Search Results

Search found 68407 results on 2737 pages for 'text files'.

Page 29/2737 | < Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >

  • Modifying text files and executing programs with command line parameters in c# or c++ on Linux

    - by Robert Harvey
    I have a need to create a utility in Suze Linux. The utility will make modifications to some text files, and then use the information in those text files to program a device in the computer using a different executable which accepts command line parameters. I am fluent in c#, but have never worked with Linux. Should I take the time to learn Gnu C++ to do this, or install Mono? How would I execute the programming utility and pass it command line parameters?

    Read the article

  • iphone app to read text files.

    - by bandito40
    Hi, Need to edit some of the local text files on my iphone but so far all the apps I have downloaded do not navigate the OS3 file tree for me to load and edit them. I need to do this on my iphone as I can no longer access via ssh or with the iphone cable. One of the files to edit is a ssh config file which is what is not allowing ssh connections. Any ideas on apps or other methods that I could use. Thanks,

    Read the article

  • Generating text file from database

    - by Goldmember
    I have a requirement to hand-code an text file from data residing in a SQL table. Just wondering if there are any best practices here. Should I write it as an XMLDocument first and transform using XSL or just use Streamwriter and skip transformation altogether? The generated text file will be in EDIFACT format, so layout is very specific.

    Read the article

  • Reading a Text file in xcode

    - by Nicolaj Zefting
    First off, I'm a complete beginner. This might be a stupid question, but here it goes: I'm currently working on an App than contains Latin texts that the users can view and read. I'm using Xcode 4 with the storybord function. Theway the app is built: user selects author - then the book - then app shows the text. I am kind of confused because i need to have various text files, depending on the users choice.

    Read the article

  • Writing text file on local server MVC 2.0

    - by Liado
    Hi, i'm trying to write a text file on remote server, i'm using the following code: [AcceptVerbs(HttpVerbs.Post)] public ActionResult Index(UserModels model) { if (!ModelState.IsValid) { return View("Index"); } try { using (StreamWriter w = new StreamWriter(Server.MapPath(TEXT_FILE_NAME), true)) { w.WriteLine(model.Email.ToString()); // Write the text } } catch { } the folder is still empty, can someone help? what should be the problem? Thanks

    Read the article

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • How do I use Group Policy on a domain to delete Temporary Internet Files?

    - by Muhammad Ali
    I have a domain controller running on Windows 2008 Server R2 and users login to application servers on which Windows 2003 Server SP2 is installed. I have applied a Group Policy to clean temporary internet files on exit i.e to delete all temporary internet files when users close the browser. But the group policy doesn't seem to work as user profile size keeps on increasing and the major space is occupied by temporary internet files therefore increasing the disk usage. How can i enforce automatic deletion of temporary internet files?

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • using a "temporary files" folder in python

    - by zubin71
    I recently wrote a script which queries PyPI and downloads a package; however, the package gets downloaded to a user defined folder. I`d like to modify the script in such a way that my downloaded files go into a temporary folder, if the folder is not specified. The temporary-files folder in *nix machines is "/tmp" ; would there be any Python method I could use to find out the temporary-files folder in a particular machine? If not, could someone suggest an alternative to this problem?

    Read the article

  • What is the fastest way to create a checksum for large files in C#

    - by crono
    Hi, I have to sync large files across some machines. The files can be up to 6GB in size. The sync will be done manually every few weeks. I cant take the filename into consideration because they can change anytime. My plan is to create checksums on the destination PC and on the source PC and than copy all files with a checksum, which are not already in the destination, to the destination. My first attempt was something like this: using System.IO; using System.Security.Cryptography; private static string GetChecksum(string file) { using (FileStream stream = File.OpenRead(file)) { SHA256Managed sha = new SHA256Managed(); byte[] checksum = sha.ComputeHash(stream); return BitConverter.ToString(checksum).Replace("-", String.Empty); } } The Problem was the runtime: - with SHA256 with a 1,6 GB File - 20 minutes - with MD5 with a 1,6 GB File - 6.15 minutes Is there a better - faster - way to get the checksum (maybe with a better hash function)?

    Read the article

  • GNU make copy files to distro directory

    - by TheRoadrunner
    I keep my source html (and images etc.) in separate directories for source control. Part of making the distro is to have make copy files to output folder and set the attributes. Today my makefile shows (extract): %.html: /usr/bin/install -c -p -m 644 $< $@ www: $(HTMLDST)/firmware.html $(HTMLDST)/firmware_status.html $(HTMLDST)/index.html $(HTMLDST)/firmware.html: $(HTMLSRC)/firmware.html $(HTMLDST)/firmware_status.html: $(HTMLSRC)/firmware_status.html $(HTMLDST)/index.html: $(HTMLSRC)/index.html This is shown with only three html files, but in reality, there are lots. I would like to just list the filenames (without paths) and have make do the comparison between source and destination and copy the files that have been updated. Thank you in advance Søren

    Read the article

  • Trying to cat files - unrecognized wildcard

    - by Barb
    Hello, I am trying to create a file that contains all of the code of an app. I have created a file called catlist.txt so that the files are added in the order I need them. A snippet of my catlist.txt: app/controllers/application_controller.rb app/views/layouts/* app/models/account.rb app/controllers/accounts_controller.rb app/views/accounts/* When I run the command the files that are explicitly listed get added but the wildcard files do not. cat catlist.txt|xargs cat > fullcode I get cat: app/views/layouts/*: No such file or directory cat: app/views/accounts/*: No such file or directory Can someone help me with this. If there is an easier method I am open to all suggestions. Barb

    Read the article

  • cannot edit any php files using specific functions

    - by user458474
    I cannot update any txt files using php. When I write a simple code like the following: <?php // create file pointer $fp = fopen("C:/Users/jj/bob.txt", 'w') or die('Could not open file, or fike does not exist and failed to create.'); $mytext = '<b>hi. This is my test</b>'; // write text to file fwrite($fp, $mytext) or die('Could not write to file.'); $content = file("C:/Users/jj/bob.txt"); // close file fclose($fp); ?> Both files do exist in the folder. I just cannot see any updates on bob.txt. Is this a permission error in windows? It works fine on my laptop at home. I also cannot change the php files on my website, using filezilla.

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • How to resize a /home partition in Kubuntu?

    - by Devon
    I was distro hopping for awhile in the past few months, so in order to keep all of my files secure, I made a partition of around 50 GB named Files to store all of my files in, and still have them for quick and easy access. However, now that I've found a distribution I'm comfortable with (Kubuntu 11.10), I would like to remove this partition, and have all of my files in my /home folder, in order to more easily deal with these files. I've moved all of my files in the partition to my /home folder (and still have plenty of room to spare), and now I'm trying to delete the partition and use the space for my /home folder. I can delete the partition just fine, however, I can't extend the /home folder into the unallocated space. Here's a screenshot of what I'm talking about. In order to change the size of the /home partition, I need to unmount it. But, I am unable to unmount it! How do I best extend the size of the partition?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • VSS - Solution file between multiple users

    - by BhejaFry
    Hi folks, we have a solution with multiple projects that is being developed by a team of developers. Project paths in the solution file checked in initially contains the path that are specific to that developer. Now when another dev gets latest of the solution, some of the projects won't load as the path differs. What's a better way to manage this ? TIA

    Read the article

< Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >