Search Results

Search found 74706 results on 2989 pages for 'did you know'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 292/2989 | < Previous Page | 288 289 290 291 292 293 294 295 296 297 298 299  | Next Page >

  • C Language preprocessing doubt

    - by khanna_param
    Hi, There are different kind of macros in C language, nested macro is one of them. Considering a program with the following macro define HYPE(x,y) (SQUR(x)+SQUR(y)) define SQUR(x) (x*x) using this we can successfully complile to get the result. My question:- As we all know the C preprocessor replaces all the occurrence of the identifiers with the replacement-string. Considering the above example i would like to know how many times the C compiler traverses the program to replace the macro with the replacement values. I assume it cannot be done in one go. Thanks.

    Read the article

  • Compatible case?

    - by Rick
    Hello everyone, first of all, I'm not sure where this question should go. So I've looked around and found the 'hardware' tag used in superuser.com please forgive me if I'm posting this on the wrong site. I'm new to the hardware part of computers. I've been looking around for a few months and now is the time to make my choice. I want to build my own computer and I think I got all the items I need. I want to know if the case and the motherboard I've chosen are compatible or if you could tell me how to check if they're compatible I want to know if they fit. Here's the motherboard/processor/memory package And this* is the case I'd like to fit it in. I'm sure that all the other stuff I might need I have with me already. Thanks in advance -Rick *See my comment, I may not post two hyperlinks due to spam protection

    Read the article

  • Windows File Checksums - Is my system hacked?

    - by rism
    I would like to know if there is a utility to verify the checksums of every windows file on my Win 7 Ultimate system. It seems on the surface such an obvious utility but I dont ever remember seeing one? I had a very weird experience while surfing earlier today and now Im not entirely sure my system is secure. I have a collection of tools in the WSCC suite but these tools no doubt just make system calls to the win32 api and if that has been subverted then the tools are practically useless. How do I know my Win 7 files are actually Win 7 files? I am particularly interested in verifying the integrity of all network TCP/IP files.

    Read the article

  • RDP - Sharing shortcuts and/or toolbars

    - by Joe
    I often have to work across several virtual machines through RDP. I used to work with Terminals, and recently changed to mRemote NG. As of now, I have a checklist that I run on each new VM I create, in order to populate the desktop with the shortcuts and apps that I use regularly. Then, I create a checkpoint and use that when I need to revert to a "clean" machine. However, it's not always practical, and the VMs I have to use are not always created by me so that checkpoint is not always available. I know that I could use a template when creating the VM, but it doesn't solve the problem when I have to use VMs that I do not own. Does anyone know of a way to setup one set of shortcuts/apps and be able to launch them on a remote desktop connection easily? Kind of like a toolbar that is present wherever I'm logged on...

    Read the article

  • Cannot delete folder - Content seems to be nested recursively

    - by RikuXan
    I cannot delete a folder located on my hard disk by any means. I don't quite know how it was created, all I know is, that it is a pretty deep structure of folders (too deep to delete it at once, since Windows restriction path name too long), but the problem in the end is, that I can't "pull out" the inner folders, because they don't seem to be folders anymore (Context menu lacks things like "Properties", "Cut", "Copy", "Delete" etc.) Here a picture of how a right click looks like on one of these "folders": As you can see, the current folder is in very deep, but that is not the problem, rather the one I left-clicked on. Has anyone any advice on how to get rid of these? I tried a chkdsk, said no errors. I also tried deleting those folder via a VMWare Ubuntu, to no success. I also tried a batch file from a volunteer at MS boards, that should automatically de-nest such folders, but I guess mine is a special case, since the tool only created more such folders.

    Read the article

  • bootmgr is missing on Toshiba laptop with Windows 7

    - by jean
    I have a Toshiba laptop with Windows 7 on it. As soon as I turn my computer on it says bootmgr is missing The only thing I can get into is the setup menu. Does anyone know what might be wrong? My step brother thinks that it might be that everything was erased off my hard drive. The last thing he did when he used it was to perform the Toshiba updates and restart the computer. If anyone knows what might be wrong or how I could get my computer up and running please let me know.

    Read the article

  • Thunderbird: Change the Format of the Date Column

    - by TheOmega
    I want to change the format of the "Date"-Column in the messagelist in Thunderbird. For mails from today, I want to display only the time, not the date. For mails from before today, I want to display only the date, not the time. This is btw the same setup mutt uses. I know of the this wiki article, which describes how to change the dateformat, but you can only switch between 5 predefined formats, and non of them is "Date only". I also know of this Extension, but it got the same limitations, you can't define a new date format. Thanks!

    Read the article

  • how to make a small image become really huge

    - by DennyHalim.com
    all webmaster should already know about hotlinking stuffs. and we know how to ban those bad referer too... but i want to get revenge... i want to replace the hotlinked images with one huge image with few megs in size. i have found one good image. yet it less than 100k. i already use it to replace all bad hotlinkers. how can i convert this image to become few megs?

    Read the article

  • Messages going missing from Apple mailboxes

    - by Ho Li Cow
    A colleague has noticed random messages being deleted from her Apple Mailboxes. e.g. Message sent to client - client replies - original message nowhere to be found. Not in sent items/sent messages/junk/trash. No rules set up. Have tried rebuilding mailboxes but message doesn't show up. Quite worrying really as it was only noticed by chance so don't know how long/how widespread it is. Mail is controlled by Exchange 2003 server. Anyone come across this before or know what's happening? Many thanks MBP 2.53GHz OS X 10.5.8 Mail 3.6

    Read the article

  • copying corrupted images from a dvd.

    - by Pennf0lio
    Hi, Are there software you know that can copy images from a DVD? now the problem is there images in the DVD that are corrupt that I won't force to copy, If the software can recover the file and copy it that would be cool, If it cannot then skip the file. The dvd is kinda large and I don't want to sit and wait there. I want the DVD do the decision, If it can recover then recover if it cannot, then skip. And do you know other solution copying corrupt files? thanks!

    Read the article

  • Moving from windows to linux : Understanding - X Window System, X Server, Xorg, Xfree86.

    - by claws
    Hello, I'm a windows developer(Win32api) moving from Windows to Linux. While installing linux there are lot of things to know about X11, X Window System, X Server, Xorg, Xfree86 and what not. How come we aren't aware of such things in windows? Wiki article on these scares me. Can any one explain these things? How they work? Why is it so complicated in linux & not in windows? Any good references are also appreciated. PS: I love to know internals, don't hesitate to go into depth.

    Read the article

  • Dell Vostro 3500 battery life remaining missing from Windows 8?

    - by Misha
    On Windows 7 a Vostro 3500 laptop shows the battery life remaining, while on Windows 8 this information appears to be missing. The percentage is still available, but the life remaining is missing. How is battery life remaining calculated and does this require some level of driver support? Is it a standardized interface? Does anybody know which driver is responsible for handling this feature? I want to force the old Windows 7 driver, but I don't know which driver does battery remaining.

    Read the article

  • Tool to allow Kerberos Authenticated users to modify Firewall settings

    - by Lars Hanke
    I run a firewall on a central router. Recently, several users want to use Skype. Since firewalling Skype virtually means to switch the firewall off, I consider to allow users to temporarily punch holes for their system. Since the users have no accounts on the router, I consider using Kerberos for authentication and authorization. The router is a Debian Squeeze box, with minimal configuration, i.e. no web-server, database or similar gimmicks. Does anyone know an existing solution, which could be used for that purpose? Or does anybody know easy to use and well documented frameworks in say Perl, Python, C, C++, ... making the set-up of a Kerberos authenticated Client and Server application really simple?

    Read the article

  • how to set global PATH on OS X?

    - by lajos
    I'd like to append to the global PATH variable on OS X so that all user shells and GUI applications get the same PATH environment. I know I can append to the path in shell startup scripts, but those settings are not inherited by GUI applications. The only way I found so far is to redefine the PATH environment variable in /etc/launchd.conf: setenv PATH /usr/bin:/bin:/usr/sbin:/sbin:/my/path I coulnd't figure out a way to actually append to PATH in launchd.conf. I'm a bit worried about this method, but so far this is the only thing that works. Does anyone know of a better way?

    Read the article

  • How to setup apache multi-site with multi-domain on ec2

    - by Esh
    Say I have two document roots domain1/ and domain2/ I know how to access those two roots from my own computer if they are hosted on the same computer. My question is that if I want to do the same thing on my ec2 server, how should I configure my elastic ips to those two roots? I know by default the elastic ip will only associate to the root with the name localhost(127.0.0.1). Anyone could give me a detailed answer? An example would help, thanks!

    Read the article

  • MSWord table shading prints too dark

    - by Relaxed1
    My friend has a very light shading in his MSWord tables. However they still print too dark to read the text. When emailed to a colleague using the same printer, it prints light nicely. However they cannot find any setting that is different between them. Any ideas? Thanks! (P.s. for myself this would help for non-tables also, when 'highlighting' text. I do know that 'shading' gives more colour options for non-tables, but it would be nice to know anyway. Thanks)

    Read the article

  • Debugging COM+ applications

    - by cc0
    I have a number of separate COM+ applications that I have to figure out; The COM+ applications respond to a number of scheduled tasks, and I need to know which COM components within which applications are being used when I execute each of these tasks. It is easy to figure out what (if anything) goes wrong in the event log, but as I am working on testing each components compatibility with the others; I need to know which ones I have actually tested by executing the scheduled tasks. Does anyone have some useful tips here? I've been looking into the sysinternals tools, and specifically processmonitor, but I have not found a way to make it monitor the COM+ applications yet. (I initially started this question here, but realized it's probably more suited for serverfault)

    Read the article

  • Verify linux user passwords

    - by zero_r
    Hi there I got a linux server that has several dozen users. I also have the cleartext password for every user (i know - bad security). I would like to know if the passwords are correct. Since the users are all ftp users and have the nologin shell, I cannot just write a script to check if login works. How can I do a local check on passwords? Script output could look like this: $ check_userpw < user_pw_list.txt user1 ok user2 ok user3 mismatch! user4 ok Thanks

    Read the article

  • AD Local Admins without password sharing

    - by Cocoabean
    My team is building out an Active Directory environment in a small grad school with support for general computer labs, and staff/faculty machine and account management. We have a team of student consultants that are hired to do general help desk work. As of now we have a local admin account on every machine. It has the same password and all of us know it. I know it's not best practice and I want to avoid this with the new setup. We want to have local admin accounts in case there are network issues that prevent AD authentication, but we do not want this account to be generic with a shared password. Is there a way we can get each machine to cache the necessary information to authenticate a group of local admins so that if AD is somehow inaccessible, student consultants can still login with their AD admin accounts?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 288 289 290 291 292 293 294 295 296 297 298 299  | Next Page >