Search Results

Search found 51790 results on 2072 pages for 'long running'.

Page 31/2072 | < Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >

  • difference between C(gcc 4.3.2) , C 99 strict(gcc 4.3.2) , C++(gcc-4.0.0-8) ,C++(gcc-4.3.2)

    - by user1139048
    I have the following questions concerning the differences between the four options: What is the main difference between the four options? Which of the above support int64_t or long long without suffix LL. I want a data type of the range 2^63 - 1 If your answer to my second question is not C(gcc 4.3.2) , whether the code I write in C(gcc 4.3.2) for C language will be valid in rest of the three options or do I have to modify something, then what will be those modifications.

    Read the article

  • Long variable names

    - by RaouL
    Lets say i have a variable that contains the number of search engine names in a file, what would you name it? number_of_seach_engine_names search_engine_name_count num_search_engines engines engine_names other name? The first name describes what the variable contains precisely, but isn't it too long?, any advice for choosing variable names? especially how to shorten a name that is too long or what kind of abbreviations to use?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • strict string to int[long]

    - by baskin
    Do we have a standard way of converting a char* to int (or long) in a strict way, i.e. we should get proper result only if all characters are digits and can fit in an int (or long) -- some way by using strtol etc.. ? Thus "sbc45", "4590k", " 56", "56 ", should be all invalid using that function.

    Read the article

  • How to check on which port apache is running

    - by Mirage
    Is there any command to find out if apache is running or not. and on which port except by seeingports.conf files When i try netstat command then apaches does not appear in that. but when i use apache2 restart command then it says restart ok i don't know where it is running

    Read the article

  • BOINC permissions issue running as non-admin on Windows PC

    - by sunpech
    I installed BOINC (running World Community Grid) on a PC (running Vista) under an administrator's account. When logged in as a standard user, and BOINC is set to run as a screensaver, it fails to connect and run properly. Only when the program is run as an administrator, does it actually run in the standard user's account. What is the correct way to install and run BOINC for standard users (non-admin) on Windows? -- Not specific to Vista necessarily.

    Read the article

  • backup of KVM VM's running on Ubuntu 12.4.1 precise edition from a remote machine

    - by Dr. Death
    I am creating a library API which will take the backup of all the VM's running on KVM hypervisor. My VM's can be of any type. I am taking this backup from a remote machine and need to put the backup at remote server. I have KVM, Libvirt installed on my system. Some of my VM's are LVM based and some are normal VM's running on KVM. I research and found out an excellent perl script for taking the backup http://pof.eslack.org/2010/12/23/best-solution-to-fully-backup-kvm-virtual-machines/ but since I am developing this library in C++ I cannot use it however it has given me a good understanding of how it will work. One thing I didnot able to sort out is if my VM's are not created using virt-manager or are created using any other tool them virsh system list command does not give them in the list of running VM's however they are running perfectly on my KVM server. Is there a way to list these VM's in my system list anyhow? secondly, when I am taking backup from the remote machine I am getting out of my ssh mode as soon as my libvirt command finishes and for every command I need to ssh again, Is there a way that I do not need to ssh each and every time? I have already used the rsa key for ssh but when once my command finishes my control moves to the remote machine again and try to find out my source VM location in remote machine's local drives which in turn fails it. here is the main problem I am facing. also for the LVM based VM I am able to take the live backup but for non LVM based my machines are getting suspended and not been able to take the live backup. Since my library will work on the remote machine only I might not know the VM's configruation on the KVM server. so need to make it consistent for all the VM's. Please share any thing related to this issue so that I may be able to take the live backup of the non lvm vm's also. I'll update my working and any research findings time to time to all of you. Thanks in advance for your suggestions in these regards.

    Read the article

  • Performance issues concurrently running MySQL and MS SQL Sever

    - by pacifika
    We're considering installing MySQL on the same database server that has been running MS SQL Server. From my research there are no technical issues running both concurrently, but I am worried that the performance will be affected. Is by default SQL Server set up to use all available memory for example? What should I look out for? Thanks

    Read the article

  • Performance issues concurrently running MySQL and SQL Sever

    - by pacifika
    We're considering installing MySQL on the same database server that has been running SQL Server. From my research there are no technical issues running both concurrently, but I am worried that the performance will be affected. Is by default SQL Server set up to use all available memory for example? What should I look out for? Thanks

    Read the article

  • Running Montavista Linux kernel 2.6.21 on XEN

    - by Josh
    I've been assigned the task of getting our MontaVista Linux (2.6.21 kernel) running on Xen. We'll be running Xen in -hvm- mode. My Xen version is 3.4.0 (linux kernel 2.6.18) and am unable to run MontaVista Linux (kernel 2.6.21) in hvm mode. Does anyone have suggestions?

    Read the article

  • Running virtual machines: Linux vs Windows 7

    - by vikp
    Hi, I have tried running windows xp development virtual machine under windows 7 and the performance was dreadful. I'm considering installing Linux and running the virtual machine from the Linux, but I'm not sure whether I can expect any performance gains? It's a 2.4ghz core 2 duo machine with 4gb ram and 5400 rpm hdd. Can somebody please recommend very cut down version of linux that can run VMWare player and isn't resource hungry? Thank you

    Read the article

  • Multiple SSL Certificates Running on Mac OS X 10.6

    - by frodosghost.mp
    I have been running into walls with this for a while, so I posted at stackoverflow, and I was pointed over here... I am attempting to setup multiple IP addresses on Snow Leopard so that I can develop with SSL certificates. I am running XAMPP - I don't know if that is the problem, but I guess I would run into the same problems, considering the built in apache is turned off. So first up I looked into starting up the IPs on start up. I got up an running with a new StartupItem that runs correctly, because I can ping the ip address: ping 127.0.0.2 ping 127.0.0.1 And both of them work. So now I have IP addresses, which as you may know are not standard on OSx. I edited the /etc/hosts file to include the new sites too: 127.0.0.1 site1.local 127.0.0.2 site2.local I had already changed the httpd.conf to use the httpd-vhosts.conf - because I had a few sites running on the one IP address. I have edited the vhosts file so a site looks like this: <VirtualHost 127.0.0.1:80> DocumentRoot "/Users/jim/Documents/Projects/site1/web" ServerName site1.local <Directory "/Users/jim/Documents/Projects/site1"> Order deny,allow Deny from All Allow from 127.0.0.1 AllowOverride All </Directory> </VirtualHost> <VirtualHost 127.0.0.1:443> DocumentRoot "/Users/jim/Documents/Projects/site1/web" ServerName site1.local SSLEngine On SSLCertificateFile "/Applications/XAMPP/etc/ssl-certs/myssl.crt" SSLCertificateKeyFile "/Applications/XAMPP/etc/ssl-certs/myssl.key" SetEnvIf User-Agent ".*MSIE.*" nokeepalive ssl-unclean-shutdown <Directory "/Users/jim/Documents/Projects/site1"> Order deny,allow Deny from All Allow from 127.0.0.1 AllowOverride All </Directory> </VirtualHost> In the above code, you can change the 1's to 2's and it is the setup for the second site. They do use the same certificate, which is why they are on different IP addresses. I also included the NameVirtualHost information at the top of the file: NameVirtualHost 127.0.0.1:80 NameVirtualHost 127.0.0.2:80 NameVirtualHost 127.0.0.1:443 NameVirtualHost 127.0.0.2:443 I can ping site1.local and site2.local. I can use telnet ( telnet site2.local 80 ) to get into both sites. But in Safari I can only get to the first site1.local - navigating to site2.local gives me either the localhost main page (which is included in the vhosts) or gives me a Access forbidden!. I am usure what to do, any suggestions would be awesome.

    Read the article

  • Running Hermes Anti-Spam Proxy Alongside Exchange 2003

    - by JohnyD
    I'm looking to implement an anti-spam solution to pre-process email destined for my Exchange 2003 server. I am interested in trying out the Hermes Anti-Spam Proxy product (the price is right) and was wondering if anyone has had any experience in running this alongside their Exchange installation (same physical box). The server is a Win2K3 box running a single core P4 D 930 @ 3GHz with 3 gigs of memory. Thank you.

    Read the article

  • Windows running service as "system" when log on as is "user"

    - by danspants
    I have an apache service that is running as "SYSTEM", however the log on as settings are configured to run as my user account. The windows task manager claims that I am the user name associated with the service when it's running, however I had the apache service call a python script which indicates that the user is "SYSTEM. Any ideas on how to fix this? I've reinstalled 3 times and once with a newer version.

    Read the article

  • Running multiple versions of Firefox

    - by nicole
    I've been reading this: http://support.mozilla.org/en-US/questions/797010#answer-193690 But it looks like it only applies to running multiple versions of Firefox when it's Firefox 4. I need to run Firefox but it seems like a lot of my clients are still running versions of Firefox 3 (is this an operating system issue? Doesn't Firefox auto-update?) so I need to run 3 plus the latest version to troubleshoot some css issues...

    Read the article

  • Multiple SSL Certificates Running on Mac OS X 10.6

    I have been running into walls with this for a while, so I posted at stackoverflow, and I was pointed over here... I am attempting to setup multiple IP addresses on Snow Leopard so that I can develop with SSL certificates. I am running XAMPP - I don't know if that is the problem, but I guess I would run into the same problems, considering the built in apache is turned off. So first up I looked into starting up the IPs on start up. I got up an running with a new StartupItem that runs correctly, because I can ping the ip address: ping 127.0.0.2 ping 127.0.0.1 And both of them work. So now I have IP addresses, which as you may know are not standard on OSx. I edited the /etc/hosts file to include the new sites too: 127.0.0.1 site1.local 127.0.0.2 site2.local I had already changed the httpd.conf to use the httpd-vhosts.conf - because I had a few sites running on the one IP address. I have edited the vhosts file so a site looks like this: <VirtualHost 127.0.0.1:80> DocumentRoot "/Users/jim/Documents/Projects/site1/web" ServerName site1.local <Directory "/Users/jim/Documents/Projects/site1"> Order deny,allow Deny from All Allow from 127.0.0.1 AllowOverride All </Directory> </VirtualHost> <VirtualHost 127.0.0.1:443> DocumentRoot "/Users/jim/Documents/Projects/site1/web" ServerName site1.local SSLEngine On SSLCertificateFile "/Applications/XAMPP/etc/ssl-certs/myssl.crt" SSLCertificateKeyFile "/Applications/XAMPP/etc/ssl-certs/myssl.key" SetEnvIf User-Agent ".*MSIE.*" nokeepalive ssl-unclean-shutdown <Directory "/Users/jim/Documents/Projects/site1"> Order deny,allow Deny from All Allow from 127.0.0.1 AllowOverride All </Directory> </VirtualHost> In the above code, you can change the 1's to 2's and it is the setup for the second site. They do use the same certificate, which is why they are on different IP addresses. I also included the NameVirtualHost information at the top of the file: NameVirtualHost 127.0.0.1:80 NameVirtualHost 127.0.0.2:80 NameVirtualHost 127.0.0.1:443 NameVirtualHost 127.0.0.2:443 I can ping site1.local and site2.local. I can use telnet ( telnet site2.local 80 ) to get into both sites. But in Safari I can only get to the first site1.local - navigating to site2.local gives me either the localhost main page (which is included in the vhosts) or gives me a Access forbidden!. I am usure what to do, any suggestions would be awesome.

    Read the article

  • Running localhost webapp projects under domain name using fiddler2

    - by user01
    I have a Tomcat server running on my local dev machine(running Windows8) & I use fiddler2 to assign an alias to localhost as my domain name (www.mydomainName.com), so my application webpages open in the browser like this: http://www.mydomainName.com/myAppName/welcome.html instead of http://localhost:8080/myAppName/welcome.html But I want to my webapp pages urls to omit 'myAppName' & be something like : http://www.mydomainName.com/welcome.html How could I configure to do this ?

    Read the article

  • Xubuntu Running Slower than windows with constant freezing

    - by Joseph
    So I switched my computer to Ubuntu after some issues with Windows, then switched the GUI to Xubuntu after I noticed Ubuntu and Unity were painfully slow. I'm running an i5 with 8 gigs of ram and I still experience at least one full freeze (where I can't do anything and have to unplug) per week. REISUB does nothing and never has. I am constantly running Virtualbox because I still need Windows. Any thoughts to prevent this annoying freezing?

    Read the article

  • What is the difference between running a Windows service vs. running through shell?

    - by Zack
    I am trying to troubleshoot an issue on a Windows 2008 server where running attempting to connect to a "Timberline Data Source" ODBC driver crashes if the call is in a "service" context, but succeeds if the call is initiated manually in a Remote Desktop session. I have set the service to run as my user. I'm wondering if, all else being equal (user, machine, etc), are there any fundamental security/environment differences between running a process as a service vs manually? --- Implementation Details --- In case it is helpful for anyone, I had a system that started as an attempt to connect to a Timberline Database using ODBC and a Python CGI script called via IIS 7. The script itself works fine, however, as soon as I attempt to perform the ODBC connect function, the script crashes without throwing an exception. The script was able to connect fine when executed via command line. The same thing happened when using a C#/.net service, attempting to run via Apache, Windows Scheduler or even a 3rd party scheduling tool. With the last option (the 3rd party scheduling tool, pycron) I set the service up log in as my user and had the same issue (I confirmed via Task Manager that the process running user was, in fact, me). It just doesn't make sense to me why a service, which should be running as my user, appears to still be operating in a different security context or environment. Also, if it's important, the Timberline database is referenced by computer name on the network ("\\timberline-server\Timberline Office\Accounts\AT" or something to that effect) I also realized that, as Joel pointed out, the server DOES have a mapped drive ("Y:" which is mapped to "\\timberline-server\Timberline Office") The DSN is set up at the "System DSN" level which, according to the ODBC Administration Tool, means that the DSN is available to users and services Since I'm not allowed to answer this question yet, I'll post the solution that I arrived on: As Joel Coel mentioned, there actually was a mapped drive scenario. I didn't realize this because the DSN specified a path using UNC. However, it seems as though the actual Timberline Driver referred to a mapped drive. Since services don't start with the mapped drive, I was forced to add the drive mapping code into my service. Since it was written in python, I used code from a Stackoverflow answer that was able to map the drive on the fly.

    Read the article

< Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >