Search Results

Search found 11644 results on 466 pages for 'column defaults'.

Page 315/466 | < Previous Page | 311 312 313 314 315 316 317 318 319 320 321 322  | Next Page >

  • Create a term-document matrix from files

    - by Joe
    I have a set of files from example001.txt to example100.txt. Each file contains a list of keywords from a superset (the superset is available if we want it). So example001.txt might contain apple banana ... otherfruit I'd like to be able to process these files and produce something akin to a matrix so there is the list of examples* on the top row, the fruit down the side, and a '1' in a column if the fruit is in the file. An example might be... x example1 example2 example3 Apple 1 1 0 Babana 0 1 0 Coconut 0 1 1 Any idea how I might build some sort of command-line magic to put this together? I'm on OSX and happy with perl or python...

    Read the article

  • How can I turn off calculated columns in an Excel table from a macro using VBA?

    - by user41293
    I am working on a macro that inserts formulas into a cell in an Excel table. The Excel table does the automatic filling of columns and fills all the cells in that column with the formula, but all I want is one cell to have the formula. I cannot just turn off automatic formula for tables as I need to have other people use this worksheet on their systems. Is there a way to turn off the automatic filling of formulas in a table using VBA in a macro? It just needs to be temporary: I just want to turn it off, put in my formulas, then turn it back on.

    Read the article

  • Cant Add Columns to a AD Task pad except for the top level of the domain

    - by Darktux
    We are working on Active Directory taskpads application for user management in our organization and facing stange issue. When we create a taskpad, and when we are at top level of the domain, i can click view - Add/Remove Columns and add "Pre Windows Name" (and lots of other properties) to the taskpad as columns, but when i just go 1 level down , i can only see "Operating System" and "Service Pack" ; why is it happening , isnt "Domain Admins" supposed to god access to all the things in AD domain , atleast of objects they own? It is important to have "Pre Windows 2000" Name as a column begause with out that our "Shell Command" task wont show up in taskpads, since its bound to parameter "Col<9" (which is pre qindows name). Please do let me know if any additions questions to clarify my problem.

    Read the article

  • In Excel, how to group data by date, and then do operations on the data?

    - by Bicou
    Hi, I have Excel 2003. My data is like this: 01/10/2010 0.99 02/10/2010 1.49 02/10/2010 0.99 02/10/2010 0.99 02/10/2010 0.99 03/10/2010 1.49 03/10/2010 1.49 03/10/2010 0.99 etc. In fact it is a list of sales every day. I want to have something like this: 01/10/2010 0.99 02/10/2010 4.46 03/10/2010 3.97 I want to group by date, and sum the column B. I'd like to see the evolution of the sales over time, and display a nice graph about that. I have managed to create pivot tables that almost do the job: they list the number of 0.99 and 1.49 each day, but I can't find a way to simply sum everything and group by date. Thanks for reading.

    Read the article

  • excel autocomplete combo-box with on-selection event

    - by IttayD
    Hi, I have an excel sheet for groceries. One column is the name, another is whether to buy it or not (checkbox) and another is the amount. I'd like to have a widget in the top row so that I start typing an item's name and it shows a list of matching items that I can select from, or if I continue to type and there's only one item, completes its name. When the last item is selected, other widgets show the amount, which I can edit and clicking 'check' will check the item in the list. I know this is kind of very specific, but am hoping someone can at least get me started. Thank you, Ittay

    Read the article

  • How to stop Excel Treating US dates as UK dates?

    - by deworde
    I'm in the UK, I've got a problem where I've got a list of dates supplied in US format. Excel seems to treat the ones that are valid in both formats as UK dates, (e.g. 03/01/2012 becomes 3rd of January rather that 1st March), and treat the ones that aren't valid UK dates (e.g. 03/13/2012) as basic text. I assume this choice is something to do with my regional settings. What I want is the system to recognise that this column of text is supplied in US date format, and convert it into the underlying date representation for calculations. How do I do this?

    Read the article

  • PostgreSQL, update existing rows with pg_restore

    - by woky
    Hello. I need to sync two PostgreSQL databases (some tables from development db to production db) sometimes. So I came up with this script: [...] pg_dump -a -F tar -t table1 -t table2 -U user1 dbname1 | \ pg_restore -a -U user2 -d dbname2 [...] The problem is that this works just for newly added rows. When I edit non-PK column I get constraint error and row isn't updated. For each dumped row I need to check if it exists in destination database (by PK) and if so delete it before INSERT/COPY. Thanks for your advice. (Previously posted on stackoverflow.com, but IMHO this is better place for this question).

    Read the article

  • Average Difference and Direction Between Values in Excel with Blanks

    - by 114
    I have a sheet that looks something like this: Sheet 1 1 2 3 4 5 6 7 8 9 10 11 1 6 2 3 5 3 4 2 4 9 4 5 6 4 6 6 7 5 3 3 3 10 8 4 8 8 9 4 11 12 12 6 10 11 8 5 5 4 9 4 7 6 What I would like to be able to do is find the average difference and direction between values in each column. For example, the first 4 rows would look like: Average Difference # + Movements # -Movements 1 2 2 1 0 3 4 (2+5+5)/3 2 1 Blanks represent N/A values due to insufficient information, and differences are calculated successively i.e. col2-col1, col3-col2, col4-col3 If I just take the differences and make a duplicate table with the formula =C2-B2 copied across issues arise whenever there is a blank space between two values or at the beginning of the row. Is there an easy way to fix this or another way to do this that I might be missing?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Set an Excel cell's color based on multiple other cells' colors

    - by Lord Torgamus
    I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

    Read the article

  • function to org-sort by three (3) criteria: due date / priority / title

    - by lawlist
    Is anyone aware of an org-sort function / modification that can refile / organize a group of TODO so that it sorts them by three (3) criteria: first sort by due date, second sort by priority, and third sort by by title of the task? EDIT: If anyone can please help me to modify this so that undated TODO are sorted last, that would be greatly appreciated -- at the present time, undated TODO are not being sorted: ;; multiple sort (defun org-sort-multi (&rest sort-types) "Multiple sorts on a certain level of an outline tree, or plain list items. SORT-TYPES is a list where each entry is either a character or a cons pair (BOOL . CHAR), where BOOL is whether or not to sort case-sensitively, and CHAR is one of the characters defined in `org-sort-entries-or-items'. Entries are applied in back to front order. Example: To sort first by TODO status, then by priority, then by date, then alphabetically (case-sensitive) use the following call: (org-sort-multi '(?d ?p ?t (t . ?a)))" (interactive) (dolist (x (nreverse sort-types)) (when (char-valid-p x) (setq x (cons nil x))) (condition-case nil (org-sort-entries (car x) (cdr x)) (error nil)))) ;; sort current level (defun lawlist-sort (&rest sort-types) "Sort the current org level. SORT-TYPES is a list where each entry is either a character or a cons pair (BOOL . CHAR), where BOOL is whether or not to sort case-sensitively, and CHAR is one of the characters defined in `org-sort-entries-or-items'. Entries are applied in back to front order. Defaults to \"?o ?p\" which is sorted by TODO status, then by priority" (interactive) (when (equal mode-name "Org") (let ((sort-types (or sort-types (if (or (org-entry-get nil "TODO") (org-entry-get nil "PRIORITY")) '(?d ?t ?p) ;; date, time, priority '((nil . ?a)))))) (save-excursion (outline-up-heading 1) (let ((start (point)) end) (while (and (not (bobp)) (not (eobp)) (<= (point) start)) (condition-case nil (outline-forward-same-level 1) (error (outline-up-heading 1)))) (unless (> (point) start) (goto-char (point-max))) (setq end (point)) (goto-char start) (apply 'org-sort-multi sort-types) (goto-char end) (when (eobp) (forward-line -1)) (when (looking-at "^\\s-*$") ;; (delete-line) ) (goto-char start) ;; (dotimes (x ) (org-cycle)) )))))

    Read the article

  • Windows 7 Enterprise, Service Pack 1. Software MS Office Excel 2010

    - by user327560
    In Excel I understand there is no mechanism to customise & re-label the Rows & Columns (i.e. Renaming Col. A to some text like "Item Number" and so on. My question is regarding if it's possible to start Row Numbering at zero, or to determine a pre-allocated number of rows which contain my Headers, and then the first Row with the detail is infact seen as Row 1? Reason for question is I work multiple INternational Projects and we use Excel to trsack alot of activities & issues. Oddly, many people will refer to, for example "Point 7"... Some people mean the ID 7 (which I have the first Column dedicated to ID Number), some mean Excel Row 7, which infact could be really ID 3, or 4 from Col. A.... Any easy way or workaround to just use the Excel Row Numbers but select from when Row 1 is counted?

    Read the article

  • How can I create matrices of data in Excel?

    - by sandeep
    I want to create a 4*4 matrix in excel 2007 by taking three or more columns or conditions for example Column index Row index Name 1 2 x 2 3 y 3 4 z 4 1 p this is how data looks and i want it for 1*1 cell as p and 1*2 cell as x and so on. and I want out put as follows matrix 1 2 3 4 1 p x y z 2 p x y z 3 p x y z 4 p x y z and I have very huge data like this some times the matrix size goes up to 60*60 also.

    Read the article

  • Real RAM latency

    - by user32569
    Hi, very quick question. When I look for RAM timing, I got 2 different explanations on what is CAS latency. First states, its the time after command to read has been issued from CPU and data are send to data bus. Second says its time betwen column in memory layout has been activated. So, where is the truth? I mean, when I want to know total RAM latenci, in case 1, ot would be just CAS times one clock time. In second case, it would be CAS+other things like RAstoCAS and so times one clock time. Thanks.

    Read the article

  • TB3.0.10: Messages being sent back to me

    - by punkinette64
    Hello, I don't know if this will make any sense to you; but here goes. When I send an email and I get a response, more often than not, in the 'to:' is my email address. However, my email address also ends up in the 'from' column.The 'reply-from' address is nowhere to be found;so I don't have any address with which I can send my reply, as both of them have just my email address. What am I doing wrong here? Is there some set-up in my TOOLOPTIONS set-up incorrectly? The set-up in OPTIONS is pretty difficult to understand and it doesn't offer any 'to' or 'reply-from' choices. This is critical because I just cannot answer my emails because there is no one I can send a reply to. Please, please try to help me. If you have the answer, please email me at: [email protected] Thank you. Blessings. Shiloh

    Read the article

  • Vim Misbehaving

    - by zchtodd
    I'm not sure what changed, but lately Vim has been driving me nuts. Whenever I try to do a column mode insert, vim takes my current character and adds to the last character I inserted. For example, the first time I do a block comment by inserting # on multiple lines, it works fine. The next time, however, I end up with ## inserted on every line, and the problem just compounds from there. To do this, I'm hitting Ctrl-V, down or up arrow, Shift-I, #, and then Esc. This worked for months, but now it seems to be pasting extra stuff in. I've tried disabling all .vimrc files, but the behavior remains the same. Any ideas?

    Read the article

  • How to prevent Excel rounding numbers or adding redundant 0's?

    - by Highly Irregular
    I have a column of numbers that appear like this: but the actual value of the shown cell is 20130.153334 Other values have a different number of decimal places. I don't want to add redundant 0's, so I can't just specify a particular number of decimal places to display. I really just want to treat the values as text. I have already changed the format of the cell to Text, as the description for Text is: "Text format cells are treated as text even when a number is in the cell. The cell is displayed exactly as entered.". However, it clearly isn't being displayed exactly as entered! Strangely, if I hit F2 on the cell to go into edit mode, then hit enter, it is then displayed correctly. I can't do this manually for 2000+ records though! How can I prevent the numbers being rounded?

    Read the article

  • Hide/Unhide rows based on more than one cell value

    - by Mike
    Please help me I am using the following code to hide rows if cell values are 0: Private Sub Worksheet_Calculate() Dim LastRow As Long, c As Range Application.EnableEvents = False LastRow = Cells(Cells.Rows.Count, "I").End(xlUp).Row On Error Resume Next For Each c In Range("I9:I48") If c.Value = 0 Then c.EntireRow.Hidden = True ElseIf c.Value > 0 Then c.EntireRow.Hidden = False End If Next On Error GoTo 0 Application.EnableEvents = True End Sub It works perfectly, but I would like for the code to also check column K (the same range K9:K48) if both cells in a row are 0 then the row must be hidden. How can I change the code to do this?

    Read the article

  • How does the "Full Control" permission differ from manually giving all other permissions?

    - by Lord Torgamus
    On Windows Server 2003, and some other versions of Windows, the Properties > Security tab of a folder's or file's context menu provides "Allow" and "Deny" options for "Full Control," "Modify," "Read" and other permissions (graphic provided). After clicking "Full Control," all boxes in the column — except for "Special Permissions" — get automatically checked. What's the difference between checking "Full Control" and just checking all the other boxes individually? Are there hidden/advanced permissions toggled by "Full Control" that aren't listed in the main permissions window? Is "Full Control" just a convenience shortcut?

    Read the article

  • How can i lock images to a cell in excel 2010

    - by Jamie
    Ok, so i am using microsoft excel 2010 and have a set up currently where i have 2 views expanded and deflated using the Group or +/- function. My problem is that ui have images on the workbook too. The images are over the cells which are to be "hidden" when the - button is pressed and i would like the images to disappear with them. This is not curently happening instead they are moving to the next visible cell. I have included an example below incase i wasn't clear. I wish to hide Columns M:AU and the images are in various cells suchas N5 and O5. When i colapse (hide) the column range all of the images move to "AV5" the next row along that isn't hidden. This means the workbooks is looking messy when colapsed which is the oposite of what i was trying to do. Can anyone advise on a way around this?

    Read the article

  • Formula in table header cells

    - by Cylindric
    I have a table in Excel 2007 that I want to summarise, in a similar fashion to a Pivot Table, but for various reasons I can't use a pivot table. I like the "Format as table" features of sort and filter buttons, automatic formatting etc, so have used that to create a simple table: A B C N +-----------+------------+------------+-------+------------+ 1 | | 01/01/2010 | 01/02/2010 | ... | 01/12/2010 | +-----------+------------+------------+-------+------------+ 2 | CategoryA | 15 | 545 | | 634 | 3 | CategoryB | 32 | 332 | | 231 | 4 | CategoryC | 5 | 234 | | 644 | | ... | | | | | 27 | CategoryZ | 2 | 123 | | 64 | +-----------+------------+------------+-------+------------+ The numbers are retrieved from a "back-end" pivot table using GETPIVOTDATA(). All that works fine. Now, the problem is that I can't seem to use formulas for my column headings in these new "smart" tables - they are converted to text or just broken. For example if in B1 I put NOW(), I don't get the date, I get 00/01/1900. Is there any way of getting a formula to work in the auto tables? Or do I have to use standard tables and manually alternate-colour my rows etc?

    Read the article

  • Matching a smaller piece of text in a local variable to a larger piece of text that I have pulled in a query

    - by Hoser
    I think this is a simple question, but google searching for 30 minutes was mostly wasted time as all I can find is matching a variable to a 'randompieceoftext'. Anyways, suppose I have a local variable called @ServerName. This server name will be something like CCPWIQAUL. I need to match this server name to various path names, which is of the form: serverName.something.somethingelse.com These path names are pulled from a database, and will be in the column vManagedEntity.Path How do I do something like this? Is @ServerName is IN vManagedEntity.Path?

    Read the article

  • Thunderbird 3.0 - how to prevent new message indicator from clearing?

    - by Joe Casadonte
    I just installed Thunderbird 3.0 and there are a few things driving me batty. When new email is delivered it has a faint star to the left of the subject (this is different than the new star column thing). In the old days (i.e. last week) the new message indicator wouldn't go away until I read the message or left the folder and returned. Now, as soon as I do anything with any email message, all new message indicators are cleared. How can I go back to the old behavior?

    Read the article

  • Sharepoint managed Properties

    - by paulie
    Originally posted on StackOverflow, and edited for clarity I have a custom Content Type inside a list that has over 30 items (Which were uploaded via DockIt), and I have added several "managed properties" to the "crawled properties", in the SSP. All of them work except 1. The column "Synopsis" is a multiline field with no limit on it's length. It appears as a crawled property "Synopsis", and is mapped to a managed property 'asynop'. On the 'Advanced Search Page', it is added as a property and searchable, however it only returns a some matching records (if any). I manually created an entry, ran the crawl and was able to search for it. I edited an existing entry, ran the crawl (full and incremental), and it still only returned the manually entered entry. If I entered the search term in the Search box directly "asynop:fatigue", then all the correct results appear. Why is this happening? And could it please stop?

    Read the article

  • can I use @reboot in cron.d files?

    - by fschwiet
    I want to run a job with cron on reboot as a particular user. I have been able to do this successfully using crontab to write to /var/spool/cron/crontabs/username with something like: @reboot ./run.sh >>~/tracefile 2>&1 However, I want to use /etc/cron.d/filename. Cron jobs in this file require an extra column to indicate what user runs, so I use: @reboot wwwuser ./run.sh >>~/tracefile 2>&1 This doesn't seem to work. Should I be able to use @reboot with a username in a cron.d file?

    Read the article

< Previous Page | 311 312 313 314 315 316 317 318 319 320 321 322  | Next Page >