my schema. Such as the "owner" tag must be the first element and should show up one time and only one time ( minOccurs="1" maxOccurs="1"). Right now I can remove the owner element from my dummy xml file and deseriliaze it and it will go on it's happy way and convert it to object and will just put that property as null. I don't want that I want it to throw an exception or something saying this does match what was expected. I don't want to have to validate things like that once deserialized. Same goes for the <car></car> tag I want that to appear always even if there is no information yet I can remove that too and it will be happy with that. So what tags do I have to add to make my serialization class know that these things are required and if they are not found throw an exception.

    Read the article

  • Initialization of std::vector<unsigned int> with a list of consecutive unsigned integers

    - by Thomas
    I want to use a special method to initialize a std::vector<unsigned int> which is described in a C++ book I use as a reference (the German book 'Der C++ Programmer' by Ulrich Breymann, in case that matters). In that book is a section on sequence types of the STL, referring in particular to list, vector and deque. In this section he writes that there are two special constructors of such sequence types, namely, if Xrefers to such a type, X(n, t) // creates a sequence with n copies of t X(i, j) // creates a sequence from the elements of the interval [i, j) I want to use the second one for an interval of unsigned int, that is std::vector<unsigned int> l(1U, 10U); to get a list initialized with {1,2,...,9}. What I get, however, is a vector with one unsigned int with value 10 :-| Does the second variant exist, and if yes, how do I force that it is called?

    Read the article

  • Deserializing classes from XML generated using XSD.exe

    - by heap
    I have classes generated (using xsd.exe) from an .xsd that I can serialize just fine, but when I try and deserialize it, I get the error: {"<XMLLanguages xmlns='http://tempuri.org/XMLLanguages.xsd'> was not expected."} I've searched for a couple of hours and found most peoples problems lie in not declaring namespaces in their xsd/xml, not defining namespaces in their classes, etc, but I can't find a solution for my problem. Here are code snippets for the relevant classes. <?xml version="1.0" encoding="utf-8"?> <xs:schema id="SetupData" targetNamespace="http://tempuri.org/XMLLanguages.xsd" elementFormDefault="qualified" xmlns="http://tempuri.org/XMLLanguages.xsd" xmlns:xs="http://www.w3.org/2001/XMLSchema" > <xs:element name="XMLLanguages"> <xs:complexType> <xs:sequence> <xs:element name="Tier" minOccurs="1" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="L" minOccurs="1" maxOccurs="unbounded" type="Language"/> </xs:sequence> <xs:attribute name="TierID" type="xs:int"/> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> <xs:complexType name="Language"> <xs:sequence> <xs:element name="LangID" type="xs:int"/> <xs:element name="Tier" type="xs:int"/> <xs:element name ="Name" type="xs:string"/> </xs:sequence> <xs:attribute name ="PassRate" type="xs:int"/> </xs:complexType> </xs:schema> And the class: /// <remarks/> [System.CodeDom.Compiler.GeneratedCodeAttribute("xsd", "4.0.30319.1")] [System.SerializableAttribute()] [System.Diagnostics.DebuggerStepThroughAttribute()] [System.ComponentModel.DesignerCategoryAttribute("code")] [System.Xml.Serialization.XmlTypeAttribute(Namespace = "http://tempuri.org/XMLLanguages.xsd")] [System.Xml.Serialization.XmlRootAttribute(Namespace = "http://tempuri.org/XMLLanguages.xsd", IsNullable = false)] public partial class XMLLanguages { private List<XMLLanguagesTier> tierField; /// <remarks/> [System.Xml.Serialization.XmlElementAttribute("Tier")] public List<XMLLanguagesTier> Tiers { get { return this.tierField; } set { this.tierField = value; } } } And a the line in XML causing the error: <XMLLanguages xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://tempuri.org/XMLLanguages.xsd">

    Read the article

  • database schema eligible for delta synchronization

    - by WilliamLou
    it's a question for discussion only. Right now, I need to re-design a mysql database table. Basically, this table contains all the contract records I synchronized from another database. The contract record can be modified, deleted or users can add new contract records via GUI interface. At this stage, the table structure is exactly the same as the Contract info (column: serial number, expiry date etc.). In that case, I can only synchronize the whole table (delete all old records, replace with new ones). If I want to delta(only synchronize with modified, new, deleted records) synchronize the table, how should I change the database schema? here is the method I come up with, but I need your suggestions because I think it's a common scenario in database applications. 1)introduce a sequence number concept/column: for each sequence, mark the new added records, modified records, deleted records with this sequence number. By recording the last synchronized sequence number, only pass those records with higher sequence number; 2) because deleted contracts can be added back, and the original table has primary key constraints, should I create another table for those deleted records? or add a flag column to indicate if this contract has been deleted? I hope I explain my question clearly. Anyway, if you know any articles or your own suggestions about this, please let me know. Thanks!

    Read the article

  • Validate xsl fo in xslt styleesheet

    - by Biegal
    Hi, i have a little problem with validating xml, xslt in details. I have a xslt stylesheet that, transforms xml data source to xsl:fo document. Something like this: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"> <xsl:template match="/"> <fo:root xmlns:fo="http://www.w3.org/1999/XSL/Format" xmlns="http://www.w3.org/1999/xhtml"> <fo:layout-master-set> <fo:simple-page-master margin-top="25mm" margin-bottom="25mm" margin-left="25mm" margin-right="25mm" page-width="210mm" page-height="297mm" master-name="simplePageLayout"> <fo:region-body region-name="xsl-region-body" column-gap="0.25in" /> <fo:region-before region-name="xsl-region-before" display-align="after" extent="0.1mm" padding-top="0pt" padding-left="0.4in" padding-right="0.4in" padding-bottom="0pt" /> <fo:region-after region-name="xsl-region-after" display-align="before" extent="0.4in" padding-top="4pt" padding-left="0.4in" padding-right="0.4in" padding-bottom="0pt" /> </fo:simple-page-master> <fo:page-sequence-master master-name="default-sequence"> <fo:repeatable-page-master-reference master-reference="simplePageLayout" /> </fo:page-sequence-master> </fo:layout-master-set> <fo:page-sequence master-reference="default-sequence"> <fo:flow flow-name="xsl-region-body"> <fo:block font-family="Segoe UI" color="#000000" font-size="9pt" /> </fo:flow> </fo:page-sequence> </fo:root> </xsl:template> What I want to do, is to validate written xsl:fo elements, ignoring xsl tags. Is it posible? For now I use dtd validation (I have xsd schema too) for validating Fo, but it give me an error on each xsl tag. Summary. Is it posiible to validate only fo elements against the schema, ignoring xsl tags, and how should I do it? Maybe a code snnippet in C#, or a hint how to modify documents? Thanks in advance!

    Read the article

  • Iterator blocks in Clojure?

    - by Checkers
    I am using clojure.contrib.sql to fetch some records from an SQLite database. (defn read-all-foo [] (with-connection *db* (with-query-results res ["select * from foo"] (into [] res)))) Now, I don't really want to realize the whole sequence before returning from the function (i.e. I want to keep it lazy), but if I return res directly or wrap it some kind of lazy wrapper (for example I want to make a certain map transformation on result sequence), SQL-related bindings will be reset and connection will be closed after I return, so realizing the sequence will throw an exception. How can I enclose the whole function in a closure and return a kind of iterator block (like yield in C# or Python)? Or is there another way to return a lazy sequence from this function?

    Read the article

  • db:migrate creates sequences but doesn't alter table?

    - by RewbieNewbie
    Hello, I have a migration that creates a postres sequence for auto incrementing a primary identifier, and then executes a statement for altering the column and specifying the default value: execute 'CREATE SEQUENCE "ServiceAvailability_ID_seq";' execute <<-SQL ALTER TABLE "ServiceAvailability" ALTER COLUMN "ID" set DEFAULT NEXTVAL('ServiceAvailability_ID_seq'); SQL If I run db:migrate everything seems to work, in that no errors are returned, however, if I run the rails application I get: Mnull value in column "ID" violates not-null constraint I have discovered by executing the sql statement in the migration manually, that this error is because the alter statement isn't working, or isn't being executed. If I manually execute the following statement: CREATE SEQUENCE "ServiceAvailability_ID_seq; I get: error : ERROR: relation "serviceavailability_id_seq" already exists Which means the migration successfully created the sequence! However, if I manually run: ALTER TABLE "ServiceProvider" ALTER COLUMN "ID" set DEFAULT NEXTVAL('ServiceProvider_ID_seq'); SQL It runs successfully and creates the default NEXTVAL. So the question is, why is the migration file creating the sequence with the first execute statement, but not altering the table in the second execute? (Remembering, no errors are output on running db:migrate) Thank you and apologies for tl:dr

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Another serialization ? - c#

    - by ltech
    I had asked this Yesterday If my xsd schema changes to <xs:element name="Document" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="MetaDoc" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="ATTRIBUTES" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="author" type="xs:string" minOccurs="0" /> <xs:element name="max_versions" type="xs:string" minOccurs="0" /> <xs:element name="summary" type="xs:string" minOccurs="0" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> My xsd - class generation becomes /// <remarks/> [System.Xml.Serialization.XmlArrayAttribute(Form=System.Xml.Schema.XmlSchemaForm.Unqualified)] [System.Xml.Serialization.XmlArrayItemAttribute("MetaDoc", typeof(DocumentMetaDocATTRIBUTES[]), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false)] [System.Xml.Serialization.XmlArrayItemAttribute("ATTRIBUTES", typeof(DocumentMetaDocATTRIBUTES), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false, NestingLevel=1)] public DocumentMetaDocATTRIBUTES[][][] Document { get { return this.documentField; } set { this.documentField = value; } } If I am deriving to CollectionBase, as shown in my previous post, how would I manage the XmlArrayItemAttribute ? so that I can read this part of my input xml into my strongly types object <Document> <MetaDoc> <ATTRIBUTES> <author>asas</author> <max_versions>1</max_versions> <summary>aasasqqqq</summary> </ATTRIBUTES> </MetaDoc> </Document>

    Read the article

  • Is this code well-defined?

    - by Nawaz
    This code is taken from a discussion going on here. someInstance.Fun(++k).Gun(10).Sun(k).Tun(); Is this code well-defined? Is ++k Fun() evaluated before k in Sun()? What if k is user-defined type, not built-in type? And in what ways the above function calls order is different from this: eat(++k);drink(10);sleep(k); As far as I can say, in both situations, there exists a sequence point after each function call. If so, then why can't the first case is also well-defined like the second one? Section 1.9.17 of the C++ ISO standard says this about sequence points and function evaluation: When calling a function (whether or not the function is inline), there is a sequence point after the evaluation of all function arguments (if any) which takes place before execution of any expressions or statements in the function body. There is also a sequence point after the copying of a returned value and before the execution of any expressions outside the function.

    Read the article

  • Swift CMutablePointers in factories e.g. NewMusicSequence

    - by Gene De Lisa
    How do you use C level factory methods in Swift? Let's try using a factory such as NewMusicSequence(). OSStatus status var sequence:MusicSequence status=NewMusicSequence(&sequence) This errors out with "error: variable 'sequence' passed by reference before being initialized". Set sequence to nil, and you get EXC_BAD_INSTRUCTION. You can try being explicit like this: var sp:CMutablePointer<MusicSequence>=nil status=NewMusicSequence(sp) But then you get a bad access exception when you set sp to nil. If you don't set sp, you get an "error: variable 'sp' used before being initialized" Here's the reference.

    Read the article

  • I am confused -- Will this code always work?

    - by Shekhar
    Hello, I have written this piece of code public class Test{ public static void main(String[] args) { List<Integer> list = new ArrayList<Integer>(); for(int i = 1;i<= 4;i++){ new Thread(new TestTask(i, list)).start(); } while(list.size() != 4){ // this while loop required so that all threads complete their work } System.out.println("List "+list); } } class TestTask implements Runnable{ private int sequence; private List<Integer> list; public TestTask(int sequence, List<Integer> list) { this.sequence = sequence; this.list = list; } @Override public void run() { list.add(sequence); } } This code works and prints all the four elements of list on my machine. My question is that will this code always work. I think there might be a issue in this code when two/or more threads add element to this list at the same point. In that case it while loop will never end and code will fail. Can anybody suggest a better way to do this? I am not very good at multithreading and don't know which concurrent collection i can use? Thanks Shekhar

    Read the article

  • XML Schema for a .NET type that inherits and implements

    - by John Ruiz
    Hi, Please consider the following three .NET types: I have an interface, an abstract class, and a concrete class. My question is how to write the XML Schema to include the properties from the interface and from the abstract class. public interface IStartable { bool RequiresKey { get; set; } void Start(object key); } public abstract class Vehicle { uint WheelCount { get; set; } } public class Car : Vehicle, IStartable { public bool RequiresKey { get; set; } public string Make { get; set; } publilc string Model { get; set; } public Car() {} public void Start(object key) { // start car with key } } I don't know how to complete this schema: <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" targetNamespace="cars" xmlns="cars" xmlns:c="cars"> <!-- How do I get car to have vehicle's wheelcount AND IStartable's RequiresKey? --> <xs:element name="Car" type="c:Car" /> <xs:complexType name="Car"> <xs:complexContent> <xs:extension base="c:Vehicle"> <xs:group ref=c:CarGroup" /> </xs:extension> </xs:complexContent> </xs:complexType> <xs:group name="CarGroup"> <xs:sequence> <xs:element name="Make" type="xs:token" /> <xs:element name="Model" type="xs:token" /> </xs:sequence> </xs:group> <xs:complexType name="Vehicle"> <xs:sequence> <xs:element name="WheelCount" type="xs:unsignedInt" /> </xs:sequence> </xs:complexType> <xs:complexType name="IStartable"> <xs:sequence> <xs:element name="RequiresKey" type="xs:boolean" /> </xs:sequence> </xs:complexType> </xs:schema>

    Read the article

  • Unable to serialize correctly- c#

    - by ltech
    I had asked this Yesterday If my xsd schema changes to <xs:element name="Document" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="MetaDoc" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="ATTRIBUTES" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="author" type="xs:string" minOccurs="0" /> <xs:element name="max_versions" type="xs:string" minOccurs="0" /> <xs:element name="summary" type="xs:string" minOccurs="0" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> My xsd - class generation becomes /// <remarks/> [System.Xml.Serialization.XmlArrayAttribute(Form=System.Xml.Schema.XmlSchemaForm.Unqualified)] [System.Xml.Serialization.XmlArrayItemAttribute("MetaDoc", typeof(DocumentMetaDocATTRIBUTES[]), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false)] [System.Xml.Serialization.XmlArrayItemAttribute("ATTRIBUTES", typeof(DocumentMetaDocATTRIBUTES), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false, NestingLevel=1)] public DocumentMetaDocATTRIBUTES[][][] Document { get { return this.documentField; } set { this.documentField = value; } } If I am deriving to CollectionBase, as shown in my previous post, how would I manage the XmlArrayItemAttribute ? so that I can read this part of my input xml into my strongly types object <Document> <MetaDoc> <ATTRIBUTES> <author>asas</author> <max_versions>1</max_versions> <summary>aasasqqqq</summary> </ATTRIBUTES> </MetaDoc> </Document>

    Read the article

  • "Anagram solver" based on statistics rather than a dictionary/table?

    - by James M.
    My problem is conceptually similar to solving anagrams, except I can't just use a dictionary lookup. I am trying to find plausible words rather than real words. I have created an N-gram model (for now, N=2) based on the letters in a bunch of text. Now, given a random sequence of letters, I would like to permute them into the most likely sequence according to the transition probabilities. I thought I would need the Viterbi algorithm when I started this, but as I look deeper, the Viterbi algorithm optimizes a sequence of hidden random variables based on the observed output. I am trying to optimize the output sequence. Is there a well-known algorithm for this that I can read about? Or am I on the right track with Viterbi and I'm just not seeing how to apply it?

    Read the article

  • Does a Postgresql dump create sequences that start with - or after - the last key?

    - by bennylope
    I recently created a SQL dump of a database behind a Django project, and after cleaning the SQL up a little bit was able to restore the DB and all of the data. The problem was the sequences were all mucked up. I tried adding a new user and generated the Python error IntegrityError: duplicate key violates unique constraint. Naturally I figured my SQL dump didn't restart the sequence. But it did: DROP SEQUENCE "auth_user_id_seq" CASCADE; CREATE SEQUENCE "auth_user_id_seq" INCREMENT 1 START 446 MAXVALUE 9223372036854775807 MINVALUE 1 CACHE 1; ALTER TABLE "auth_user_id_seq" OWNER TO "db_user"; I figured out that a repeated attempt at creating a user (or any new row in any table with existing data and such a sequence) allowed for successful object/row creation. That solved the pressing problem. But given that the last user ID in that table was 446 - the same start value in the sequence creation above - it looks like Postgresql was simply trying to start creating rows with that key. Does the SQL dump provide the wrong start key by 1? Or should I invoke some other command to start sequences after the given start ID? Keenly curious.

    Read the article

  • Anonymous iterators blocks in Clojure?

    - by Checkers
    I am using clojure.contrib.sql to fetch some records from an SQLite database. (defn read-all-foo [] (let [sql "select * from foo"] (with-connection *db* (with-query-results res [sql] (into [] res))))) Now, I don't really want to realize the whole sequence before returning from the function (i.e. I want to keep it lazy), but if I return res directly or wrap it some kind of lazy wrapper (for example I want to make a certain map transformation on result sequence), SQL bindings will be gone after I return, so realizing the sequence will throw an error. How can I enclose the whole function in a closure and return a kind of anonymous iterator block (like yield in C# or Python)? Or is there another way to return a lazy sequence from this function?

    Read the article

  • How to column-ify an output from a certain program?

    - by mbaitoff
    I have a program that generates and outputs a sequence of simple sample math homework tasks, like: 1 + 1 = ... 3 + 3 = ... 2 + 5 = ... 3 + 7 = ... 4 + 2 = ... a sequence can be quite long, and I'd like to save space when this sequence is printed by converting it as follows: 1 + 1 = ... 3 + 7 = ... 3 + 3 = ... 4 + 2 = ... 2 + 5 = ... that is, wrapping the lines into the two or more columns. I was expecting the column linux utility to do the job using the -c N option witn N=2, however, it still outputs the lines in one column whatever the N is. How would I do the column-ifying of the sequence of lines?

    Read the article

  • How to find the largest square in the number (Java)

    - by Ypsilon IV
    Hello everyone, I want to find the largest square in the number, but I am stuck at some point. I would really appreciate some suggestions. This is what I've done so far: I take the number on the input, factorize into prime numbers, and put the sequence of prime numbers to ArrayList. Numbers are sorted, in a sense, thus the numbers in the sequence are increasing. For example, 996 is 2 2 3 83 1000 is 2 2 2 5 5 5 100000 is 2 2 2 2 2 5 5 5 5 5 My idea now is to count number of occurrences of each elements in the sequence, so if the number of occurrences is divisible by two, then this is the square. In this way, I can get another sequence, where the right most element divisible by two is the largest square. What is the most efficient way to count occurrences in the ArrayList? Or is there any better way to find the largest square? Many thanks in advance!

    Read the article

  • How to specify a child element in XML schema with a name but any content?

    - by mackenir
    I am trying to write some XML schema code to specify that a particular element 'abc' may have a child element with name 'xyz', and that element may have any attributes, and any child elements. At the moment I have this: <xs:element name="abc"> <xs:complexType> <xs:sequence> <xs:element name="xyz"> <xs:complexType> <xs:sequence> <xs:any/> </xs:sequence> <xs:anyAttribute/> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> But when I validate my XML against the schema, I get validation failures complaining about the child elements of the xyz element.

    Read the article

  • better for-loop syntax for detecting empty sequences?

    - by Dmitry Beransky
    Hi, Is there a better way to write the following: row_counter = 0 for item in iterable_sequence: # do stuff with the item counter += 1 if not row_counter: # handle the empty-sequence-case Please keep in mind that I can't use len(iterable_sequence) because 1) not all sequences have known lengths; 2) in some cases calling len() may trigger loading of the sequence's items into memory (as the case would be with sql query results). The reason I ask is that I'm simply curious if there is a way to make above more concise and idiomatic. What I'm looking for is along the lines of: for item in sequence: #process item *else*: #handle the empty sequence case (assuming "else" here worked only on empty sequences, which I know it doesn't)

    Read the article

  • Separating merged array of arithmetic and geometric series

    - by user1814037
    My friend asked me an interseting question. Given an array of positive integers in increasing order. Seperate them in two series, an arithmetic sequence and geometric sequence. The given array is such that a solution do exist. The union of numbers of the two sequence must be the given array. Both series can have common elements i.e. series need not to be disjoint. The ratio of the geometric series can be fractional. Example: Given series : 2,4,6,8,10,12,25 AP: 2,4,6,8,10,12 GP: 4,10,25 I tried taking few examples but could not reach a general way. Even tried some graph implementation by introducing edges if they follow a particular sequence but could not reach solution.

    Read the article

  • Anonymous iterator blocks in Clojure?

    - by Checkers
    I am using clojure.contrib.sql to fetch some records from an SQLite database. (defn read-all-foo [] (with-connection *db* (with-query-results res ["select * from foo"] (into [] res)))) Now, I don't really want to realize the whole sequence before returning from the function (i.e. I want to keep it lazy), but if I return res directly or wrap it some kind of lazy wrapper (for example I want to make a certain map transformation on result sequence), SQL-related bindings will be reset and connection will be closed after I return, so realizing the sequence will throw an exception. How can I enclose the whole function in a closure and return a kind of anonymous iterator block (like yield in C# or Python)? Or is there another way to return a lazy sequence from this function?

    Read the article

  • CSS list menu; extra padding on rollover of buttons

    - by user1669878
    I have been going crazy trying to figure out why there is extra padding showing up on my navigation buttons when I rollover them. It's only showing up to the left and right of them though. Here's a link to the screenshot of what it looks like: http://i179.photobucket.com/albums/w319/jdauel/Screenshot2012-09-13at25417PM.png I think it has something to do with my CSS but I have no idea anymore. Please help me??? I tried using Firebug to figure it out with no prevail. Here's the code: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title>Farren's Photography</title> <style type="text/css"> html { height: 100%; width: 100%; } body { margin: 0px; } #container { font-family: Georgia, "Times New Roman", Times, serif; font-size: 1.2em; color: #000; background-color: #06F; text-align: left; padding: 0px; height: 650px; width: 960px; margin-right: auto; margin-left: auto; background-image: url(images/background_image.png); background-repeat: no-repeat; margin-top: 45px; } a:link { color: #FFF; } a:visited { color: #FFF; } a:hover { color: #FFF; } #container #logo { } #container #logo #fp-logo { background-image: url(images/logo.png); height: 137px; width: 408px; text-indent: -9999px; display: block; } #logo { height: 137px; width: 408px; position: relative; padding-top: 35px; padding-right: 0px; padding-bottom: 0px; padding-left: 35px; } #main { background-color: #FFF; min-height: 383px; width: 707px; position: relative; left: 217px; top: 16px; right: 36px; bottom: 113px; } #container #navbar { font-family: Georgia, "Times New Roman", Times, serif; font-size: 14px; color: #FFF; text-align: right; height: 45px; background-color: #CC0000; position: relative; top: 8px; bottom: 0px; left: 0px; right: 0px; } #container #navbar ul li a { text-decoration: none; } #container #navbar ul { list-style-type: none; padding-top: 16px; } #container #navbar ul li { display: inline; background-color: #280803; margin: 0px; height: 0px; width: 0px; position: relative; padding-top: 16px; padding-right: 15px; padding-bottom: 17px; padding-left: 15px; } #container #navbar ul li a:link { text-decoration: none; color: #FFF; } #container #navbar ul li a:visited { text-decoration: none; color: #FFF; } #container #navbar ul li a:hover { text-decoration: none; color: #FFF; background-color: #027e8e; padding-top: 16px; padding-right: 15px; padding-bottom: 17px; padding-left: 15px; margin: 0px; } #footer { font-family: Arial, Helvetica, sans-serif; font-size: x-small; height: 28px; position: relative; top: 8px; color: #FFF; font-style: italic; } </style> </head> <body> <div id="container"> <div id="logo"><a href="http://www.farrensphotography.com" title="Farren's Photography" target="_self" id="fp-logo">Farren's Photography</a></div><!-- end logo --> <div id="main"> <div id="content"> </div><!-- end content --> </div><!-- end main --> <div id="navbar"> <ul> <li><a href="index.html" target="_self">Home</a></li> <li><a href="portfolio.html" target="_self">Portfolio</a></li> <li><a href="mystyle.html" target="_self">My Style</a></li> <li><a href="specials.html" target="_self">Specials</a></li> <li><a href="pricing.html" target="_self">Pricing</a></li> <li><a href="contact.html" target="_self">Contact</a></li> </ul> </div> <!-- end navbar --> <div id="footer"> <div id="copyright">All images copyright© Farrens Photography </div><!-- end copyright --> <div id="network">Facebook button </div><!-- end network --> </div><!-- end footer --> </div><!-- end container --> </body> </html>

    Read the article

  • MySQL - Counting rows in preparation for greatest-n-per-group not working?

    - by John M
    Referring to SO and other sites have given me examples of how to use MySQL to create a 'greatest-n-per-group' query. My variant on this would be to have a query that returns the first 3 rows of each category. As the basis for this I need to sort my data into a usable sequence and that is where my problems start. Running just the sequence query with row numbering shows that changes in category are mostly ignored. I should have 35 categories returning rows but only 5 do so. My query: set @c:=0; set @a:=0; SELECT IF(@c = tdg, @a:=@a+1, @a:=1) AS rownum, (@c:=tdg) , julian_day, sequence, complete, year, tdg FROM tsd WHERE complete = 0 order by tdg, year, julian_day, sequence Do I have a syntax mistake with this query?

    Read the article

< Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >