Search Results

Search found 54055 results on 2163 pages for 'multiple files'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 306/2163 | < Previous Page | 302 303 304 305 306 307 308 309 310 311 312 313  | Next Page >

  • Minimum set of Delphi 2010 files to move to a SVN repository for compiling

    - by bcrooker
    We are using Subversion for SCC. We have a great deal of our build environment in our repository so that we can check a given version out and rebuild it fairly close to what was in use at that time. We have the following in there now: InnoSetup binaries Third Party Components VCL (including Indy) Our Source (of course) Finalbuilder project files The only thing missing is the binaries for Delphi itself - I am wondering if there is a minimum set of files that can be copied to the repository and run. Thanks

    Read the article

  • Online editing gettext files?

    - by NeoNmaN
    Online editing gettext files, is it possible? I use gettext for all my PHP projects, but sides with a minor problem, want to mine user may translate my language from as Danish to Norwegian, but in this case it enste I know is that I need to export my file from Poedit there is any. other software that can export / import my files? for Poedit can I do with export as. hope i could help me a little.

    Read the article

  • version control on large files

    - by Dustin Getz
    We happily use SVN for SCM at work. Currently I've got our binary assets in the same SVN repository as our code. SVN supports very large files (it transmits them 'streamily' to keep memory usage sane), but it is SLOOWWWWW. What asset management software do you recommend, for about a GB (and growing) worth of assets? We would prefer branching and merging (different assets & config files go to different customers).

    Read the article

  • Ten latest files on disk

    - by Artic
    I need effective algorithm to keep only ten latest files on disk in particular folder to support some kind of publishing process. Only 10 files should present in this folder at any point of time. Please, give your advises what should be used here.

    Read the article

  • Generate SQL script to insert XML from files, using Powershell

    - by Jeff Meatball Yang
    I have a bunch of (50+) XML files in a directory that I would like to insert into a SQL server 2008 table. How can I create a SQL script from the command prompt or Powershell that will let me insert the files into a simple table with the following schema: XMLDataFiles ( xmlFileName varchar(255) , content xml ) All I need is for something to generate a script with a bunch of insert statements. Right now, I'm contemplating writing a silly little .NET console app to write the SQL script. Thanks.

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Reading Binary Plist files with Python

    - by Zeki Turedi
    I am currently using the Plistlib module to read Plist files but I am currently having an issue with it when it comes to Binary Plist files. I am wanting to read the data into a string to later to be analysed/printed etc. I am wondering if their is anyway of reading in a Binary Plist file without using the plutil function and converting the binary file into XML? Thank you for your help and time in advance.

    Read the article

  • where should i put the configuration files in a webservice

    - by KItis
    Could some one help me on this problem. i have webservice , which reads data from configuration files. When i run this webservice from eclipse , i give absolute the path for these webservices of these configuration files , but when i shift the webservice in to server and run, it can not read the config file. so how can i solve this problem. is there a relative path that webservice can understand during run time.

    Read the article

  • multiple definition of inline function

    - by K71993
    Hi, I have gone through some posts related to this topic but was not able to sort out my doubt completly. This might be a very navie question. Code Description I have a header file "inline.h" and two translation unit "main.cpp" and "tran.cpp". Details of code are as below inline.h file details #ifndef __HEADER__ #include <stdio.h> extern inline int func1(void) { return 5; } static inline int func2(void) { return 6; } inline int func3(void) { return 7; } #endif main.c file details are below #define <stdio.h> #include <inline.h> int main(int argc, char *argv[]) { printf("%d\n",func1()); printf("%d\n",func2()); printf("%d\n",func3()); return 0; } tran.cpp file details (Not that the functions are not inline here) #include <stdio.h> int func1(void) { return 500; } int func2(void) { return 600; } int func3(void) { return 700; } Question The above code does not compile in gcc compiler whereas compiles in g++ (Assuming you make changes related to gcc in code like changing the code to .c not using any C++ header files... etc). The error displayed is "duplicate definition of inline function - func3". Can you clarify why this difference is present across compile? When you run the program (g++ compiled) by creating two seperate compilation unit (main.o and tran.o and create an executable a.out), the output obtained is 500 6 700 Why does the compiler pick up the definition of the function which is not inline. Actually since #include is used to "add" the inline definiton I had expected 5,6,7 as the output. My understanding was during compilation since the inline definition is found, the function call would be "replaced" by inline function definition. Can you please tell me in detailed steps the process of compilation and linking which would lead us to 500,6,700 output. I can only understand the output 6. Thanks in advance for valuable input.

    Read the article

  • Emacs under Windows and PNG files

    - by Leo Alekseyev
    Would anyone have any pointers on getting PNG images to display in Emacs 23 under Win32?.. I have installed the gnuwin32 set of utilities, including libpng and zlib; C:\Program Files\GnuWin32\bin is in path. JPG files started working but not PNGs. I'd appreciate any hints on getting this to work.

    Read the article

  • I can't load the css files

    - by mfalcon
    I want to load some .css files to my Django project but I don't know why they aren't loaded. The css files are located at "/myproject/media/css". settings.py: import os.path PROJECT_DIR = os.path.dirname(__file__) MEDIA_ROOT = os.path.join(PROJECT_DIR, 'media') urls.py: from django.conf import settings ... (r'^media/(?P<path>.*)$', 'django.views.static.serve', {'document_root': settings.MEDIA_ROOT, 'show_indexes': True}), ) base.html: <link rel="stylesheet" type="text/css" media="all" href="{{ MEDIA_ROOT }}css/myStyle.css" />

    Read the article

  • append files to an archive without reading/rewriting the whole archive

    - by bene
    I've got many files that I want to store in a single archive file. My first approach was to store the files in a gzipped tarball. The problem is, that I've to rewrite the whole archive if a single file is added. I could get rid of the gzip compression, but adding a file would still be expensive. What other archive format would you suggest that allows fast append operations?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Error 'duplicate definition' when compiling 2 c files that reference 1 header file

    - by super newbie
    I have two C files and one header that are as follows: Header file header.h: char c = 0; file1.c: #include "header.h" file2.c: #include "header.h" I was warned about 'duplicate definition' when compiling. I understand the cause as the variable c is defined twice in both file1.c and file2.c; however, I do need to reference the header.h in both c files. How should I overcome this issue?

    Read the article

  • Restoring MySQL database from physical files

    - by Abdullah Jibaly
    Is it possible to restore a MySQL database from the physical database files. I have a directory that has the following file types: client.frm client.MYD client.MYI but for about 20 more tables. I usually use mysqldump or a similar tool to get everything in 1 SQL file so what is the way to deal with these types of files?

    Read the article

  • Where are Kohana config files?

    - by elmonty
    I've just installed Kohana 3.0.4.2 and I have run the index.php file successfully. According to the documentation, the next step is to edit the config files in the application/config folder. I have that folder but there are no files in it! I downloaded the package again to make sure it wasn't corrupted, but the same problem exists. Why is the application/config folder empty?

    Read the article

  • Is it possible to reliably auto-decode user files to Unicode? [C#]

    - by NVRAM
    I have a web application that allows users to upload their content for processing. The processing engine expects UTF8 (and I'm composing XML from multiple users' files), so I need to ensure that I can properly decode the uploaded files. Since I'd be surprised if any of my users knew their files even were encoded, I have very little hope they'd be able to correctly specify the encoding (decoder) to use. And so, my application is left with task of detecting before decoding. This seems like such a universal problem, I'm surprised not to find either a framework capability or general recipe for the solution. Can it be I'm not searching with meaningful search terms? I've implemented BOM-aware detection (http://en.wikipedia.org/wiki/Byte_order_mark) but I'm not sure how often files will be uploaded w/o a BOM to indicate encoding, and this isn't useful for most non-UTF files. My questions boil down to: Is BOM-aware detection sufficient for the vast majority of files? In the case where BOM-detection fails, is it possible to try different decoders and determine if they are "valid"? (My attempts indicate the answer is "no.") Under what circumstances will a "valid" file fail with the C# encoder/decoder framework? Is there a repository anywhere that has a multitude of files with various encodings to use for testing? While I'm specifically asking about C#/.NET, I'd like to know the answer for Java, Python and other languages for the next time I have to do this. So far I've found: A "valid" UTF-16 file with Ctrl-S characters has caused encoding to UTF-8 to throw an exception (Illegal character?) (That was an XML encoding exception.) Decoding a valid UTF-16 file with UTF-8 succeeds but gives text with null characters. Huh? Currently, I only expect UTF-8, UTF-16 and probably ISO-8859-1 files, but I want the solution to be extensible if possible. My existing set of input files isn't nearly broad enough to uncover all the problems that will occur with live files. Although the files I'm trying to decode are "text" I think they are often created w/methods that leave garbage characters in the files. Hence "valid" files may not be "pure". Oh joy. Thanks.

    Read the article

  • Recursively add files by pattern

    - by Michel Krämer
    How do I recursively add files by a pattern (or glob) located in different directories? For example, I'd like to add A/B/C/foo.java and D/E/F/bar.java (and several other java files) with one command: git add '*.java' Unfortunately, that doesn't work as expected.

    Read the article

  • I write bad wave files using Java

    - by Cliff
    I'm writing out wave files in Java using AudioInputStream output = new AudioInputStream(new ByteArrayInputStream(rawPCMSamples), new AudioFormat(22000,16,1,true,false), rawPCMSamples.length) AudioSystem.write(output, AudioFileFormat.Type.WAVE, new FileOutputStream('somefile.wav')) And I get what appears to be corrupt wave files on OSX. They won't play from Finder however using the same code behind a servlet writing directly to the response stream and setting the Content-Type to audio/wave seems to play fine in quicktime. What gives?

    Read the article

  • Exclude files only in "release" in VS2008 config

    - by Tom
    Hi Guys, I was wondering how to "Exclude" individual files in the "release" web.csproj config of my solution. I've seen other answers and they all feature "include" - but this is not what I am wanting to achieve. I only want to exclude around 10-15 files from a "release" package ? I don't want to manually edit the web.csproj file - so is there any way I can do this via web.config or ? How would I go about doing this ?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 302 303 304 305 306 307 308 309 310 311 312 313  | Next Page >