Search Results

Search found 72103 results on 2885 pages for 'file storage'.

Page 30/2885 | < Previous Page | 26 27 28 29 30 31 32 33 34 35 36 37  | Next Page >

  • SQL Server Storage Internals 101

    This article is an extract from the book Tribal SQL. In this article, Mark S. Rasmussen offers a concise introduction to the physical storage internals behind SQL Server databases. He doesn't dive into every detail, but provides a simple, clear picture of how SQL Server stores data. Deployment Manager 2 is now free!The new version includes tons of new features and we've launched a completely free Starter Edition! Get Deployment Manager here

    Read the article

  • Long Term Data Storage - Choosing A Media Type

    Choosing a long term data storage medium isn';t as easy as you may think. You might imagine that the data could be burnt to CD, locked in a cupboard and that it would last forever however unfortunatel... [Author: Chris Holgate - Computers and Internet - April 02, 2010]

    Read the article

  • REMINDER : SPARC T4 Servers and ZFS Storage Appliance Demo Equipment Purchase Opportunity

    - by Cinzia Mascanzoni
    Please mark your calendars for the SPARC T4 Servers and ZFS Storage Appliance Demo Program webcast on November 22nd at 12 noon GMT/ 1pm CET and learn how you can take the maximum advantage from this unique opportunity. The objective of this call is to share value, details, guidelines and rules of this demo program with you. Go on the EMEA VAD Resource Center to find more info and the details to access the webcast.

    Read the article

  • Storage Technology for the Home User

    <b>Linux Magazine:</b> "Sometimes you just have to get excited about what you can buy, hold in your hand, and use in your home machines. Let's look at some cool storage technology that the average desktop user can tackle."

    Read the article

  • ??????Oracle Automatic Storage Management???·????????

    - by Yusuke.Yamamoto
    ????? ??:2010/03/01 ??:???? Oracle Database ?????? Automatic Storage Management(ASM) ? Oracle Database 10g ?????????Oracle ASM ? Oracle Database ?????????????·????????????·????????????????????????????????????????Oracle ASM ????????????????·?????????????????????????? ??????·???????????????·??????????????????????ASRU ???????ASRU ???????????? ????????? ????????????????? http://www.oracle.com/technetwork/jp/database/1005200-oracle-asm-and-tr-321865-ja.pdf

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • setup lowcost image storage server with 24x SSD array to get high IOPS?

    - by Nenad
    I want to build let's name it a lowcost Ra*san which would host for our social site the images (many millions) we have 5 sizes of every photo with 3 KB, 7 KB, 15 KB, 25 KB and 80 KB per Image. My idea is to build a Server with 24x consumer 240 GB SSD's in Raid 6 which will give me some 5 TB Disk space for the photo storage. To have HA I can add a 2nd one and use drdb. I'm looking to get above 150'000 IOPS (4K Random reads). As we mostly have read access only and rarely delete photos i think to go with consumer MLC SSD. I read many endurance reviews and don't see there a problem as long we don't rewrite the cells. What you think about my idea? - I'm not sure between Raid 6 or Raid 10 (more IOPS, cost SSD). - Is ext4 OK for the filesystem - Would you use 1 or 2 Raid controller, with Extender Backplane If anyone has realized something similar i would be happy to get Real World numbers. UPDATE I have buy 12 (plus some spare) OCZ Talos 480GB SAS SSD Drive's they will be placed in a 12-bay DAS and attached to a PERC H800 (1GB NV Cache, manufactured by LSI with fastpath) Controller, I plan to setup Raid 50 with ext4. If someone is wondering about some benchmarks let me know what you would like to see.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • How can I remove all drivers and other files related to a USB Mass Storage device?

    - by Bob
    I have a flash drive here that does not work on one OS on computer - let's call it the desktop Windows 7. It works fine on another computer - laptop Windows 7. It also works fine on Windows 8 on the same desktop computer. Other flash drives work fine under desktop Windows 7. So not a hardware issue, not a generic USB Mass Storage driver issue. It's something specific to this drive. On desktop Windows 7, I can connect the drive but no volume comes up under Windows Explorer. Ditto for Disk Management. With diskpart, loading hangs until I unplug the drive, if I replug it and try list disk it hangs again. If I unplug the drive at this point, list disk prints out all attached drives - including the just removed flash drive. The drive consistently appears under Device Manager, but uninstalling the drivers, restarting and reinstalling the drivers (by inserting the drive) only works for the first insertion. After that it fails again. I get the feeling that the driver files are not actually removed, and are corrupted, meaning every reinstall it's the same corrupted drivers being installed. Is there any way to remove these drivers completely? Or perhaps some other setting Windows 7 retains? Formatting the drive through another computer/OS does not help. I've also tried a complete wipe and rebuild of the MBR and single partition. The allocation unit size makes no difference; neither does a NTFS format. This is a relatively small matter, and I would not like to reinstall the entire OS!

    Read the article

< Previous Page | 26 27 28 29 30 31 32 33 34 35 36 37  | Next Page >