Search Results

Search found 4315 results on 173 pages for 'learner 17'.

Page 31/173 | < Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • wireless printer - entering WPA - is there a quicker way?

    - by camcam
    I have a wireless printer (Brother DCP-585CW). The wireless setup instruction says I should enter the WPA key to the printer. The key is entered using up and down buttons on the printer. So, I am supposed to enter 64 characters using up and down buttons. To enter 1 character, it takes on average (24+10)/2 = 17 times pressing the button (digits start after 24 letters). So 17*64 = 1088 times. Is there a quicker way to setup a wireless printer? Maybe there is a Windows program that discovers printers connected to computer through USB or Ethernet (my printer has both sockets) and allows to pre-configure it for wireless usage (enter the long WPA key)? Update There is BRAdmin program and it allows to set up almost all wireless settings... almost - all except WPA :(

    Read the article

  • Is there any script to do accounting for the proftpd's xferlog?

    - by Aseques
    I would like to convert from the xferlog format that proftpd uses into per user in/out bytes, to have a summary on how much traffic does each user use per month. The exact format is this: Thu Oct 17 12:47:05 2013 1 123.123.123.123 74852 /home/vftp/doc1.txt b _ i r user ftp 0 * c Thu Oct 17 12:47:06 2013 2 123.123.123.123 86321 /home/vftp/doc2.txt b _ i r user ftp 0 * c So far I only found a script that makes a nice report but not exactly what I needed, that one can be found here I might create a fork of this one and place it somewhere but it probably has been done a lot of times already. Just found a well hidden page in proftpd site with some more examples here

    Read the article

  • Best monitor for reading

    - by wajed
    Will response rate make a difference? What is good brightness? What is a good contrast ratio? Definitely there are other things to look for, so please give me your opinion. Also, what screen size is good for reading? What size would you choose from 17-22? I'm thinking of getting one 17-19 for reading, and one 22 for movies. Or maybe 2 22" one vertical and one horizontal is better? I think I should look for lower native res., right?

    Read the article

  • WiX 3 Tutorial: Custom EULA License and MSI localization

    - by Mladen Prajdic
    In this part of the ongoing Wix tutorial series we’ll take a look at how to localize your MSI into different languages. We’re still the mighty SuperForm: Program that takes care of all your label color needs. :) Localizing the MSI With WiX 3.0 localizing an MSI is pretty much a simple and straightforward process. First let look at the WiX project Properties->Build. There you can see "Cultures to build" textbox. Put specific cultures to build into the testbox or leave it empty to build all of them. Cultures have to be in correct culture format like en-US, en-GB or de-DE. Next we have to tell WiX which cultures we actually have in our project. Take a look at the first post in the series about Solution/Project structure and look at the Lang directory in the project structure picture. There we have de-de and en-us subfolders each with its own localized stuff. In the subfolders pay attention to the WXL files Loc_de-de.wxl and Loc_en-us.wxl. Each one has a <String Id="LANG"> under the WixLocalization root node. By including the string with id LANG we tell WiX we want that culture built. For English we have <String Id="LANG">1033</String>, for German <String Id="LANG">1031</String> in Loc_de-de.wxl and for French we’d have to create another file Loc_fr-FR.wxl and put <String Id="LANG">1036</String>. WXL files are localization files. Any string we want to localize we have to put in there. To reference it we use loc keyword like this: !(loc.IdOfTheVariable) => !(loc.MustCloseSuperForm) This is our Loc_en-us.wxl. Note that German wxl has an identical structure but values are in German. <?xml version="1.0" encoding="utf-8"?><WixLocalization Culture="en-us" xmlns="http://schemas.microsoft.com/wix/2006/localization" Codepage="1252"> <String Id="LANG">1033</String> <String Id="ProductName">SuperForm</String> <String Id="LicenseRtf" Overridable="yes">\Lang\en-us\EULA_en-us.rtf</String> <String Id="ManufacturerName">My Company Name</String> <String Id="AppNotSupported">This application is is not supported on your current OS. Minimal OS supported is Windows XP SP2</String> <String Id="DotNetFrameworkNeeded">.NET Framework 3.5 is required. Please install the .NET Framework then run this installer again.</String> <String Id="MustCloseSuperForm">Must close SuperForm!</String> <String Id="SuperFormNewerVersionInstalled">A newer version of !(loc.ProductName) is already installed.</String> <String Id="ProductKeyCheckDialog_Title">!(loc.ProductName) setup</String> <String Id="ProductKeyCheckDialogControls_Title">!(loc.ProductName) Product check</String> <String Id="ProductKeyCheckDialogControls_Description">Plese Enter following information to perform the licence check.</String> <String Id="ProductKeyCheckDialogControls_FullName">Full Name:</String> <String Id="ProductKeyCheckDialogControls_Organization">Organization:</String> <String Id="ProductKeyCheckDialogControls_ProductKey">Product Key:</String> <String Id="ProductKeyCheckDialogControls_InvalidProductKey">The product key you entered is invalid. Please call user support.</String> </WixLocalization>   As you can see from the file we can use localization variables in other variables like we do for SuperFormNewerVersionInstalled string. ProductKeyCheckDialog* strings are to localize a custom dialog for Product key check which we’ll look at in the next post. Built in dialog text localization Under the de-de folder there’s also the WixUI_de-de.wxl file. This files contains German translations of all texts that are in WiX built in dialogs. It can be downloaded from WiX 3.0.5419.0 Source Forge site. Download the wix3-sources.zip and go to \src\ext\UIExtension\wixlib. There you’ll find already translated all WiX texts in 12 Languages. Localizing the custom EULA license Here it gets ugly. We can override the default EULA license easily by overriding WixUILicenseRtf WiX variable like this: <WixVariable Id="WixUILicenseRtf" Value="License.rtf" /> where License.rtf is the name of your custom EULA license file. The downside of this method is that you can only have one license file which means no localization for it. That’s why we need to make a workaround. License is checked on a dialog name LicenseAgreementDialog. What we have to do is overwrite that dialog and insert the functionality for localization. This is a code for LicenseAgreementDialogOverwritten.wxs, an overwritten LicenseAgreementDialog that supports localization. LicenseAcceptedOverwritten replaces the LicenseAccepted built in variable. <?xml version="1.0" encoding="UTF-8" ?><Wix xmlns="http://schemas.microsoft.com/wix/2006/wi"> <Fragment> <UI> <Dialog Id="LicenseAgreementDialogOverwritten" Width="370" Height="270" Title="!(loc.LicenseAgreementDlg_Title)"> <Control Id="LicenseAcceptedOverwrittenCheckBox" Type="CheckBox" X="20" Y="207" Width="330" Height="18" CheckBoxValue="1" Property="LicenseAcceptedOverwritten" Text="!(loc.LicenseAgreementDlgLicenseAcceptedCheckBox)" /> <Control Id="Back" Type="PushButton" X="180" Y="243" Width="56" Height="17" Text="!(loc.WixUIBack)" /> <Control Id="Next" Type="PushButton" X="236" Y="243" Width="56" Height="17" Default="yes" Text="!(loc.WixUINext)"> <Publish Event="SpawnWaitDialog" Value="WaitForCostingDlg">CostingComplete = 1</Publish> <Condition Action="disable"> <![CDATA[ LicenseAcceptedOverwritten <> "1" ]]> </Condition> <Condition Action="enable">LicenseAcceptedOverwritten = "1"</Condition> </Control> <Control Id="Cancel" Type="PushButton" X="304" Y="243" Width="56" Height="17" Cancel="yes" Text="!(loc.WixUICancel)"> <Publish Event="SpawnDialog" Value="CancelDlg">1</Publish> </Control> <Control Id="BannerBitmap" Type="Bitmap" X="0" Y="0" Width="370" Height="44" TabSkip="no" Text="!(loc.LicenseAgreementDlgBannerBitmap)" /> <Control Id="LicenseText" Type="ScrollableText" X="20" Y="60" Width="330" Height="140" Sunken="yes" TabSkip="no"> <!-- This is original line --> <!--<Text SourceFile="!(wix.WixUILicenseRtf=$(var.LicenseRtf))" />--> <!-- To enable EULA localization we change it to this --> <Text SourceFile="$(var.ProjectDir)\!(loc.LicenseRtf)" /> <!-- In each of localization files (wxl) put line like this: <String Id="LicenseRtf" Overridable="yes">\Lang\en-us\EULA_en-us.rtf</String>--> </Control> <Control Id="Print" Type="PushButton" X="112" Y="243" Width="56" Height="17" Text="!(loc.WixUIPrint)"> <Publish Event="DoAction" Value="WixUIPrintEula">1</Publish> </Control> <Control Id="BannerLine" Type="Line" X="0" Y="44" Width="370" Height="0" /> <Control Id="BottomLine" Type="Line" X="0" Y="234" Width="370" Height="0" /> <Control Id="Description" Type="Text" X="25" Y="23" Width="340" Height="15" Transparent="yes" NoPrefix="yes" Text="!(loc.LicenseAgreementDlgDescription)" /> <Control Id="Title" Type="Text" X="15" Y="6" Width="200" Height="15" Transparent="yes" NoPrefix="yes" Text="!(loc.LicenseAgreementDlgTitle)" /> </Dialog> </UI> </Fragment></Wix>   Look at the Control with Id "LicenseText” and read the comments. We’ve changed the original license text source to "$(var.ProjectDir)\!(loc.LicenseRtf)". var.ProjectDir is the directory of the project file. The !(loc.LicenseRtf) is where the magic happens. Scroll up and take a look at the wxl localization file example. We have the LicenseRtf declared there and it’s been made overridable so developers can change it if they want. The value of the LicenseRtf is the path to our localized EULA relative to the WiX project directory. With little hacking we’ve achieved a fully localizable installer package.   The final step is to insert the extended LicenseAgreementDialogOverwritten license dialog into the installer GUI chain. This is how it’s done under the <UI> node of course.   <UI> <!-- code to be discussed in later posts –> <!-- BEGIN UI LOGIC FOR CLEAN INSTALLER --> <Publish Dialog="WelcomeDlg" Control="Next" Event="NewDialog" Value="LicenseAgreementDialogOverwritten">1</Publish> <Publish Dialog="LicenseAgreementDialogOverwritten" Control="Back" Event="NewDialog" Value="WelcomeDlg">1</Publish> <Publish Dialog="LicenseAgreementDialogOverwritten" Control="Next" Event="NewDialog" Value="ProductKeyCheckDialog">LicenseAcceptedOverwritten = "1" AND NOT OLDER_VERSION_FOUND</Publish> <Publish Dialog="InstallDirDlg" Control="Back" Event="NewDialog" Value="ProductKeyCheckDialog">1</Publish> <!-- END UI LOGIC FOR CLEAN INSTALLER –> <!-- code to be discussed in later posts --></UI> For a thing that should be simple for the end developer to do, localization can be a bit advanced for the novice WiXer. Hope this post makes the journey easier and that next versions of WiX improve this process. WiX 3 tutorial by Mladen Prajdic navigation WiX 3 Tutorial: Solution/Project structure and Dev resources WiX 3 Tutorial: Understanding main wxs and wxi file WiX 3 Tutorial: Generating file/directory fragments with Heat.exe  WiX 3 Tutorial: Custom EULA License and MSI localization WiX 3 Tutorial: Product Key Check custom action WiX 3 Tutorial: Building an updater WiX 3 Tutorial: Icons and installer pictures WiX 3 Tutorial: Creating a Bootstrapper

    Read the article

  • Java Spotlight Episode 99: Daniel Blaukopf on JavaFX for Embedded Systems

    - by Roger Brinkley
    Interview with  Daniel Blaukopf on JavaFX for Embedded Systems Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast in iTunes. Show Notes News Top 5 Reasons to go to JavaOne 5. Chance to see the future of Java Technical Keynotes and sessions The pavillion The new Embedded@JavaOne conference 4. The meetings outside the scope of the conference Top 10 Reasons to Attend the Oracle Appreciation Event GlassFish Community Event at JavaOne 2012 Sundays User Group Forum 3. It’s like drinking from firehose Less keynotes more sessions - 20% more 60% of the talks are external to HOLs Tutorials OracleJava University classes on Sunday - Top Five Reasons You Should Attend Java University at JavaOne 2. Students are free 1. It’s not what you see it’s who you will meet Events Sep 10-15, IMTS 2012 Conference,  Chicago Sep 12,  The Coming M2M Revolution: Critical Issues for End-to-End Software and Systems Development,  Webinar Sep 30-Oct 4, JavaONE, San Francisco Oct 3-4, Java Embedded @ JavaONE, San Francisco Oct 15-17, JAX London Oct 30-Nov 1, Arm TechCon, Santa Clara Oct 22-23, Freescale Technology Forum - Japan, Tokyo Oct 31, JFall, Netherlands Nov 2-3, JMagreb, Morocco Nov 13-17, Devoxx, Belgium Feature InterviewDaniel Blaukopf is the Embedded Java Client Architect at Oracle, working on JavaFX. Daniel's focus in his 14 years in the Java organization has been mobile and embedded devices, including working with device manufacturers to port and tune all levels of the Java stack to their hardware and software environments. Daniel's particular interests are: graphics, performance optimization and functional programming.

    Read the article

  • Java Spotlight Episode 97: Shaun Smith on JPA and EclipseLink

    - by Roger Brinkley
    Interview with Java Champion Shaun Smith on JPA and EclipseLink. Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast in iTunes. Show Notes News Project Jigsaw: Late for the train: The Q&A JDK 8 Milestone schedule The Coming M2M Revolution: Critical Issues for End-to-End Software and Systems Development JSR 355 passed the JCP EC Final Approval Ballot on 13 August 2012 Vote for GlassFish t-shirt design GlassFish on Openshift JFokus 2012 Call for Papers is open Who do you want to hear in the 100 JavaSpotlight feature interview Events Sep 3-6, Herbstcampus, Nuremberg, Germany Sep 10-15, IMTS 2012 Conference,  Chicago Sep 12,  The Coming M2M Revolution: Critical Issues for End-to-End Software and Systems Development,  Webinar Sep 30-Oct 4, JavaONE, San Francisco Oct 3-4, Java Embedded @ JavaONE, San Francisco Oct 15-17, JAX London Oct 30-Nov 1, Arm TechCon, Santa Clara Oct 22-23, Freescale Technology Forum - Japan, Tokyo Nov 2-3, JMagreb, Morocco Nov 13-17, Devoxx, Belgium Feature InterviewShaun Smith is a Principal Product Manager for Oracle TopLink and an active member of the Eclipse community. He's Ecosystem Development Lead for the Eclipse Persistence Services Project (EclipseLink) and a committer on the Eclipse EMF Teneo and Dali Java Persistence Tools projects. He’s currently involved with the development of JPA persistence for OSGi and Oracle TopLink Grid, which integrates Oracle Coherence with Oracle TopLink to provide JPA on the grid. Mail Bag What’s Cool James Gosling and GlassFish (youtube video) Every time I see a piece of C code I need to port, my heart dies a little. Then I port it to 1/4 as much Java, and feel better. Tweet by Charles Nutter #JavaFX 2.2 is really looking like a great alternative to Flex. SceneBuilder + NetBeans 7.2 = Flash Builder replacement. Tweet by Danny Kopping

    Read the article

  • very long boot up with Ubuntu 10.04.4

    - by wt70707
    I installed Ubuntu 10.04.3 on Atom. Then I do the update and upgrade with: #apt-get update #apt-get upgrade #apt-get dist-upgrade The system can boot up now but in almost 2 minutes. After power on and system test, it will stop at "Verifying DMI pool data" for 10 seconds before the GRUB menu comes up. Then after the choosing of one item, to the start up of OS there is 100 seconds of black screen. The start up after that is normal and the operations in the system is also normal. I am concerned with if it is of hardware problem, or just some problem with the kernel. Also I want to know after "Verifying DMI pool data" what is done? And after we choose an item in GRUB menu, what does the system do? And where can I see the procedure of the whole boot up? The /var/log/boot.log is too simple, and this is it: fsck from util-linux-ng 2.17.2 fsck from util-linux-ng 2.17.2 /dev/mmcblk0p5: clean, ...... /dev/mmcblk0p1: clean, ...... * Starting AppArmor profiles Skipping profile in /etc/apparmor.d/disable: usr.bin.firefox OK] * Setting sensors limits OK]

    Read the article

  • Java Spotlight Episode 77: Donald Smith on the OpenJDK and Java

    - by Roger Brinkley
    Tweet An interview with Donald Smith about Java and OpenJDK. Joining us this week on the Java All Star Developer Panel are Dalibor Topic, Java Free and Open Source Software Ambassador and Arun Gupta, Java EE Guy. Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast in iTunes. Show Notes News Jersey 2.0 Milestone 2 available Oracle distribution of Eclipse (OEPE) now supports GlassFish 3.1.2 Oracle Linux 6 is now part of the certification matrix for 3.1.2 3rd part of Spring -> Java EE 6 article series published Joe Darcy - Repeating annotations in the works JEP 152: Crypto Operations with Network HSMs JEP 153: Launch JavaFX Applications OpenJDK bug database: Status update OpenJDK Governing Board 2012 Election: Results jtreg update March 2012 Take Two: Comparing JVMs on ARM/Linux The OpenJDK group at Oracle is growing App bundler project now open Events April 4-5, JavaOne Japan, Tokyo, Japan April 11, Cleveland JUG, Cleveland, OH April 12, GreenJUG, Greenville, SC April 17-18, JavaOne Russia, Moscow Russia April 18–20, Devoxx France, Paris, France April 17-20, GIDS, Bangalore April 21, Java Summit, Chennai April 26, Mix-IT, Lyon, France, May 3-4, JavaOne India, Hyderabad, India May 5, Bangalore, Pune, ?? - JUG outreach May 7, OTN Developer Day, Mumbai May 8, OTN Developer Day, Delhi Feature InterviewDonald Smith, MBA, MSc, is Director of Product Management for Oracle. He brings worldwide enterprise software experience, ranging from small "dot-com" through Fortune 500 companies. Donald speaks regularly about Java, open source, community development, business models, business integration and software development politics at conferences and events worldwide including Java One, Oracle World, Sun Tech Days, Evans Developer Relations Conference, OOPSLA, JAOO, Server Side Symposium, Colorado Software Summit and others. Prior to returning to Oracle, Donald was Director of Ecosystem Development for the Eclipse Foundation, an independent not-for-profit foundation supporting the Eclipse open source community. Mail Bag What’s Cool OpenJDK 7 port to Haiku JEP 154: Remove Serialization Goto for the Java Programming Language

    Read the article

  • Install and upgrade strategies for Oracle Enterprise Manager 12c - Upcoming Webcasts with live demos

    - by Anand Akela
    At Oracle Open World 2011, we launched the Oracle Enterprise Manager 12c , the only complete cloud management solution for your enterprise cloud. With the new release of Oracle Enterprise Manager Cloud Control 12c, the installation and upgrade process has been enhanced to provide a fast and smooth install experience. In the upcoming webcasts, Oracle Enterprise Manager experts will discuss the installation and upgrade strategies for Oracle Enterprise Manager Cloud Control 12c . These webcasts will include live demonstrations of the install and upgrade processes. In the Webcast on November 17th, we will cover the installation steps and provide recommendations to setup a new Oracle Enterprise Manager Cloud Control 12c environment. We'll also provide a live demonstration of the complete installation process.   Upgrading your Oracle Enterprise Manager environment can be a challenging and complex task especially with large environments consisting of hundreds or thousands of targets. In the webcast on November 18th, we'll describe key facts that administrators must know before upgrading their Enterprise Manager system as well as introduce the different approaches for an upgrade. We'll also walk you through the key steps for upgrading an existing Enterprise Manager 11g (or 10g) Grid Control to Oracle Enterprise Manager Cloud Control 12c. In addition to the live webcasts on Oracle Enterprise Manager Cloud Control 12c install and upgrade processes, please consider attending the replay of  Oracle Enterprise Manager Ops Center webcast with live Q&A . Schedule and registration links of upcoming webcasts  :- Topics Schedule Oracle Enterprise Manager Ops Center: Global Systems Management Made Easy (Replay) November 17 10 a.m PT December 1 10 a.m PT Oracle Enterprise Manager Cloud Control 12c Installation Overview November 17 8 a.m PT Upgrade Smoothly to Oracle Enterprise Manager Cloud Control 12c November 18 8 a.m PT For more information, please go to Oracle Enterprise Manager  web page or  follow us at :  Twitter   Facebook YouTube Linkedin

    Read the article

  • DocumentDB - Another Azure NoSQL Storage Service

    - by Shaun
    Originally posted on: http://geekswithblogs.net/shaunxu/archive/2014/08/25/documentdb---another-azure-nosql-storage-service.aspxMicrosoft just released a bunch of new features for Azure on 22nd and one of them I was interested in most is DocumentDB, a document NoSQL database service on the cloud.   Quick Look at DocumentDB We can try DocumentDB from the new azure preview portal. Just click the NEW button and select the item named DocumentDB to create a new account. Specify the name of the DocumentDB, which will be the endpoint we are going to use to connect later. Select the capacity unit, resource group and subscription. In resource group section we can select which region our DocumentDB will be located. Same as other azure services select the same location with your consumers of the DocumentDB, for example the website, web services, etc.. After several minutes the DocumentDB will be ready. Click the KEYS button we can find the URI and primary key, which will be used when connecting. Now let's open Visual Studio and try to use the DocumentDB we had just created. Create a new console application and install the DocumentDB .NET client library from NuGet with the keyword "DocumentDB". You need to select "Include Prerelase" in NuGet Package Manager window since this library was not yet released. Next we will create a new database and document collection under our DocumentDB account. The code below created an instance of DocumentClient with the URI and primary key we just copied from azure portal, and create a database and collection. And it also prints the document and collection link string which will be used later to insert and query documents. 1: static void Main(string[] args) 2: { 3: var endpoint = new Uri("https://shx.documents.azure.com:443/"); 4: var key = "LU2NoyS2fH0131TGxtBE4DW/CjHQBzAaUx/mbuJ1X77C4FWUG129wWk2oyS2odgkFO2Xdif9/ZddintQicF+lA=="; 5:  6: var client = new DocumentClient(endpoint, key); 7: Run(client).Wait(); 8:  9: Console.WriteLine("done"); 10: Console.ReadKey(); 11: } 12:  13: static async Task Run(DocumentClient client) 14: { 15:  16: var database = new Database() { Id = "testdb" }; 17: database = await client.CreateDatabaseAsync(database); 18: Console.WriteLine("database link = {0}", database.SelfLink); 19:  20: var collection = new DocumentCollection() { Id = "testcol" }; 21: collection = await client.CreateDocumentCollectionAsync(database.SelfLink, collection); 22: Console.WriteLine("collection link = {0}", collection.SelfLink); 23: } Below is the result from the console window. We need to copy the collection link string for future usage. Now if we back to the portal we will find a database was listed with the name we specified in the code. Next we will insert a document into the database and collection we had just created. In the code below we pasted the collection link which copied in previous step, create a dynamic object with several properties defined. As you can see we can add some normal properties contains string, integer, we can also add complex property for example an array, a dictionary and an object reference, unless they can be serialized to JSON. 1: static void Main(string[] args) 2: { 3: var endpoint = new Uri("https://shx.documents.azure.com:443/"); 4: var key = "LU2NoyS2fH0131TGxtBE4DW/CjHQBzAaUx/mbuJ1X77C4FWUG129wWk2oyS2odgkFO2Xdif9/ZddintQicF+lA=="; 5:  6: var client = new DocumentClient(endpoint, key); 7:  8: // collection link pasted from the result in previous demo 9: var collectionLink = "dbs/AAk3AA==/colls/AAk3AP6oFgA=/"; 10:  11: // document we are going to insert to database 12: dynamic doc = new ExpandoObject(); 13: doc.firstName = "Shaun"; 14: doc.lastName = "Xu"; 15: doc.roles = new string[] { "developer", "trainer", "presenter", "father" }; 16:  17: // insert the docuemnt 18: InsertADoc(client, collectionLink, doc).Wait(); 19:  20: Console.WriteLine("done"); 21: Console.ReadKey(); 22: } the insert code will be very simple as below, just provide the collection link and the object we are going to insert. 1: static async Task InsertADoc(DocumentClient client, string collectionLink, dynamic doc) 2: { 3: var document = await client.CreateDocumentAsync(collectionLink, doc); 4: Console.WriteLine(await JsonConvert.SerializeObjectAsync(document, Formatting.Indented)); 5: } Below is the result after the object had been inserted. Finally we will query the document from the database and collection. Similar to the insert code, we just need to specify the collection link so that the .NET SDK will help us to retrieve all documents in it. 1: static void Main(string[] args) 2: { 3: var endpoint = new Uri("https://shx.documents.azure.com:443/"); 4: var key = "LU2NoyS2fH0131TGxtBE4DW/CjHQBzAaUx/mbuJ1X77C4FWUG129wWk2oyS2odgkFO2Xdif9/ZddintQicF+lA=="; 5:  6: var client = new DocumentClient(endpoint, key); 7:  8: var collectionLink = "dbs/AAk3AA==/colls/AAk3AP6oFgA=/"; 9:  10: SelectDocs(client, collectionLink); 11:  12: Console.WriteLine("done"); 13: Console.ReadKey(); 14: } 15:  16: static void SelectDocs(DocumentClient client, string collectionLink) 17: { 18: var docs = client.CreateDocumentQuery(collectionLink + "docs/").ToList(); 19: foreach(var doc in docs) 20: { 21: Console.WriteLine(doc); 22: } 23: } Since there's only one document in my collection below is the result when I executed the code. As you can see all properties, includes the array was retrieve at the same time. DocumentDB also attached some properties we didn't specified such as "_rid", "_ts", "_self" etc., which is controlled by the service.   DocumentDB Benefit DocumentDB is a document NoSQL database service. Different from the traditional database, document database is truly schema-free. In a short nut, you can save anything in the same database and collection if it could be serialized to JSON. We you query the document database, all sub documents will be retrieved at the same time. This means you don't need to join other tables when using a traditional database. Document database is very useful when we build some high performance system with hierarchical data structure. For example, assuming we need to build a blog system, there will be many blog posts and each of them contains the content and comments. The comment can be commented as well. If we were using traditional database, let's say SQL Server, the database schema might be defined as below. When we need to display a post we need to load the post content from the Posts table, as well as the comments from the Comments table. We also need to build the comment tree based on the CommentID field. But if were using DocumentDB, what we need to do is to save the post as a document with a list contains all comments. Under a comment all sub comments will be a list in it. When we display this post we just need to to query the post document, the content and all comments will be loaded in proper structure. 1: { 2: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 3: "title": "xxxxx", 4: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 5: "postedOn": "08/25/2014 13:55", 6: "comments": 7: [ 8: { 9: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 10: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 11: "commentedOn": "08/25/2014 14:00", 12: "commentedBy": "xxx" 13: }, 14: { 15: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 16: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 17: "commentedOn": "08/25/2014 14:10", 18: "commentedBy": "xxx", 19: "comments": 20: [ 21: { 22: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 23: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 24: "commentedOn": "08/25/2014 14:18", 25: "commentedBy": "xxx", 26: "comments": 27: [ 28: { 29: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 30: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 31: "commentedOn": "08/25/2014 18:22", 32: "commentedBy": "xxx", 33: } 34: ] 35: }, 36: { 37: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 38: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 39: "commentedOn": "08/25/2014 15:02", 40: "commentedBy": "xxx", 41: } 42: ] 43: }, 44: { 45: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 46: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 47: "commentedOn": "08/25/2014 14:30", 48: "commentedBy": "xxx" 49: } 50: ] 51: }   DocumentDB vs. Table Storage DocumentDB and Table Storage are all NoSQL service in Microsoft Azure. One common question is "when we should use DocumentDB rather than Table Storage". Here are some ideas from me and some MVPs. First of all, they are different kind of NoSQL database. DocumentDB is a document database while table storage is a key-value database. Second, table storage is cheaper. DocumentDB supports scale out from one capacity unit to 5 in preview period and each capacity unit provides 10GB local SSD storage. The price is $0.73/day includes 50% discount. For storage service the highest price is $0.061/GB, which is almost 10% of DocumentDB. Third, table storage provides local-replication, geo-replication, read access geo-replication while DocumentDB doesn't support. Fourth, there is local emulator for table storage but none for DocumentDB. We have to connect to the DocumentDB on cloud when developing locally. But, DocumentDB supports some cool features that table storage doesn't have. It supports store procedure, trigger and user-defined-function. It supports rich indexing while table storage only supports indexing against partition key and row key. It supports transaction, table storage supports as well but restricted with Entity Group Transaction scope. And the last, table storage is GA but DocumentDB is still in preview.   Summary In this post I have a quick demonstration and introduction about the new DocumentDB service in Azure. It's very easy to interact through .NET and it also support REST API, Node.js SDK and Python SDK. Then I explained the concept and benefit of  using document database, then compared with table storage.   Hope this helps, Shaun All documents and related graphics, codes are provided "AS IS" without warranty of any kind. Copyright © Shaun Ziyan Xu. This work is licensed under the Creative Commons License.

    Read the article

  • First Step Towards Rapid Enterprise Application Deployment

    - by Antoinette O'Sullivan
    Take Oracle VM Server for x86 training as a first step towards deploying enterprise applications rapidly. You have a choice between the following instructor-led training: Oracle VM with Oracle VM Server for x86 1-day Seminar. Take this course from your own desk on one of the 300 events on the schedule. This seminar tells you how to build a virtualization platform using the Oracle VM Manager and Oracle VM Server for x86 and to sustain the deployment of highly configurable, inter-connected virtual machines. Oracle VM Administration: Oracle VM Server for x86 3-day hands on course. This course teaches you how to build a virtualization platform using the Oracle VM Manager and Oracle VM Server for x86. You learn how deploy and manage highly configurable, inter-connected virtual machines. The course teaches you how to install and configure Oracle VM Server for x86 as well as details of network and storage configuration, pool and repository creation, and virtual machine management.Take this course from your own desk on one of the 450 events on the schedule. You can also take this course in an Oracle classroom on one of the following events:  Location  Date  Delivery Language  Istanbul, Turkey  12 November 2012  Turkish  Wellington, New Zealand  10 Dec 2012  English  Roseveille, United States  19 November 2012  English  Warsaw, Poland  17 October 2012  Polish  Paris, France  17 October 2012  French  Paris, France  21 November 2012  French  Dusseldorfm Germany  5 November 2012  German For more information on Oracle's Virtualization courses see http://oracle.com/education/vm

    Read the article

  • Global Indian Developer Summit (GIDS), JavaOne Moscow, Java Summit Chennai

    - by arungupta
    My whirlwind tour of Java EE and GlassFish starts next weekend and covers the following cities in the next 6 weeks: JavaOne and Oracle Develop, Moscow Global Indian Developer Summit, Bangalore Java Summit, Chennai JavaOne, Hyderabad OTN Developer Day, Pune OTN Developer Day, Istanbul Geecon, Poznan JEEConf, Kiev OTN Developer Day, Johannesburg Several other members of the team will be speaking at some of these events as well. Please feel free to reach out to any of us, ask a question, and share your passion. Here is the first set of conferences coming up: Date: Apr 17-18 Schedule My Schedule       Deploying your Java EE 6 Applications in Producion hands-on lab       Technical Keynote       Some other technical sessions Venue: Russian Academy of Sciences Register Connect: @OracleRU Date: April 17-20 Schedule (date decided, time slots TBD) My Schedule: NetBeans/Java EE 6 workshop on April 19th, Other sessions (as listed above) on April 20 Venue: J. N. Tata Auditorium, National Science Symposium Complex, Sir C. V. Raman Avenue, Bangalore, India Register Connect: @GreatIndianDev Date: April 21, 2011 Schedule My Schedule: Java EE 7 at 9:30am, JAX-RS 2.0 at 11am Venue: VELS University Register (FREE) Connect: @jug_c Where will I meet or run with you ? Do ask me to record a video session if you are using GlassFish and would like to share your story at blogs.oracle.com/stories.

    Read the article

  • Top Reasons to Take the MySQL Cluster Training

    - by Antoinette O'Sullivan
    Here are the top reasons to take the authorized MySQL Cluster training course: Take training which was developed by MySQL Cluster product team and delivered by the MySQL Cluster experts at Oracle Learn how to develop, deploy, manage and scale your MySQL Cluster applications more efficiently Keep your mission-critical applications and essential services up and running 24x7 Deliver the highest performance and scalability using MySQL Cluster best practices In this 3 day course, experienced database users learn the important details of clustering necessary to get started with MySQL Cluster, to properly configure and manage the cluster nodes to ensure high availability, to install the different nodes and provide a better understanding of the internals of the cluster. To see the schedule for this course, go to the Oracle University Portal (click on MySQL). Should you not see an event for a location/date that suits you, register your interest in additional events. Here is a small sample of the events already on the schedule for the MySQL Cluster course:  Location  Date  Delivery Language  Prague, Czech Republic  17 September 2012  Czech  Warsaw, Poland  1 August 2012  Polish  London, United Kingdom  18 July 2012  English  Lisbon, Portugal  3 December 2012  European Portugese  Nice, France  8 October 2012  French  Barcelona, Spain  25 September 2012  Spanish  Madrid, Spain  20 August 2012  Spanish  Denver, United States  17 October 2012  English  Chicago, United States  22 August 2012  English  Petaling Jaya, Malaysia  10 October 2012  English  Singapore  21 August 2012  English  Mexico City, Mexico  23 July 2012  Spanish

    Read the article

  • Devoxx UK JCP & Adopt-a-JSR activities

    - by Heather VanCura
    Devoxx UK starts this week!  The JCP Program is organizing many activities throughout the conference, including some tables in the Hackergarten area on 12-13 June.  Topics include Java EE, Data Grids, Java SE 8 (Lambdas and Date & Time API), Money & Currency API and OpenJDK.  We will have two book signings by Richard Warburton and Peter Pilgrim during the Hackergarten - free signed copy of their books at these times - first come, first served (limited quantities available).  Thursday night is the party and the Birds of a Feather (BoF) sessions - come with your favorite questions and topics related to the JCP, Adopt-a-JSR and Adopt OpenJDK Programs!  See below for the schedule of activities; I will fill in details for each session tomorrow.    Thursday 12 June 10:20 - 12:50 Java EE -- Arun Gupta 13:30-17:00 Lambdas/Date & Time API --Richard Warburton & Raoul-Gabriel Urma (also a book signing with Richard Warburon during the afternoon break) 14:30-17:30 Data Grids - Peter Lawrey 14:30-18:00 Money & Currency -- Anatole Tresch 18:45 Adopt OpenJDK BoF session (Java EE BoF runs concurrently) 19:45 JCP & Adopt-a-JSR BoF session Friday 13 June 10:20-13:00 OpenJDK -- Mani Sarkar  10:20- 14:30 Money & Currency -- Anatole Tresch 10:20 - 13:00 Java EE -- Peter Pilgrim 13:00-13:30 Peter Pilgrim Java EE 7 Book signing sponsored by JCP @ lunch time 13:30 - 15:30 JCP.Next/JSR 364 -- Heather VanCura

    Read the article

  • Juju Openstack bundle: Can't launch an instance

    - by user281985
    Deployed bundle:~makyo/openstack/2/openstack, on top of 7 physical boxes and 3 virtual ones. After changing vip_iface strings to point to right devices, e.g., br0 instead of eth0, and defining "/mnt/loopback|30G", in Cinder's block-device string, am able to navigate through openstack dashboard, error free. Following http://docs.openstack.org/grizzly/openstack-compute/install/apt/content/running-an-instance.html instructions, attempted to launch cirros 0.3.1 image; however, novalist shows the instance in error state. ubuntu@node7:~$ nova --debug boot --flavor 1 --image 28bed1bc-bc1c-4533-beee-8e0428ad40dd --key_name key2 --security_group default cirros REQ: curl -i http://keyStone.IP:5000/v2.0/tokens -X POST -H "Content-Type: application/json" -H "Accept: application/json" -H "User-Agent: python-novaclient" -d '{"auth": {"tenantName": "admin", "passwordCredentials": {"username": "admin", "password": "openstack"}}}' INFO (connectionpool:191) Starting new HTTP connection (1): keyStone.IP DEBUG (connectionpool:283) "POST /v2.0/tokens HTTP/1.1" 200 None RESP: [200] {'date': 'Tue, 10 Jun 2014 00:01:02 GMT', 'transfer-encoding': 'chunked', 'vary': 'X-Auth-Token', 'content-type': 'application/json'} RESP BODY: {"access": {"token": {"expires": "2014-06-11T00:01:02Z", "id": "3eefa1837d984426a633fe09259a1534", "tenant": {"description": "Created by Juju", "enabled": true, "id": "08cff06d13b74492b780d9ceed699239", "name": "admin"}}, "serviceCatalog": [{"endpoints": [{"adminURL": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239", "region": "RegionOne", "internalURL": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239", "publicURL": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239"}], "endpoints_links": [], "type": "compute", "name": "nova"}, {"endpoints": [{"adminURL": "http://nova.cloud.controller:9696", "region": "RegionOne", "internalURL": "http://nova.cloud.controller:9696", "publicURL": "http://nova.cloud.controller:9696"}], "endpoints_links": [], "type": "network", "name": "quantum"}, {"endpoints": [{"adminURL": "http://nova.cloud.controller:3333", "region": "RegionOne", "internalURL": "http://nova.cloud.controller:3333", "publicURL": "http://nova.cloud.controller:3333"}], "endpoints_links": [], "type": "s3", "name": "s3"}, {"endpoints": [{"adminURL": "http://i.p.s.36:9292", "region": "RegionOne", "internalURL": "http://i.p.s.36:9292", "publicURL": "http://i.p.s.36:9292"}], "endpoints_links": [], "type": "image", "name": "glance"}, {"endpoints": [{"adminURL": "http://i.p.s.39:8776/v1/08cff06d13b74492b780d9ceed699239", "region": "RegionOne", "internalURL": "http://i.p.s.39:8776/v1/08cff06d13b74492b780d9ceed699239", "publicURL": "http://i.p.s.39:8776/v1/08cff06d13b74492b780d9ceed699239"}], "endpoints_links": [], "type": "volume", "name": "cinder"}, {"endpoints": [{"adminURL": "http://nova.cloud.controller:8773/services/Cloud", "region": "RegionOne", "internalURL": "http://nova.cloud.controller:8773/services/Cloud", "publicURL": "http://nova.cloud.controller:8773/services/Cloud"}], "endpoints_links": [], "type": "ec2", "name": "ec2"}, {"endpoints": [{"adminURL": "http://keyStone.IP:35357/v2.0", "region": "RegionOne", "internalURL": "http://keyStone.IP:5000/v2.0", "publicURL": "http://i.p.s.44:5000/v2.0"}], "endpoints_links": [], "type": "identity", "name": "keystone"}], "user": {"username": "admin", "roles_links": [], "id": "b3730a52a32e40f0a9500440d1ef1c7d", "roles": [{"id": "e020001eb9a049f4a16540238ab158aa", "name": "Admin"}, {"id": "b84fbff4d5554d53bbbffdaad66b56cb", "name": "KeystoneServiceAdmin"}, {"id": "129c8b49d42b4f0796109aaef2069aa9", "name": "KeystoneAdmin"}], "name": "admin"}}} REQ: curl -i http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd -X GET -H "X-Auth-Project-Id: admin" -H "User-Agent: python-novaclient" -H "Accept: application/json" -H "X-Auth-Token: 3eefa1837d984426a633fe09259a1534" INFO (connectionpool:191) Starting new HTTP connection (1): nova.cloud.controller DEBUG (connectionpool:283) "GET /v1.1/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd HTTP/1.1" 200 719 RESP: [200] {'date': 'Tue, 10 Jun 2014 00:01:03 GMT', 'x-compute-request-id': 'req-7f3459f8-d3d5-47f1-97a3-8407a4419a69', 'content-type': 'application/json', 'content-length': '719'} RESP BODY: {"image": {"status": "ACTIVE", "updated": "2014-06-09T22:17:54Z", "links": [{"href": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd", "rel": "self"}, {"href": "http://nova.cloud.controller:8774/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd", "rel": "bookmark"}, {"href": "http://External.Public.Port:9292/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd", "type": "application/vnd.openstack.image", "rel": "alternate"}], "id": "28bed1bc-bc1c-4533-beee-8e0428ad40dd", "OS-EXT-IMG-SIZE:size": 13147648, "name": "Cirros 0.3.1", "created": "2014-06-09T22:17:54Z", "minDisk": 0, "progress": 100, "minRam": 0, "metadata": {}}} REQ: curl -i http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/flavors/1 -X GET -H "X-Auth-Project-Id: admin" -H "User-Agent: python-novaclient" -H "Accept: application/json" -H "X-Auth-Token: 3eefa1837d984426a633fe09259a1534" INFO (connectionpool:191) Starting new HTTP connection (1): nova.cloud.controller DEBUG (connectionpool:283) "GET /v1.1/08cff06d13b74492b780d9ceed699239/flavors/1 HTTP/1.1" 200 418 RESP: [200] {'date': 'Tue, 10 Jun 2014 00:01:04 GMT', 'x-compute-request-id': 'req-2c153110-6969-4f3a-b51c-8f1a6ce75bee', 'content-type': 'application/json', 'content-length': '418'} RESP BODY: {"flavor": {"name": "m1.tiny", "links": [{"href": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/flavors/1", "rel": "self"}, {"href": "http://nova.cloud.controller:8774/08cff06d13b74492b780d9ceed699239/flavors/1", "rel": "bookmark"}], "ram": 512, "OS-FLV-DISABLED:disabled": false, "vcpus": 1, "swap": "", "os-flavor-access:is_public": true, "rxtx_factor": 1.0, "OS-FLV-EXT-DATA:ephemeral": 0, "disk": 0, "id": "1"}} REQ: curl -i http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/servers -X POST -H "X-Auth-Project-Id: admin" -H "User-Agent: python-novaclient" -H "Content-Type: application/json" -H "Accept: application/json" -H "X-Auth-Token: 3eefa1837d984426a633fe09259a1534" -d '{"server": {"name": "cirros", "imageRef": "28bed1bc-bc1c-4533-beee-8e0428ad40dd", "key_name": "key2", "flavorRef": "1", "max_count": 1, "min_count": 1, "security_groups": [{"name": "default"}]}}' INFO (connectionpool:191) Starting new HTTP connection (1): nova.cloud.controller DEBUG (connectionpool:283) "POST /v1.1/08cff06d13b74492b780d9ceed699239/servers HTTP/1.1" 202 436 RESP: [202] {'date': 'Tue, 10 Jun 2014 00:01:05 GMT', 'x-compute-request-id': 'req-41e53086-6454-4efb-bb35-a30dc2c780be', 'content-type': 'application/json', 'location': 'http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/servers/2eb5e3ad-3044-41c1-bbb7-10f398f83e43', 'content-length': '436'} RESP BODY: {"server": {"security_groups": [{"name": "default"}], "OS-DCF:diskConfig": "MANUAL", "id": "2eb5e3ad-3044-41c1-bbb7-10f398f83e43", "links": [{"href": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/servers/2eb5e3ad-3044-41c1-bbb7-10f398f83e43", "rel": "self"}, {"href": "http://nova.cloud.controller:8774/08cff06d13b74492b780d9ceed699239/servers/2eb5e3ad-3044-41c1-bbb7-10f398f83e43", "rel": "bookmark"}], "adminPass": "oFRbvRqif2C8"}} REQ: curl -i http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/servers/2eb5e3ad-3044-41c1-bbb7-10f398f83e43 -X GET -H "X-Auth-Project-Id: admin" -H "User-Agent: python-novaclient" -H "Accept: application/json" -H "X-Auth-Token: 3eefa1837d984426a633fe09259a1534" INFO (connectionpool:191) Starting new HTTP connection (1): nova.cloud.controller DEBUG (connectionpool:283) "GET /v1.1/08cff06d13b74492b780d9ceed699239/servers/2eb5e3ad-3044-41c1-bbb7-10f398f83e43 HTTP/1.1" 200 1349 RESP: [200] {'date': 'Tue, 10 Jun 2014 00:01:05 GMT', 'x-compute-request-id': 'req-d91d0858-7030-469d-8e55-40e05e4d00fd', 'content-type': 'application/json', 'content-length': '1349'} RESP BODY: {"server": {"status": "BUILD", "updated": "2014-06-10T00:01:05Z", "hostId": "", "OS-EXT-SRV-ATTR:host": null, "addresses": {}, "links": [{"href": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/servers/2eb5e3ad-3044-41c1-bbb7-10f398f83e43", "rel": "self"}, {"href": "http://nova.cloud.controller:8774/08cff06d13b74492b780d9ceed699239/servers/2eb5e3ad-3044-41c1-bbb7-10f398f83e43", "rel": "bookmark"}], "key_name": "key2", "image": {"id": "28bed1bc-bc1c-4533-beee-8e0428ad40dd", "links": [{"href": "http://nova.cloud.controller:8774/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd", "rel": "bookmark"}]}, "OS-EXT-STS:task_state": "scheduling", "OS-EXT-STS:vm_state": "building", "OS-EXT-SRV-ATTR:instance_name": "instance-00000004", "OS-EXT-SRV-ATTR:hypervisor_hostname": null, "flavor": {"id": "1", "links": [{"href": "http://nova.cloud.controller:8774/08cff06d13b74492b780d9ceed699239/flavors/1", "rel": "bookmark"}]}, "id": "2eb5e3ad-3044-41c1-bbb7-10f398f83e43", "security_groups": [{"name": "default"}], "OS-EXT-AZ:availability_zone": "nova", "user_id": "b3730a52a32e40f0a9500440d1ef1c7d", "name": "cirros", "created": "2014-06-10T00:01:04Z", "tenant_id": "08cff06d13b74492b780d9ceed699239", "OS-DCF:diskConfig": "MANUAL", "accessIPv4": "", "accessIPv6": "", "progress": 0, "OS-EXT-STS:power_state": 0, "config_drive": "", "metadata": {}}} REQ: curl -i http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/flavors/1 -X GET -H "X-Auth-Project-Id: admin" -H "User-Agent: python-novaclient" -H "Accept: application/json" -H "X-Auth-Token: 3eefa1837d984426a633fe09259a1534" INFO (connectionpool:191) Starting new HTTP connection (1): nova.cloud.controller DEBUG (connectionpool:283) "GET /v1.1/08cff06d13b74492b780d9ceed699239/flavors/1 HTTP/1.1" 200 418 RESP: [200] {'date': 'Tue, 10 Jun 2014 00:01:05 GMT', 'x-compute-request-id': 'req-896c0120-1102-4408-9e09-cd628f2dd699', 'content-type': 'application/json', 'content-length': '418'} RESP BODY: {"flavor": {"name": "m1.tiny", "links": [{"href": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/flavors/1", "rel": "self"}, {"href": "http://nova.cloud.controller:8774/08cff06d13b74492b780d9ceed699239/flavors/1", "rel": "bookmark"}], "ram": 512, "OS-FLV-DISABLED:disabled": false, "vcpus": 1, "swap": "", "os-flavor-access:is_public": true, "rxtx_factor": 1.0, "OS-FLV-EXT-DATA:ephemeral": 0, "disk": 0, "id": "1"}} REQ: curl -i http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd -X GET -H "X-Auth-Project-Id: admin" -H "User-Agent: python-novaclient" -H "Accept: application/json" -H "X-Auth-Token: 3eefa1837d984426a633fe09259a1534" INFO (connectionpool:191) Starting new HTTP connection (1): nova.cloud.controller DEBUG (connectionpool:283) "GET /v1.1/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd HTTP/1.1" 200 719 RESP: [200] {'date': 'Tue, 10 Jun 2014 00:01:05 GMT', 'x-compute-request-id': 'req-454e9651-c247-4d31-8049-6b254de050ae', 'content-type': 'application/json', 'content-length': '719'} RESP BODY: {"image": {"status": "ACTIVE", "updated": "2014-06-09T22:17:54Z", "links": [{"href": "http://nova.cloud.controller:8774/v1.1/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd", "rel": "self"}, {"href": "http://nova.cloud.controller:8774/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd", "rel": "bookmark"}, {"href": "http://External.Public.Port:9292/08cff06d13b74492b780d9ceed699239/images/28bed1bc-bc1c-4533-beee-8e0428ad40dd", "type": "application/vnd.openstack.image", "rel": "alternate"}], "id": "28bed1bc-bc1c-4533-beee-8e0428ad40dd", "OS-EXT-IMG-SIZE:size": 13147648, "name": "Cirros 0.3.1", "created": "2014-06-09T22:17:54Z", "minDisk": 0, "progress": 100, "minRam": 0, "metadata": {}}} +-------------------------------------+--------------------------------------+ | Property | Value | +-------------------------------------+--------------------------------------+ | OS-EXT-STS:task_state | scheduling | | image | Cirros 0.3.1 | | OS-EXT-STS:vm_state | building | | OS-EXT-SRV-ATTR:instance_name | instance-00000004 | | flavor | m1.tiny | | id | 2eb5e3ad-3044-41c1-bbb7-10f398f83e43 | | security_groups | [{u'name': u'default'}] | | user_id | b3730a52a32e40f0a9500440d1ef1c7d | | OS-DCF:diskConfig | MANUAL | | accessIPv4 | | | accessIPv6 | | | progress | 0 | | OS-EXT-STS:power_state | 0 | | OS-EXT-AZ:availability_zone | nova | | config_drive | | | status | BUILD | | updated | 2014-06-10T00:01:05Z | | hostId | | | OS-EXT-SRV-ATTR:host | None | | key_name | key2 | | OS-EXT-SRV-ATTR:hypervisor_hostname | None | | name | cirros | | adminPass | oFRbvRqif2C8 | | tenant_id | 08cff06d13b74492b780d9ceed699239 | | created | 2014-06-10T00:01:04Z | | metadata | {} | +-------------------------------------+--------------------------------------+ ubuntu@node7:~$ ubuntu@node7:~$ nova list +--------------------------------------+--------+--------+----------+ | ID | Name | Status | Networks | +--------------------------------------+--------+--------+----------+ | 2eb5e3ad-3044-41c1-bbb7-10f398f83e43 | cirros | ERROR | | +--------------------------------------+--------+--------+----------+ ubuntu@node7:~$ var/log/nova/nova-compute.log shows the following error: ... 2014-06-10 00:01:06.048 AUDIT nova.compute.claims [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Attempting claim: memory 512 MB, disk 0 GB, VCPUs 1 2014-06-10 00:01:06.049 AUDIT nova.compute.claims [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Total Memory: 3885 MB, used: 512 MB 2014-06-10 00:01:06.049 AUDIT nova.compute.claims [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Memory limit: 5827 MB, free: 5315 MB 2014-06-10 00:01:06.049 AUDIT nova.compute.claims [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Total Disk: 146 GB, used: 0 GB 2014-06-10 00:01:06.050 AUDIT nova.compute.claims [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Disk limit not specified, defaulting to unlimited 2014-06-10 00:01:06.050 AUDIT nova.compute.claims [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Total CPU: 2 VCPUs, used: 0 VCPUs 2014-06-10 00:01:06.050 AUDIT nova.compute.claims [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] CPU limit not specified, defaulting to unlimited 2014-06-10 00:01:06.051 AUDIT nova.compute.claims [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Claim successful 2014-06-10 00:01:06.963 WARNING nova.network.quantumv2.api [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] No network configured! 2014-06-10 00:01:08.347 ERROR nova.compute.manager [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Instance failed to spawn 2014-06-10 00:01:08.347 32223 TRACE nova.compute.manager [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Traceback (most recent call last): 2014-06-10 00:01:08.347 32223 TRACE nova.compute.manager [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] File "/usr/lib/python2.7/dist-packages/nova/compute/manager.py", line 1118, in _spawn 2014-06-10 00:01:08.347 32223 TRACE nova.compute.manager [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] self._legacy_nw_info(network_info), 2014-06-10 00:01:08.347 32223 TRACE nova.compute.manager [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] File "/usr/lib/python2.7/dist-packages/nova/compute/manager.py", line 703, in _legacy_nw_info 2014-06-10 00:01:08.347 32223 TRACE nova.compute.manager [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] network_info = network_info.legacy() 2014-06-10 00:01:08.347 32223 TRACE nova.compute.manager [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] AttributeError: 'list' object has no attribute 'legacy' 2014-06-10 00:01:08.347 32223 TRACE nova.compute.manager [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] 2014-06-10 00:01:08.919 AUDIT nova.compute.manager [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Terminating instance 2014-06-10 00:01:09.712 32223 ERROR nova.virt.libvirt.driver [-] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] During wait destroy, instance disappeared. 2014-06-10 00:01:09.718 INFO nova.virt.libvirt.firewall [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Attempted to unfilter instance which is not filtered 2014-06-10 00:01:09.719 INFO nova.virt.libvirt.driver [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Deleting instance files /var/lib/nova/instances/2eb5e3ad-3044-41c1-bbb7-10f398f83e43 2014-06-10 00:01:10.044 ERROR nova.compute.manager [req-41e53086-6454-4efb-bb35-a30dc2c780be b3730a52a32e40f0a9500440d1ef1c7d 08cff06d13b74492b780d9ceed699239] [instance: 2eb5e3ad-3044-41c1-bbb7-10f398f83e43] Error: ['Traceback (most recent call last):\n', ' File "/usr/lib/python2.7/dist-packages/nova/compute/manager.py", line 864, in _run_instance\n set_access_ip=set_access_ip)\n', ' File "/usr/lib/python2.7/dist-packages/nova/compute/manager.py", line 1123, in _spawn\n LOG.exception(_(\'Instance failed to spawn\'), instance=instance)\n', ' File "/usr/lib/python2.7/contextlib.py", line 24, in __exit__\n self.gen.next()\n', ' File "/usr/lib/python2.7/dist-packages/nova/compute/manager.py", line 1118, in _spawn\n self._legacy_nw_info(network_info),\n', ' File "/usr/lib/python2.7/dist-packages/nova/compute/manager.py", line 703, in _legacy_nw_info\n network_info = network_info.legacy()\n', "AttributeError: 'list' object has no attribute 'legacy'\n"] 2014-06-10 00:01:40.951 32223 AUDIT nova.compute.resource_tracker [-] Auditing locally available compute resources 2014-06-10 00:01:41.072 32223 AUDIT nova.compute.resource_tracker [-] Free ram (MB): 2861 2014-06-10 00:01:41.072 32223 AUDIT nova.compute.resource_tracker [-] Free disk (GB): 146 2014-06-10 00:01:41.073 32223 AUDIT nova.compute.resource_tracker [-] Free VCPUS: 1 2014-06-10 00:01:41.262 32223 INFO nova.compute.resource_tracker [-] Compute_service record updated for node5:node5.maas ... Can't seem to find any entries in quantum.conf related to "legacy". Any help would be appreciated. Cheers,

    Read the article

  • Silverlight Cream for November 25, 2011 -- #1174

    - by Dave Campbell
    In this Issue: Michael Collier, Samidip Basu, Jesse Liberty, Dhananjay Kumar, and Michael Crump. Above the Fold: WP7: "31 Days of Mango | Day #16: Isolated Storage Explorer" Samidip Basu Metro/WinRT/W8: "1360x768x32 Resolution in Windows 8 in VirtualBox" Michael Crump Shoutouts: Michael Palermo's latest Desert Mountain Developers is up Michael Washington's latest Visual Studio #LightSwitch Daily is up Alex Golesh releases a Silverlight 5-friendly version of his external map manifest file tool: Utility: Extmap Maker v1.1From SilverlightCream.com:31 Days of Mango | Day #17: Using Windows AzureMichael Collier has Jeff Blankenburg's Day 17 and is talking about Azure services for your Phone apps... great discussion on this... good diagrams, code, and entire project to download31 Days of Mango | Day #16: Isolated Storage ExplorerSamidip Basu has Jeff Blankenburg's 31 Days for Day 16, and is discussing ISO, and the Isolated Storage Explorer which helps peruse ISO either in the emulator or on your deviceTest Driven Development–Testing Private ValuesJesse Liberty's got a post up discussing TDD in his latest Full Stack excerpt wherein he and Jon Galloway are building a Pomodoro timer app. He has a solution for dealing with private member variables and is looking for feedbackVideo on How to work with System Tray Progress Indicator in Windows Phone 7Dhananjay Kumar's latest video tutorial is up... covering working with the System Tray Progress Indicator in WP7, as the title says :)1360x768x32 Resolution in Windows 8 in VirtualBoxMichael Crump is using a non-standard resolution with Win8 preview and demosntrates how to make that all work with VirtualBoxMichaelStay in the 'Light!Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCreamJoin me @ SilverlightCream | Phoenix Silverlight User GroupTechnorati Tags:Silverlight    Silverlight 3    Silverlight 4    Windows PhoneMIX10

    Read the article

  • How to reset display settings in XFCE \ Ubuntu 12.04 and also flgrx drivers

    - by Agent24
    I recently upgraded to Ubuntu 12.04 and since I hate unity I installed the Xubuntu package and am using XFCE instead. Since I have a Radeon HD5770 I also installed the fglrx drivers. This all went fine (aside from the fact that the post-release update fglrx drivers have an error on installation and Ubuntu thinks they're not installed when they actually are. I configured my display settings (dual monitors, a 17" CRT on VGA and a 17" LCD on DVI) in the amdcccle program and everything was perfect. THEN, 2 days ago, I accidentally clicked on the "Display" settings in XFCE "settings" manager. After that, everything got screwed. Now, I normally run the CRT at 1152x854 and the LCD at 1280x1024 with the CRT as my primary monitor (with panel) and the LCD without panels etc just to display other windows when I want to drag them over there. The problem is now that if I set my CRT to 1152x864, it stays at 1280x1024 virtually and half the stuff falls off the screen. It also puts the LCD at 1280x1024 BUT then overlays the CRT's display ontop with different wallpaper in an L shape down the right-hand and bottom edges. In short, nothing makes sense and everything is FUBAR. I tried uninstalling fglrx through synaptic, and renaming xorg.conf and also the xfce XML file that has monitor settings but it still won't make sense. Unity on the other hand can currently set everything normally so the problem appears to be only with XFCE. In any case, I can't even get the fglrx drivers back, when I re-installed them, I can't run amdccle anymore as it says the driver isn't installed!! Can someone help me reset my XFCE settings so the monitors aren't screwed with some incorrect virtual desktop size and also so I can get fglrx drivers back and working? I really don't want to have to format and reinstall and go through all the hassle but it looks like I may have to :(

    Read the article

  • Building Publishing Pages in Code

    - by David Jacobus
    Originally posted on: http://geekswithblogs.net/djacobus/archive/2013/10/27/154478.aspxOne of the Mantras we developers try to follow: Ensure that the solution package we deliver to the client is complete.  We build Web Parts, Master Pages, Images, CSS files and other artifacts that we push to the client with a WSP (Solution Package) And then we have them finish the solution by building their site pages by adding the web parts to the site pages.       I am a proponent that we,  the developers,  should minimize this time consuming work and build these site pages in code.  I found a few blogs and some MSDN documentation but not really a complete solution that has all these artifacts working in one solution.   What I am will discuss and provide a solution for is a package that has: 1.  Master Page 2.  Page Layout 3.  Page Web Parts 4.  Site Pages   Most all done in code without the development team or the developers having to finish up the site building process spending a few hours or days completing the site!  I am not implying that in Development we do this. In fact,  we build these pages incrementally testing our web parts, etc. I am saying that the final action in our solution is that we take all these artifacts and add them to the site pages in code, the client then only needs to activate a few features and VIOLA their site appears!.  I had a project that had me build 8 pages like this as part of the solution.   In this blog post, I am taking a master page solution that I have called DJGreenMaster.  On My Office 365 Development Site it looks like this:     It is a generic master page for a SharePoint 2010 site Along with a three column layout.  Centered with a footer that uses a SharePoint List and Web Part for the footer links.  I use this master page a lot in my site development!  Easy to change the color and site logo with a little CSS.   I am going to add a few web parts for discussion purposes and then add these web parts to a site page in code.    Lets look at the solution package for DJ Green Master as that will be the basis project for building the site pages:   What you are seeing  is a complete solution to add a Master Page to a site collection which contains: 1.  Master Page Module which contains the Master Page and Page Layout 2.  The Footer Module to add the Footer Web Part 3.  Miscellaneous modules to add images, JQuery, CSS and subsite page 4.  3 features and two feature event receivers: a.  DJGreenCSS, used to add the master page CSS file to Style Sheet Library and an Event Receiver to check it in. b.  DJGreenMaster used to add the Master Page and Page Layout.  In an Event Receiver change the master page to DJGreenMaster , create the footer list and check the files in. c.  DJGreenMasterWebParts add the Footer Web Part to the site collection. I won’t go over the code for this as I will give it to you at the end of this blog post. I have discussed creating a list in code in a previous post.  So what we have is the basis to begin what is germane to this discussion.  I have the first two requirements completed.  I need now to add page web parts and the build the pages in code.  For the page web parts, I will use one downloaded from Codeplex which does not use a SharePoint custom list for simplicity:   Weather Web Part and another downloaded from MSDN which is a SharePoint Custom Calendar Web Part, I had to add some functionality to make the events color coded to exceed the built-in 10 overlays using JQuery!    Here is the solution with the added projects:     Here is a screen shot of the Weather Web Part Deployed:   Here is a screen shot of the Site Calendar with JQuery:     Okay, Now we get to the final item:  To create Publishing pages.   We need to add a feature receiver to the DJGreenMaster project I will name it DJSitePages and also add a Event Receiver:       We will build the page at the site collection level and all of the code necessary will be contained in the event receiver.   Added a reference to the Microsoft.SharePoint.Publishing.dll contained in the ISAPI folder of the 14 Hive.   First we will add some static methods from which we will call  in our Event Receiver:   1: private static void checkOut(string pagename, PublishingPage p) 2: { 3: if (p.Name.Equals(pagename, StringComparison.InvariantCultureIgnoreCase)) 4: { 5: 6: if (p.ListItem.File.CheckOutType == SPFile.SPCheckOutType.None) 7: { 8: p.CheckOut(); 9: } 10:   11: if (p.ListItem.File.CheckOutType == SPFile.SPCheckOutType.Online) 12: { 13: p.CheckIn("initial"); 14: p.CheckOut(); 15: } 16: } 17: } 18: private static void checkin(PublishingPage p,PublishingWeb pw) 19: { 20: SPFile publishFile = p.ListItem.File; 21:   22: if (publishFile.CheckOutType != SPFile.SPCheckOutType.None) 23: { 24:   25: publishFile.CheckIn( 26:   27: "CheckedIn"); 28:   29: publishFile.Publish( 30:   31: "published"); 32: } 33: // In case of content approval, approve the file need to add 34: //pulishing site 35: if (pw.PagesList.EnableModeration) 36: { 37: publishFile.Approve("Initial"); 38: } 39: publishFile.Update(); 40: }   In a Publishing Site, CheckIn and CheckOut  are required when dealing with pages in a publishing site.  Okay lets look at the Feature Activated Event Receiver: 1: public override void FeatureActivated(SPFeatureReceiverProperties properties) 2: { 3:   4:   5:   6: object oParent = properties.Feature.Parent; 7:   8:   9:   10: if (properties.Feature.Parent is SPWeb) 11: { 12:   13: currentWeb = (SPWeb)oParent; 14:   15: currentSite = currentWeb.Site; 16:   17: } 18:   19: else 20: { 21:   22: currentSite = (SPSite)oParent; 23:   24: currentWeb = currentSite.RootWeb; 25:   26: } 27: 28:   29: //create the publishing pages 30: CreatePublishingPage(currentWeb, "Home.aspx", "ThreeColumnLayout.aspx","Home"); 31: //CreatePublishingPage(currentWeb, "Dummy.aspx", "ThreeColumnLayout.aspx","Dummy"); 32: }     Basically we are calling the method Create Publishing Page with parameters:  Current Web, Name of the Page, The Page Layout, Title of the page.  Let’s look at the Create Publishing Page method:   1:   2: private void CreatePublishingPage(SPWeb site, string pageName, string pageLayoutName, string title) 3: { 4: PublishingSite pubSiteCollection = new PublishingSite(site.Site); 5: PublishingWeb pubSite = null; 6: if (pubSiteCollection != null) 7: { 8: // Assign an object to the pubSite variable 9: if (PublishingWeb.IsPublishingWeb(site)) 10: { 11: pubSite = PublishingWeb.GetPublishingWeb(site); 12: } 13: } 14: // Search for the page layout for creating the new page 15: PageLayout currentPageLayout = FindPageLayout(pubSiteCollection, pageLayoutName); 16: // Check or the Page Layout could be found in the collection 17: // if not (== null, return because the page has to be based on 18: // an excisting Page Layout 19: if (currentPageLayout == null) 20: { 21: return; 22: } 23:   24: 25: PublishingPageCollection pages = pubSite.GetPublishingPages(); 26: foreach (PublishingPage p in pages) 27: { 28: //The page allready exists 29: if ((p.Name == pageName)) return; 30:   31: } 32: 33:   34:   35: PublishingPage newPage = pages.Add(pageName, currentPageLayout); 36: newPage.Description = pageName.Replace(".aspx", ""); 37: // Here you can set some properties like: 38: newPage.IncludeInCurrentNavigation = true; 39: newPage.IncludeInGlobalNavigation = true; 40: newPage.Title = title; 41: 42: 43:   44:   45: 46:   47: //build the page 48:   49: 50: switch (pageName) 51: { 52: case "Homer.aspx": 53: checkOut("Courier.aspx", newPage); 54: BuildHomePage(site, newPage); 55: break; 56:   57:   58: default: 59: break; 60: } 61: // newPage.Update(); 62: //Now we can checkin the newly created page to the “pages” library 63: checkin(newPage, pubSite); 64: 65: 66: }     The narrative in what is going on here is: 1.  We need to find out if we are dealing with a Publishing Web.  2.  Get the Page Layout 3.  Create the Page in the pages list. 4.  Based on the page name we build that page.  (Here is where we can add all the methods to build multiple pages.) In the switch we call Build Home Page where all the work is done to add the web parts.  Prior to adding the web parts we need to add references to the two web part projects in the solution. using WeatherWebPart.WeatherWebPart; using CSSharePointCustomCalendar.CustomCalendarWebPart;   We can then reference them in the Build Home Page method.   Let’s look at Build Home Page: 1:   2: private static void BuildHomePage(SPWeb web, PublishingPage pubPage) 3: { 4: // build the pages 5: // Get the web part manager for each page and do the same code as below (copy and paste, change to the web parts for the page) 6: // Part Description 7: SPLimitedWebPartManager mgr = web.GetLimitedWebPartManager(web.Url + "/Pages/Home.aspx", System.Web.UI.WebControls.WebParts.PersonalizationScope.Shared); 8: WeatherWebPart.WeatherWebPart.WeatherWebPart wwp = new WeatherWebPart.WeatherWebPart.WeatherWebPart() { ChromeType = PartChromeType.None, Title = "Todays Weather", AreaCode = "2504627" }; 9: //Dictionary<string, string> wwpDic= new Dictionary<string, string>(); 10: //wwpDic.Add("AreaCode", "2504627"); 11: //setWebPartProperties(wwp, "WeatherWebPart", wwpDic); 12:   13: // Add the web part to a pagelayout Web Part Zone 14: mgr.AddWebPart(wwp, "g_685594D193AA4BBFABEF2FB0C8A6C1DD", 1); 15:   16: CSSharePointCustomCalendar.CustomCalendarWebPart.CustomCalendarWebPart cwp = new CustomCalendarWebPart() { ChromeType = PartChromeType.None, Title = "Corporate Calendar", listName="CorporateCalendar" }; 17:   18: mgr.AddWebPart(cwp, "g_20CBAA1DF45949CDA5D351350462E4C6", 1); 19:   20:   21: pubPage.Update(); 22:   23: } Here is what we are doing: 1.  We got  a reference to the SharePoint Limited Web Part Manager and linked/referenced Home.aspx  2.  Instantiated the a new Weather Web Part and used the Manager to add it to the page in a web part zone identified by ID,  thus the need for a Page Layout where the developer knows the ID’s. 3.  Instantiated the Calendar Web Part and used the Manager to add it to the page. 4. We the called the Publishing Page update method. 5.  Lastly, the Create Publishing Page method checks in the page just created.   Here is a screen shot of the page right after a deploy!       Okay!  I know we could make a home page look much better!  However, I built this whole Integrated solution in less than a day with the caveat that the Green Master was already built!  So what am I saying?  Build you web parts, master pages, etc.  At the very end of the engagement build the pages.  The client will be very happy!  Here is the code for this solution Code

    Read the article

  • Stuttgart 24.07. 16:30Uhr: Virtualisierung mit LDOMs in der Praxis

    - by Franz Haberhauer
    Mit einer Veranstaltung zum Thema ""Virtualisierung mit LDOMs in der Praxis" beginnen wir in der Oracle Geschäftstelle Stuttgart eine Veranstaltungsreihe Red Hardware Cafe rund um Themen aus der Praxis des Einsatzes von Oracle Hardware Produkten.  Auf der technischen Ebene (z.B. Adminstratoren, Architekten und Consultants) betrachten wir jeweils ein Thema im Detail - bei einem After Work Imbiss. Den Auftakt bildet die Server-Virtualisierung mit den Systemen der SPARC Enterprise T-Serie. Im Hauptteil wird Stefan Hinker den Einsatz des Oracle VM Server für SPARC in der Praxis vorstellen. Neben einem kurzen theoretischen Überblick und einer Einordnung in die unterschiedlichen Technologien der Virtualisierung auf der Serverseite wird eine Live-Vorführung auf Demosysteme erfolgen. Stefan ist seit vielen Jahren ein ausgewiesener Spezialist zum Thema SPARC Server Technologien und stellt sein Wissen und seine Erfahrungen beim Kunden, auf Veranstaltung, bei Workshops und in seinem Blog  zur Verfügung. Agenda: 16:00    Registrierung und Welcome mit Erfrischungen 16:30    Oracle Hardware Aktuell 16:50    LDoms und Solaris  Zonen - was, wann, wie? 17:10    LDoms in der Praxis mit Best Practices, Tipps und Tricks - Teil 1 17:40    Pause 18:00    LDoms in der Praxis mit Best Practices, Tipps und Tricks - Teil 2 19:00    Offener Erfahrungsaustausch Zur Planung der Erfrischungen bitten wir um eine Anmeldung zu dieser für Teilnehmer kostenfreien Veranstaltung.

    Read the article

  • Cannot log in to the desktop on ubuntu 11.10?

    - by Jichao
    The problem is, I could log in under the terminal, i could ifup eth0, i could do anything I want in the terminal, but if I use ctrl+alt+f7 goto the gnome login screen, after I input the correct password, the system just send me back to same login screen again. I have created a new user, but it didn't work. I have change all the files under ~/ to jichao:jichao(which is my username) with chown -hR jichao:jichao /home/jichao, but it didn't work too. I searched the internet, somebody said I should see the logs under /var/log/gdm, but there is not a /var/log/gdm directory in my box. Here are the tail of files under /var/log/ tail X.org.log [ 3263.348] (II) Loading /usr/lib/xorg/modules/input/evdev_drv.so [ 3263.348] (**) Dell Dell USB Keyboard: always reports core events [ 3263.348] (**) Dell Dell USB Keyboard: Device: "/dev/input/event5" [ 3263.348] (--) Dell Dell USB Keyboard: Found keys [ 3263.348] (II) Dell Dell USB Keyboard: Configuring as keyboard [ 3263.348] (**) Option "config_info" "udev:/sys/devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.4/2-1.4:1.0/input/input29/event5" [ 3263.348] (II) XINPUT: Adding extended input device "Dell Dell USB Keyboard" (type: KEYBOARD) [ 3263.348] (**) Option "xkb_rules" "evdev" [ 3263.348] (**) Option "xkb_model" "pc105" [ 3263.348] (**) Option "xkb_layout" "us" kern.log Mar 20 09:32:58 jichao-MS-730 kernel: [ 3182.701247] input: Dell Dell USB Keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.4/2-1.4:1.0/input/input27 Mar 20 09:32:58 jichao-MS-730 kernel: [ 3182.701392] generic-usb 0003:413C:2003.0018: input,hidraw1: USB HID v1.10 Keyboard [Dell Dell USB Keyboard] on usb-0000:00:1d.0-1.4/input0 Mar 20 09:33:02 jichao-MS-730 kernel: [ 3186.642572] usb 2-1.3: new low speed USB device number 17 using ehci_hcd Mar 20 09:33:02 jichao-MS-730 kernel: [ 3186.741892] input: Microsoft Microsoft 5-Button Mouse with IntelliEye(TM) as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.3/2-1.3:1.0/input/input28 Mar 20 09:33:02 jichao-MS-730 kernel: [ 3186.742080] generic-usb 0003:045E:0047.0019: input,hidraw2: USB HID v1.10 Mouse [Microsoft Microsoft 5-Button Mouse with IntelliEye(TM)] on usb-0000:00:1d.0-1.3/input0 Mar 20 09:33:27 jichao-MS-730 kernel: [ 3212.473901] usb 2-1.3: USB disconnect, device number 17 Mar 20 09:33:28 jichao-MS-730 kernel: [ 3212.702031] usb 2-1.4: USB disconnect, device number 16 Mar 20 09:34:08 jichao-MS-730 kernel: [ 3253.022655] usb 2-1.4: new low speed USB device number 18 using ehci_hcd Mar 20 09:34:08 jichao-MS-730 kernel: [ 3253.124278] input: Dell Dell USB Keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.4/2-1.4:1.0/input/input29 Mar 20 09:34:08 jichao-MS-730 kernel: [ 3253.124423] generic-usb 0003:413C:2003.001A: input,hidraw1: USB HID v1.10 Keyboard [Dell Dell USB Keyboard] on usb-0000:00:1d.0-1.4/input0 Mar 20 09:33:02 jichao-MS-730 kernel: [ 3186.741892] input: Microsoft Microsoft 5-Button Mouse with IntelliEye(TM) as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.3/2-1.3:1.0/input/input28 Mar 20 09:33:02 jichao-MS-730 kernel: [ 3186.742080] generic-usb 0003:045E:0047.0019: input,hidraw2: USB HID v1.10 Mouse [Microsoft Microsoft 5-Button Mouse with IntelliEye(TM)] on usb-0000:00:1d.0-1.3/input0 syslog Mar 20 09:33:02 jichao-MS-730 mtp-probe: bus: 2, device: 17 was not an MTP device Mar 20 09:33:27 jichao-MS-730 kernel: [ 3212.473901] usb 2-1.3: USB disconnect, device number 17 Mar 20 09:33:28 jichao-MS-730 kernel: [ 3212.702031] usb 2-1.4: USB disconnect, device number 16 Mar 20 09:34:08 jichao-MS-730 kernel: [ 3253.022655] usb 2-1.4: new low speed USB device number 18 using ehci_hcd Mar 20 09:34:08 jichao-MS-730 mtp-probe: checking bus 2, device 18: "/sys/devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.4" Mar 20 09:34:08 jichao-MS-730 mtp-probe: bus: 2, device: 18 was not an MTP device Mar 20 09:34:08 jichao-MS-730 kernel: [ 3253.124278] input: Dell Dell USB Keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.4/2-1.4:1.0/input/input29 Mar 20 09:34:08 jichao-MS-730 kernel: [ 3253.124423] generic-usb 0003:413C:2003.001A: input,hidraw1: USB HID v1.10 Keyboard [Dell Dell USB Keyboard] on usb-0000:00:1d.0-1.4/input0 auth.log Mar 20 09:18:52 jichao-MS-730 lightdm: pam_ck_connector(lightdm-autologin:session): nox11 mode, ignoring PAM_TTY :0 Mar 20 09:18:53 jichao-MS-730 lightdm: pam_succeed_if(lightdm:auth): requirement "user ingroup nopasswdlogin" not met by user "jichao" Mar 20 09:18:53 jichao-MS-730 dbus[835]: [system] Rejected send message, 2 matched rules; type="method_call", sender=":1.240" (uid=104 pid=6457 comm="/usr/lib/indicator-datetime/indicator-datetime-ser") interface="org.freedesktop.DBus.Properties" member="GetAll" error name="(unset)" requested_reply="0" destination=":1.11" (uid=0 pid=1156 comm="/usr/sbin/console-kit-daemon --no-daemon ") Mar 20 09:19:38 jichao-MS-730 sudo: jichao : TTY=tty6 ; PWD=/home ; USER=root ; COMMAND=/bin/chown -hR jichao:jichao jicha Mar 20 09:19:39 jichao-MS-730 sudo: jichao : TTY=tty6 ; PWD=/home ; USER=root ; COMMAND=/bin/chown -hR jichao:jichao jichao Mar 20 09:20:10 jichao-MS-730 lightdm: pam_unix(lightdm-autologin:session): session closed for user lightdm Mar 20 09:20:11 jichao-MS-730 lightdm: pam_unix(lightdm-autologin:session): session opened for user lightdm by (uid=0) Mar 20 09:20:11 jichao-MS-730 lightdm: pam_ck_connector(lightdm-autologin:session): nox11 mode, ignoring PAM_TTY :0 Mar 20 09:20:12 jichao-MS-730 lightdm: pam_succeed_if(lightdm:auth): requirement "user ingroup nopasswdlogin" not met by user "jichao" Mar 20 09:20:12 jichao-MS-730 dbus[835]: [system] Rejected send message, 2 matched rules; type="method_call", sender=":1.247" (uid=104 pid=6572 comm="/usr/lib/indicator-datetime/indicator-datetime-ser") interface="org.freedesktop.DBus.Properties" member="GetAll" error name="(unset)" requested_reply="0" destination=":1.11" (uid=0 pid=1156 comm="/usr/sbin/console-kit-daemon --no-daemon ") It seems that my .xsession-errors does not grow since yesterday. Here is my .xsession-error: (gnome-settings-daemon:1550): Gdk-WARNING **: The program 'gnome-settings-daemon' received an X Window System error. This probably reflects a bug in the program. The error was 'BadWindow (invalid Window parameter)'. (Details: serial 26702 error_code 3 request_code 2 minor_code 0) (Note to programmers: normally, X errors are reported asynchronously; that is, you will receive the error a while after causing it. To debug your program, run it with the --sync command line option to change this behavior. You can then get a meaningful backtrace from your debugger if you break on the gdk_x_error() function.) (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed (nautilus:3106): GLib-GObject-CRITICAL **: g_value_get_object: assertion `G_VALUE_HOLDS_OBJECT (value)' failed WARN 2012-03-17 19:28:46 glib <unknown>:0 Unable to fetch children: Method "Children" with signature "" on interface "org.ayatana.bamf.view" doesn't exist WARN 2012-03-17 19:28:46 glib <unknown>:0 Unable to fetch children: Method "Children" with signature "" on interface "org.ayatana.bamf.view" doesn't exist (yunio:2430): Gtk-WARNING **: ??????????????:“pixmap”, (yunio:2430): Gtk-WARNING **: ??????????????:“pixmap”, (polkit-gnome-authentication-agent-1:1601): Gtk-WARNING **: ??????????????:“pixmap”, (yunio:2430): Gtk-WARNING **: ??????????????:“pixmap”, (yunio:2430): Gtk-WARNING **: ??????????????:“pixmap”, (polkit-gnome-authentication-agent-1:1601): Gtk-WARNING **: ??????????????:“pixmap”, (polkit-gnome-authentication-agent-1:1601): Gtk-WARNING **: ??????????????:“pixmap”, (polkit-gnome-authentication-agent-1:1601): Gtk-WARNING **: ??????????????:“pixmap”, /usr/share/system-config-printer/applet.py:336: GtkWarning: ??????????????:“pixmap”, self.loop.run () (unity-window-decorator:1652): Gtk-WARNING **: ??????????????:“pixmap”, (unity-window-decorator:1652): Gtk-WARNING **: ??????????????:“pixmap”, (unity-window-decorator:1652): Gtk-WARNING **: ??????????????:“pixmap”, (unity-window-decorator:1652): Gtk-WARNING **: ??????????????:“pixmap”, common-plugin-Message: checking whether we have a device for 4: yes common-plugin-Message: checking whether we have a device for 5: yes common-plugin-Message: checking whether we have a device for 6: yes common-plugin-Message: checking whether we have a device for 7: yes common-plugin-Message: checking whether we have a device for 10: yes common-plugin-Message: checking whether we have a device for 8: yes common-plugin-Message: checking whether we have a device for 9: yes (gnome-settings-daemon:13791): GLib-GObject-CRITICAL **: g_object_unref: assertion `G_IS_OBJECT (object)' failed [1331983727,000,xklavier.c:xkl_engine_start_listen/] The backend does not require manual layout management - but it is provided by the application ** (gnome-fallback-mount-helper:1584): DEBUG: ConsoleKit session is active 0 (gnome-fallback-mount-helper:1584): Gdk-WARNING **: gnome-fallback-mount-helper: Fatal IO error 11 (???????) on X server :0. (gdu-notification-daemon:1708): Gdk-WARNING **: gdu-notification-daemon: Fatal IO error 11 (???????) on X server :0. unity-window-decorator: Fatal IO error 11 (???????) on X server :0.0. (bluetooth-applet:1583): Gdk-WARNING **: bluetooth-applet: Fatal IO error 11 (???????) on X server :0. (nm-applet:1596): Gdk-WARNING **: nm-applet: Fatal IO error 11 (???????) on X server :0. (nautilus:3106): IBUS-WARNING **: _connection_closed_cb: Underlying GIOStream returned 0 bytes on an async read (update-notifier:1821): Gdk-WARNING **: update-notifier: Fatal IO error 11 (???????) on X server :0. applet.py: Fatal IO error 11 (???????) on X server :0. (nautilus:3106): Gdk-WARNING **: nautilus: Fatal IO error 11 (???????) on X server :0. Could you help me, Thanks.

    Read the article

  • Very slow write access to SSD disks on some Asus P8Z77 motherboards

    - by lenik
    I have Asus P8Z77-V LK motherboard, that ran Mint 13 (based on Ubuntu 12.04) just perfectly, but recently I've tried to install Mint 17 and noticed abysmal write performance. Write speed on SSD disk was about 1.5MB/sec, when it's supposed to be in 150-250MB/sec range. For write testing I've used dd if=/dev/zero of=/dev/sda bs=10M count=10 while booted up from LiveCD. I have also tested the read speed with hdparm -tT /dev/sda and got about 440MB/sec -- that's normal. I can tell, the read performance has not degraded at all and is not an issue here. Since I had a few different SSD disks and few motherboards, I've tested and tested and here are results: Asus P8H77 works fine with Mint13, has very slow write speed starting from Mint14. Asus P8Z77-V LK works with Mint13, has very slow write speed starting from Mint14. Asus P8Z77-V PRO works with Mint13, and works just fine with Mint14, 15, 16 and 17. The only difference between "PRO" version and others is that it has extra SATA controller onboard (in addition to the Z77 chipset SATA controller) providing extra 2 SATA ports. SSD disks work fine with "PRO" version when connected to the native SATA ports as well as to the ports provided by extra SATA controller, so this does not look like a hardware issue. As far as I can tell, there's something changed in the kernel while going from 3.2 to 3.5, that affects the detection of onboard SATA controller for Asus P8*77 motherboards, that screws up the write speed for SSD drives. Could anyone shed some light on how to fix this issue or, possibly, give a pointer to a more suitable place to ask this question?

    Read the article

  • Java Spotlight Episode 102: Freescale on Embedded Java and Java Embedded @ JavaOne

    - by Roger Brinkley
    An interview with Michael O'Donnell of Freescale on Embedded Java and Embedded Java @ JavaOne. Part of this podcast was recorded live at the JavaOne 2012 Glassfish Party at the Thirsty Bear. Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast in iTunes. Show Notes News Oracle Java ME Embedded 3.2 Java Embedded Server 7.0 Events Oct 3-4, Java Embedded @ JavaONE, San Francisco Oct 15-17, JAX London Oct 30-Nov 1, Arm TechCon, Santa Clara Oct 22-23, Freescale Technology Forum - Japan, Tokyo Oct 31, JFall, Netherlands Nov 2-3, JMagreb, Morocco Nov 13-17, Devoxx, Belgium Feature InterviewFreescale is the global leader in embedded processing solutions, advancing the automotive, consumer, industrial and networking markets. From microprocessors and microcontrollers to sensors, analog ICs and connectivity – our technologies are the foundation to the innovations that make our world greener, safer, healthier and more connected. Michael O'Donnell, is the Director of Software Ecosystem Alliances. The upcoming Freescale Technology Forum - Japan in Tokyo, Japan is an excellent way for developers to learn more about Freescale and Java. What’s Cool Glassfish Party - 6th year Geek Bike Ride

    Read the article

  • Java EE 7 JSR update

    - by Heather VanCura
    Java EE 7 JSR update...in case you missed the last few entries with JSR updates, there are 8 Java EE 7 JSRs currently in JCP milestone review stages.  Your input is requested and needed! JSR 342: Early Draft Review 2– Java Platform, Enterprise Edition 7 (Java EE 7) Specification (review ends 30 November); Oracle JSR 107: Early Draft Review - JCACHE - Java Temporary Caching API (review ends 22 November); Greg Luck, Oracle JSR 236: Early Draft Review – Concurrency Utilities for Java EE (review ends 15 December); Oracle JSR 338: Early Draft Review 2 – Java Persistence 2 (review ends 30 November); Oracle JSR 346: Public Review – Contexts and Dependency Injection for Java EE 1.1 (EC ballot 4-17 December); RedHat JSR 352: Public Review – Batch Applications for the Java Platform (EC ballot 4-17 December); IBM JSR 349: Public Review – Bean Validation 1.1 (EC ballot 20- 26 November); RedHat JSR 339: Public Review – JAX-RS 2.0: The Java API for RESTful Web Services (Review period ended, EC ballot ends 26 November); Oracle  Also, check out the Java EE wiki with a specification and schedule update, including most recently, the addition of JSR 236.

    Read the article

  • How to translate formulas into form of natural language?

    - by Ricky
    I am recently working on a project aiming at evaluating whether an android app crashes or not. The evaluation process is 1.Collect the logs(which record the execution process of an app). 2.Generate formulas to predict the result (formulas is generated by GP) 3.Evaluate the logs by formulas Now I can produce formulas, but for convenience for users, I want to translate formulas into form of natural language and tell users why crash happened.(I think it looks like "inverse natural language processing".) To explain the idea more clearly, imagine you got a formula like this: 155 - count(onKeyDown) >= 148 It's obvious that if count(onKeyDown) 7, the result of "155 - count(onKeyDown) = 148" is false, so the log contains more than 7 onKeyDown event would be predicted "Failed". I want to show users that if onKeyDown event appears more than 7 times(155-148=7), this app will crash. However, the real formula is much more complicated, such as: (< !( ( SUM( {Att[17]}, Event[5]) <= MAX( {Att[7]}, Att[0] >= Att[11]) OR SUM( {Att[17]}, Event[5]) > MIN( {Att[12]}, 734 > Att[19]) ) OR count(Event[5]) != 1 ) > (< count(Att[4] = Att[3]) >= count(702 != Att[8]) + 348 / SUM( {Att[13]}, 641 < Att[12]) mod 587 - SUM( {Att[13]}, Att[10] < Att[15]) mod MAX( {Att[13]}, Event[2]) + 384 > count(Event[10]) != 1)) I tried to implement this function by C++, but it's quite difficult, here's the snippet of code I am working right now. Does anyone knows how to implement this function quickly?(maybe by some tools or research findings?)Any idea is welcomed: ) Thanks in advance.

    Read the article

< Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >