Search Results

Search found 29888 results on 1196 pages for 'line breaks'.

Page 315/1196 | < Previous Page | 311 312 313 314 315 316 317 318 319 320 321 322  | Next Page >

  • Algorithm to figure out appointment times?

    - by Rachel
    I have a weird situation where a client would like a script that automatically sets up thousands of appointments over several days. The tricky part is the appointments are for a variety of US time zones, and I need to take the consumer's local time zone into account when generating appointment dates and times for each record. Appointment Rules: Appointments should be set from 8AM to 8PM Eastern Standard Time, with breaks from 12P-2P and 4P-6P. This leaves a total of 8 hours per day available for setting appointments. Appointments should be scheduled 5 minutes apart. 8 hours of 5-minute intervals means 96 appointments per day. There will be 5 users at a time handling appointments. 96 appointments per day multiplied by 5 users equals 480, so the maximum number of appointments that can be set per day is 480. Now the tricky requirement: Appointments are restricted to 8am to 8pm in the consumer's local time zone. This means that the earliest time allowed for each appointment is different depending on the consumer's time zone: Eastern: 8A Central: 9A Mountain: 10A Pacific: 11A Alaska: 12P Hawaii or Undefined: 2P Arizona: 10A or 11A based on current Daylight Savings Time Assuming a data set can be several thousand records, and each record will contain a timezone value, is there an algorithm I could use to determine a Date and Time for every record that matches the rules above?

    Read the article

  • How to Detect Sprites in a SpriteSheet?

    - by IAE
    I'm currently writing a Sprite Sheet Unpacker such as Alferds Spritesheet Unpacker. Now, before this is sent to gamedev, this isn't necessarily about games. I would like to know how to detect a sprite within a spriitesheet, or more abstactly, a shape inside of an image. Given this sprite sheet: I want to detect and extract all individual sprites. I've followed the algorithm detailed in Alferd's Blog Post which goes like: Determine predominant color and dub it the BackgroundColor Iterate over each pixel and check ColorAtXY == BackgroundColor If false, we've found a sprite. Keep going right until we find a BackgroundColor again, backtrack one, go down and repeat until a BackgroundColor is reached. Create a box from location to ending location. Repeat this until all sprites are boxed up. Combined overlapping boxes (or within a very short distance) The resulting non-overlapping boxes should contain the sprite. This implementation is fine, especially for small sprite sheets. However, I find the performance too poor for larger sprite sheets and I would like to know what algorithms or techniques can be leveraged to increase the finding of sprites. A second implementation I considered, but have not tested yet, is to find the first pixel, then use a backtracking algorithm to find every connected pixel. This should find a contiguous sprite (breaks down if the sprite is something like an explosion where particles are no longer part of the main sprite). The cool thing is that I can immediately remove a detected sprite from the sprite sheet. Any other suggestions?

    Read the article

  • Can't use the hardware scissor any more, should I use the stencil buffer or manually clip sprites?

    - by Alex Ames
    I wrote a simple UI system for my game. There is a clip flag on my widgets that you can use to tell a widget to clip any children that try to draw outside their parent's box (for scrollboxes for example). The clip flag uses glScissor, which is fed an axis aligned rectangle. I just added arbitrary rotation and transformations to my widgets, so I can rotate or scale them however I want. Unfortunately, this breaks the scissor that I was using as now my clip rectangle might not be axis aligned. There are two ways I can think of to fix this: either by using the stencil buffer to define the drawable area, or by having a wrapper function around my sprite drawing function that will adjust the vertices and texture coords of the sprites being drawn based on the clipper on the top of a clipper stack. Of course, there may also be other options I can't think of (something fancy with shaders possibly?). I'm not sure which way to go at the moment. Changing the implementation of my scissor functions to use the stencil buffer probably requires the smallest change, but I'm not sure how much overhead that has compared to the coordinate adjusting or if the performance difference is even worth considering.

    Read the article

  • Colour coding of the status bar in SQL Server Management Studio - Oh dear

    - by simonsabin
    The new feature in SQL Server 2008 to have your query window status bar colour coded to the server you are on is great. Its a nice way to distinguish production from development servers. Unfortunately it was pointed out to me by a client recently that it doesn't always work. To me that sort of makes it pointless. Its a bit like having breaks that work some of the time. Are you going to place Russian roulette every time you execute the query. Whats more the colour doesn't change if you change the connection. So you can flip between dev and production servers but your status bar stays the colour you set for the dev server. It really annoys me to find features that sort of work. The reason I initially gave up on SQLPrompt was that it didn't work 100% of the time and for that time it didn't work I wasted so much time trying to get it to work I wasted more time than if I didn't have it. (I will say that was 2-3 years ago). If you would like to use this feature but aren't because of these features please vote on these bugs. https://connect.microsoft.com/SQLServer/feedback/details/504418/ssms-make-color-coding-of-query-windows-work-all-the-time https://connect.microsoft.com/SQLServer/feedback/details/361832/update-status-bar-colour-when-changing-connections  

    Read the article

  • Mobile BI Comes of Age

    - by rich.clayton(at)oracle.com
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} One of the hot topics in the Business Intelligence industry is mobility.  More specifically the question is how business can be transformed by the iPhone and the iPad.  In June 2003, Gartner predicted that Mobile BI would be obsolete and that the technology was headed for the 'trough of disillusionment'.  I agreed with them at that time.  Many vendors like MicroStrategy and Business Objects jumped into the fray attempting to show how PDA's like Palm Pilots could be integrated with BI.  Their investments resulted in interesting demos with no commercial traction.  Why, because wireless networks and mobile operating systems were primitive, immature and slow. In my opinion, Apple's iOS has changed everything in Mobile BI.  Yes Blackberry, Android and Symbian and all the rest have their place in the market but I believe that increasingly consumers (not IT departments) influence BI decision making processes.  Consumers are choosing the iPhone and the iPad. The number of iPads I see in business meetings now is staggering.  Some use it for email and note taking and others are starting to use corporate applications.  The possibilities for Mobile BI are countless and I would expect to see iPads enterprise-wide over the next few years.   These new devices will provide just-in-time access to critical business information.  Front-line managers interacting with customers, suppliers, patients or citizens will have information literally at their fingertips. I've experimented with several mobile BI tools.  They look cool but like their Executive Information System (EIS) predecessors of the 1990's these tools lack a backbone and a plausible integration strategy.  EIS was a viral technology in the early 1990's.  Executives from every industry and job function were showcasing their dashboards to fellow co-workers and colleagues at the country club.  Just like the iPad, every senior manager wanted one.  EIS wasn't a device however, it was a software application.   EIS quickly faded into the software sunset as it lacked integration with corporate information systems.  BI servers  replaced EIS because the technology focused on the heavy data lifting of integrating, normalizing, aggregating and managing large, complex data volumes.  The devices are here to stay. The cute stand-alone mobile BI tools, not so much. If all you're looking to do is put Excel files on your iPad, there are plenty of free tools on the market.  You'll look cool at your next management meeting but after a few weeks, the cool factor will fade away and you'll be wondering how you will ever maintain it.  If however you want secure, consistent, reliable information on your iPad, you need an integration strategy and a way to model the data.  BI Server technologies like the Oracle BI Foundation is a market leading approach to tackle that issue. I liken the BI mobility frenzy to buying classic cars.  Classic Cars have two buying groups - teenagers and middle-age folks looking to tinker.  Teenagers look at the pin-stripes and the paint job while middle-agers (like me)  kick the tires a bit and look under the hood to check out the quality and reliability of the engine.  Mobile BI tools sure look sexy but don't go very far without an engine and a transmission or an integration strategy. The strategic question in Mobile BI is can these startups build a motor and transmission faster than Oracle can re-paint the car?  Oracle has a great engine and a transmission that connects to all enterprise information assets.  We're working on the new paint job and are excited about the possibilities.  Just as vertical integration worked in the automotive business, it too works in the technology industry.

    Read the article

  • Recommendations for adjustable sit-stand workstations?

    - by Chris Phillips
    Recently, I've been feeling the discomfort of sitting at my desk all day long. I'm fairly active, stretch, and take regular breaks, but some days it's still pretty uncomfortable to sit all day long, whether in a nice chair or on an exercise ball. I would really like able to stand at my computer for part of the day. My current setup is a large desk with two 26" lcds and a 17" laptop. I don't mind if the laptop isn't adjustable, as I don't use it as regularly as the monitors. I would like to be able to fairly easily switch from a sitting position to a standing position and back again as necessary. I've been looking into adjustable height desks and stands and found that they tend to be either really expensive, or don't quite meet my needs. (For example, the Ergotron WorkFit-S Dual LCD workstation looks like the ideal feature set at a reasonable price, but won't fit with my monitors.) Any suggestions or thoughts? Update: fixed a typo. Thanks @RDL!

    Read the article

  • CodePlex Daily Summary for Monday, June 02, 2014

    CodePlex Daily Summary for Monday, June 02, 2014Popular ReleasesPortable Class Library for SQLite: Portable Class Library for SQLite - 3.8.4.4: This pull request from mattleibow addresses an issue with custom function creation (define functions in C# code and invoke them from SQLite as id they where regular SQL functions). Impact: Xamarin iOSTweetinvi a friendly Twitter C# API: Tweetinvi 0.9.3.x: Timelines- Added all the parameters available from the Timeline Endpoints in Tweetinvi. - This is available for HomeTimeline, UserTimeline, MentionsTimeline // Simple query var tweets = Timeline.GetHomeTimeline(); // Create a parameter for queries with specific parameters var timelineParameter = Timeline.GenerateHomeTimelineRequestParameter(); timelineParameter.ExcludeReplies = true; timelineParameter.TrimUser = true; var tweets = Timeline.GetHomeTimeline(timelineParameter); Tweets- Add mis...Sandcastle Help File Builder: Help File Builder and Tools v2014.5.31.0: General InformationIMPORTANT: On some systems, the content of the ZIP file is blocked and the installer may fail to run. Before extracting it, right click on the ZIP file, select Properties, and click on the Unblock button if it is present in the lower right corner of the General tab in the properties dialog. This release completes removal of the branding transformations and implements the new VS2013 presentation style that utilizes the new lightweight website format. Several breaking cha...Tooltip Web Preview: ToolTip Web Preview: Version 1.0Database Helper: Release 1.0.0.0: First Release of Database HelperCoMaSy: CoMaSy1.0.2: !Contact Management SystemImage View Slider: Image View Slider: This is a .NET component. We create this using VB.NET. Here you can use an Image Viewer with several properties to your application form. We wish somebody to improve freely. Try this out! Author : Steven Renaldo Antony Yustinus Arjuna Purnama Putra Andre Wijaya P Martin Lidau PBK GENAP 2014 - TI UKDWAspose for Apache POI: Missing Features of Apache POI WP - v 1.1: Release contain the Missing Features in Apache POI WP SDK in Comparison with Aspose.Words for dealing with Microsoft Word. What's New ?Following Examples: Insert Picture in Word Document Insert Comments Set Page Borders Mail Merge from XML Data Source Moving the Cursor Feedback and Suggestions Many more examples are yet to come here. Keep visiting us. Raise your queries and suggest more examples via Aspose Forums or via this social coding site.SEToolbox: 01.032.014 Release 1: Added fix when loading game Textures for icons causing 'Unable to read beyond the end of the stream'. Added new Resource Report, that displays all in game resources in a concise report. Added in temp directory cleaner, to keep excess files from building up. Fixed use of colors on the windows, to work better with desktop schemes. Adding base support for multilingual resources. This will allow loading of the Space Engineers resources to show localized names, and display localized date a...ClosedXML - The easy way to OpenXML: ClosedXML 0.71.2: More memory and performance improvements. Fixed an issue with pivot table field order.Vi-AIO SearchBar: Vi – AIO Search Bar: Version 1.0Top Verses ( Ayat Emas ): Binary Top Verses: This one is the bin folder of the component. the .dll component is inside.Traditional Calendar Component: Traditional Calender Converter: Duta Wacana Christian University This file containing Traditional Calendar Component and Demo Aplication that using Traditional Calendar Component. This component made with .NET Framework 4 and the programming language is C# .SQLSetupHelper: 1.0.0.0: First Stable Version of SQL SetupComposite Iconote: Composite Iconote: This is a composite has been made by Microsoft Visual Studio 2013. Requirement: To develop this composite or use this component in your application, your computer must have .NET framework 4.5 or newer.Magick.NET: Magick.NET 6.8.9.101: Magick.NET linked with ImageMagick 6.8.9.1. Breaking changes: - Int/short Set methods of WritablePixelCollection are now unsigned. - The Q16 build no longer uses HDRI, switch to the new Q16-HDRI build if you need HDRI.fnr.exe - Find And Replace Tool: 1.7: Bug fixes Refactored logic for encoding text values to command line to handle common edge cases where find/replace operation works in GUI but not in command line Fix for bug where selection in Encoding drop down was different when generating command line in some cases. It was reported in: https://findandreplace.codeplex.com/workitem/34 Fix for "Backslash inserted before dot in replacement text" reported here: https://findandreplace.codeplex.com/discussions/541024 Fix for finding replacing...VG-Ripper & PG-Ripper: VG-Ripper 2.9.59: changes NEW: Added Support for 'GokoImage.com' links NEW: Added Support for 'ViperII.com' links NEW: Added Support for 'PixxxView.com' links NEW: Added Support for 'ImgRex.com' links NEW: Added Support for 'PixLiv.com' links NEW: Added Support for 'imgsee.me' links NEW: Added Support for 'ImgS.it' linksToolbox for Dynamics CRM 2011/2013: XrmToolBox (v1.2014.5.28): XrmToolbox improvement XrmToolBox updates (v1.2014.5.28)Fix connecting to a connection with custom authentication without saved password Tools improvement New tool!Solution Components Mover (v1.2014.5.22) Transfer solution components from one solution to another one Import/Export NN relationships (v1.2014.3.7) Allows you to import and export many to many relationships Tools updatesAttribute Bulk Updater (v1.2014.5.28) Audit Center (v1.2014.5.28) View Layout Replicator (v1.2014.5.28) Scrip...Microsoft Ajax Minifier: Microsoft Ajax Minifier 5.10: Fix for Issue #20875 - echo switch doesn't work for CSS CSS should honor the SASS source-file comments JS should allow multi-line comment directivesNew Projects[ISEN] Rendu de projet Naughty3Dogs - Pong3D: Pong3D est un jeu qui reprend le principe classique du Pong en le portant dans un environnement 3D à l'aide du langage c# et du moteur Unity3DBootstrap for MVC: Bootstrap for MVC.F. A. Q. - Najczesciej zadawane pytania: FAQForuMvc: Technifutur short projecthomework456: no.iStoody: Studies organize solution, available through app for Windows and Windows Phone.liaoliao: ???????????Price Tracker: Allows a user to track prices based on parsed emailsRoslynEval: RoslynRx Hub: Rx Hub provides server side computation which initiate by subscriber requestSharepoint Online AppCache Reset: We are an IT resource company providing Virtual IT services and custom and opensource programs for everyday needs. UnitConversionLib : Smart Unit Conversion Library in C#: Conversion of units, arithmetic operation and parsing quantities with their units on run time. Smart unit converter and conversion lib for physical quantities,

    Read the article

  • How do search engines handle hyphenated words?

    - by NinjaKC
    I am not sure my title fully explains what I mean. I thought this might be an interesting question. If I had a set of keywords, broken with a dash or 2, will search engines consider the dashed split keyword as maybe a full keyword? Say I have a site that sort of breaks words down, like the dictionary sites do. So a keyword for that page, might end up in the page, and / or the URL, as broken by dashes. Key-word = keyword Co-op-er-at-ive = cooperative Pho-to-gra-phy = Photography www.example.com/key-word/ www.example.com/co-op-er-at-ive/ www.example.com/pho-to-gra-phy/ I know search engines will consider a dash (at least Google) as a space, and understand it as multiple words. But in the English language, a dash can also break a word down (at least I think it can, can't it?), so will search engines also take this into consideration? I did a 'little' research, I Googled some words and placed random dashes, and it returned the words I searched for, but this could be considered a typo from the user on Google's search end, so really I am wondering if I can purposely put a dash in a keyword, and have the search engine spiders still catch that keyword as the real word without dashes? I've done a little Googling and looking here on Stackoverflow, but everything comes down to dashes for multiple words, not really the specific thing I'm trying to figure out. Hopefully that makes sense, I am not an expert in SEO, yet, but get the basics and have been playing, and this is just really a random question to satisfy my knowledge of playing :P

    Read the article

  • OOW 2012: Kings of Leon & Pearl Jam - Appreciation Event

    - by Mike Dietrich
    June 15, 1992 - that was actually the day when Pearl Jam played their first concert in Serenadenhof in my hometown, Nürnberg. Oups ... that's over 20 years ago ... So I was so happy to get a ticket to this year's OOW 2012 appreciation event on Treasure Island. Every year it amazes me over and over again how the organizers manage it logistically to bring almost 40,000 people to and back from the island. Food was ... I would say fairly ok ... and beer (as always) is not - actually even though I'm not a beer drinker I wouldn't call it beer.  Kings of Leon did start. I like them a lot and owe their 2008 album Only By Night. That was a good start to warm up the crowd. And then Pearl Jam took over - and ... wooooooow ... they are such a great live band. First of all as far as I understood they were donating the money they've got for that gig to an NGO. And Eddie Vedder's voice is simply striking ... I had shivers running down my spine. They played a good excerpt of their +20 years career closing down with Alive at the very end. It seemed to everybody that the band had real fun playing there - and it was sooooo good. Thanks a lot to the person who did organize me a ticket Catching my bus back to my hotel area down at Fisherman's Wharf worked well - but I must have fallen asleep 5 minutes after we've left the parking lot. The next thing I did recognize was the bus driver pushing the breaks at Northpoint. What a wonderful night ...

    Read the article

  • Why Is Vertical Resolution Monitor Resolution so Often a Multiple of 360?

    - by Jason Fitzpatrick
    Stare at a list of monitor resolutions long enough and you might notice a pattern: many of the vertical resolutions, especially those of gaming or multimedia displays, are multiples of 360 (720, 1080, 1440, etc.) But why exactly is this the case? Is it arbitrary or is there something more at work? Today’s Question & Answer session comes to us courtesy of SuperUser—a subdivision of Stack Exchange, a community-driven grouping of Q&A web sites. The Question SuperUser reader Trojandestroy recently noticed something about his display interface and needs answers: YouTube recently added 1440p functionality, and for the first time I realized that all (most?) vertical resolutions are multiples of 360. Is this just because the smallest common resolution is 480×360, and it’s convenient to use multiples? (Not doubting that multiples are convenient.) And/or was that the first viewable/conveniently sized resolution, so hardware (TVs, monitors, etc) grew with 360 in mind? Taking it further, why not have a square resolution? Or something else unusual? (Assuming it’s usual enough that it’s viewable). Is it merely a pleasing-the-eye situation? So why have the display be a multiple of 360? The Answer SuperUser contributor User26129 offers us not just an answer as to why the numerical pattern exists but a history of screen design in the process: Alright, there are a couple of questions and a lot of factors here. Resolutions are a really interesting field of psychooptics meeting marketing. First of all, why are the vertical resolutions on youtube multiples of 360. This is of course just arbitrary, there is no real reason this is the case. The reason is that resolution here is not the limiting factor for Youtube videos – bandwidth is. Youtube has to re-encode every video that is uploaded a couple of times, and tries to use as little re-encoding formats/bitrates/resolutions as possible to cover all the different use cases. For low-res mobile devices they have 360×240, for higher res mobile there’s 480p, and for the computer crowd there is 360p for 2xISDN/multiuser landlines, 720p for DSL and 1080p for higher speed internet. For a while there were some other codecs than h.264, but these are slowly being phased out with h.264 having essentially ‘won’ the format war and all computers being outfitted with hardware codecs for this. Now, there is some interesting psychooptics going on as well. As I said: resolution isn’t everything. 720p with really strong compression can and will look worse than 240p at a very high bitrate. But on the other side of the spectrum: throwing more bits at a certain resolution doesn’t magically make it better beyond some point. There is an optimum here, which of course depends on both resolution and codec. In general: the optimal bitrate is actually proportional to the resolution. So the next question is: what kind of resolution steps make sense? Apparently, people need about a 2x increase in resolution to really see (and prefer) a marked difference. Anything less than that and many people will simply not bother with the higher bitrates, they’d rather use their bandwidth for other stuff. This has been researched quite a long time ago and is the big reason why we went from 720×576 (415kpix) to 1280×720 (922kpix), and then again from 1280×720 to 1920×1080 (2MP). Stuff in between is not a viable optimization target. And again, 1440P is about 3.7MP, another ~2x increase over HD. You will see a difference there. 4K is the next step after that. Next up is that magical number of 360 vertical pixels. Actually, the magic number is 120 or 128. All resolutions are some kind of multiple of 120 pixels nowadays, back in the day they used to be multiples of 128. This is something that just grew out of LCD panel industry. LCD panels use what are called line drivers, little chips that sit on the sides of your LCD screen that control how bright each subpixel is. Because historically, for reasons I don’t really know for sure, probably memory constraints, these multiple-of-128 or multiple-of-120 resolutions already existed, the industry standard line drivers became drivers with 360 line outputs (1 per subpixel). If you would tear down your 1920×1080 screen, I would be putting money on there being 16 line drivers on the top/bottom and 9 on one of the sides. Oh hey, that’s 16:9. Guess how obvious that resolution choice was back when 16:9 was ‘invented’. Then there’s the issue of aspect ratio. This is really a completely different field of psychology, but it boils down to: historically, people have believed and measured that we have a sort of wide-screen view of the world. Naturally, people believed that the most natural representation of data on a screen would be in a wide-screen view, and this is where the great anamorphic revolution of the ’60s came from when films were shot in ever wider aspect ratios. Since then, this kind of knowledge has been refined and mostly debunked. Yes, we do have a wide-angle view, but the area where we can actually see sharply – the center of our vision – is fairly round. Slightly elliptical and squashed, but not really more than about 4:3 or 3:2. So for detailed viewing, for instance for reading text on a screen, you can utilize most of your detail vision by employing an almost-square screen, a bit like the screens up to the mid-2000s. However, again this is not how marketing took it. Computers in ye olden days were used mostly for productivity and detailed work, but as they commoditized and as the computer as media consumption device evolved, people didn’t necessarily use their computer for work most of the time. They used it to watch media content: movies, television series and photos. And for that kind of viewing, you get the most ‘immersion factor’ if the screen fills as much of your vision (including your peripheral vision) as possible. Which means widescreen. But there’s more marketing still. When detail work was still an important factor, people cared about resolution. As many pixels as possible on the screen. SGI was selling almost-4K CRTs! The most optimal way to get the maximum amount of pixels out of a glass substrate is to cut it as square as possible. 1:1 or 4:3 screens have the most pixels per diagonal inch. But with displays becoming more consumery, inch-size became more important, not amount of pixels. And this is a completely different optimization target. To get the most diagonal inches out of a substrate, you want to make the screen as wide as possible. First we got 16:10, then 16:9 and there have been moderately successful panel manufacturers making 22:9 and 2:1 screens (like Philips). Even though pixel density and absolute resolution went down for a couple of years, inch-sizes went up and that’s what sold. Why buy a 19″ 1280×1024 when you can buy a 21″ 1366×768? Eh… I think that about covers all the major aspects here. There’s more of course; bandwidth limits of HDMI, DVI, DP and of course VGA played a role, and if you go back to the pre-2000s, graphics memory, in-computer bandwdith and simply the limits of commercially available RAMDACs played an important role. But for today’s considerations, this is about all you need to know. Have something to add to the explanation? Sound off in the the comments. Want to read more answers from other tech-savvy Stack Exchange users? Check out the full discussion thread here.     

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • Bomberman clone, how to do bombs?

    - by hustlerinc
    I'm playing around with a bomberman clone to learn game-developement. So far I've done tiles, movement, collision detection, and item pickup. I also have pseudo bombplacing (just graphics and collision, no real functionality). I've made a jsFiddle of the game with the functionality I currently have. The code in the fiddle is very ugly though. Scroll past the map and you find how I place bombs. Anyway, what I would like to do is an object, that has the general information about bombs like: function Bomb(){ this.radius = player.bombRadius; this.placeBomb = function (){ if(player.bombs != 0){ // place bomb } } this.explosion = function (){ // Explosion } } I don't really know how to fit it into the code though. Everytime I place a bomb, do I do var bomb = new Bomb(); or do i need to constantly have that in the script to be able to access it. How does the bomb do damage? Is it as simple as doing X,Y in all directions until radius runs out or object stops it? Can I use something like setTimeout(bomb.explosion, 3000) as timer? Any help is appreciated, be it a simple explanation of the theory or code examples based on the fiddle. When I tried the object way it breaks the code.

    Read the article

  • Following my passion

    - by Maria Sandu
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-ansi-language:RO;} Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-ansi-language:RO;} Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-ansi-language:RO;} What makes you go the extra mile? What makes you move forward and be ambitious? My name is Alin Gheorghe and I am currently working as a Contracts Administrator in the Shared Service Centre in Bucharest, Romania. I have graduated from the Political Science Faculty of the National School of Political and Administrative Studies here in Bucharest and I am currently undergoing a Master Program on Security and Diplomacy at the same university. Although I have been working a full time job here at Oracle since January 2011 and also going to school after work, I am going to tell you how I spend my spare time and about my passion. I always thought that if one doesn’t have something that he would consider a passion it’s always just a matter of time until he would discover one. Looking back, I can tell you that I discovered mine when I was 14 years old and I remember watching a football game when suddenly I became fascinated by the “man in black” that all football players obeyed during the match. That year I attended and promoted a referee course within my local referee committee and about 6 months later I was delegated to my first official game at youth tournament. Almost 10 years have passed since then and I can tell you that I very much love and appreciate this activity that I have spent doing, each and every weekend, 9 months every year, acquiring more than 600 official games until now. And even if not having a real free weekend or holiday might be sound very consuming, I can say that having something I am passionate about helps me to keep myself balanced and happy while giving me an option to channel any stress or anxiety I may feel. I think it’s important to have something of your own besides work that you spend time and effort on. Whether it’s painting, writing or a sport, having a passion can only have a positive effect on your life. And as every extra thing, it’s not always easy to follow your passion, but is it worth it? Speaking from my own experience I am sure it is, and here are some tips and tricks I constantly use not to give up on my passion: Normal 0 false false false EN-US X-NONE X-NONE -"/ /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-ansi-language:RO;} No matter how much time you spend at work and how much credit you get for that, it will always be the passion related achievements that will comfort you more and boost your self esteem and nothing compares to that feeling you get. I always try to keep this in mind so that each time I think about giving up I get even more ambitious to move forward. Everybody can just do what they are paid to do or what they are requested to do at work but not everybody can go that extra mile when it comes to following their passion and putting in extra work for that. By exercising this constantly you get used to also applying this attitude on the work related tasks. It takes accurate planning, anticipation and forecasting in order to combine your work with your passion. Therefore having a full schedule and keeping up with it will only help develop and exercise such skills and also will prove to you that you are up to such a challenge. I always keep in mind as a final goal that if you get very good at your passion you can actually start earning from it. And I think that is the ultimate level when you can say that you make a living by doing exactly what you are passionate about. In conclusion, by taking the easy way not only do you miss out on something nice, but life’s priceless rewards are usually given by those things that you actually believe in and know how to stand up for over time.

    Read the article

  • Automatic Appointment Conflict Resolution

    - by Thomas
    I'm trying to figure out an algorithm for resolving appointment times. I currently have a naive algorithm that pushes down conflicting appointments repeatedly, until there are no more appointments. # The appointment list is always sorted on start time appointment_list = [ <Appointment: 10:00 -> 12:00>, <Appointment: 11:00 -> 12:30>, <Appointment: 13:00 -> 14:00>, <Appointment: 13:30 -> 14:30>, ] Constraints are that appointments: cannot be after 15:00 cannot be before 9:00 This is the naive algorithm for i, app in enumerate(appointment_list): for possible_conflict in appointment_list[i+1:]: if possible_conflict.start < app.end: difference = app.end - possible_conflict.start possible_conflict.end += difference possible_conflict.start += difference else: break This results in the following resolution, which obviously breaks those constraints, and the last appointment will have to be pushed to the following day. appointment_list = [ <Appointment: 10:00 -> 12:00>, <Appointment: 12:00 -> 13:30>, <Appointment: 13:30 -> 14:30>, <Appointment: 14:30 -> 15:30>, ] Obviously this is sub-optimal, It performs 3 appointment moves when the confict could have been resolved with one: if we were able to push the first appointment backwards, we could avoid moving all the subsequent appointments down. I'm thinking that there should be a sort of edit-distance approach that would calculate the least number of appointments that should be moved in order to resolve the scheduling conflict, but I can't get the a handle on the methodology. Should it be breadth-first or depth first solution search. When do I know if the solution is "good enough"?

    Read the article

  • Oracle Enterprise Manager Ops Center : Using Operational Profiles to Install Packages and other Content

    - by LeonShaner
    Oracle Enterprise Manager Ops Center provides numerous ways to deploy content, such as through OS Update Profiles, or as part of an OS Provisioning plan or combinations of those and other "Install Software" capabilities of Deployment Plans.  This short "how-to" blog will highlight an alternative way to deploy content using Operational Profiles. Usually we think of Operational Profiles as a way to execute a simple "one-time" script to perform a basic system administration function, which can optionally be based on user input; however, Operational Profiles can be much more powerful than that.  There is often more to performing an action than merely running a script -- sometimes configuration files, packages, binaries, and other scripts, etc. are needed to perform the action, and sometimes the user would like to leave such content on the system for later use. For shell scripts and other content written to be generic enough to work on any flavor of UNIX, converting the same scripts and configuration files into Solaris 10 SVR4 package, Solaris 11 IPS package, and/or a Linux RPM's might be seen as three times the work, for little appreciable gain.   That is where using an Operational Profile to deploy simple scripts and other generic content can be very helpful.  The approach is so powerful, that pretty much any kind of content can be deployed using an Operational Profile, provided the files involved are not overly large, and it is not necessary to convert the content into UNIX variant-specific formats. The basic formula for deploying content with an Operational Profile is as follows: Begin with a traditional script header, which is a UNIX shell script that will be responsible for decoding and extracting content, copying files into the right places, and executing any other scripts and commands needed to install and configure that content. Include steps to make the script platform-aware, to do the right thing for a given UNIX variant, or a "sorry" message if the operator has somehow tried to run the Operational Profile on a system where the script is not designed to run.  Ops Center can constrain execution by target type, so such checks at this level are an added safeguard, but also useful with the generic target type of "Operating System" where the admin wants the script to "do the right thing," whatever the UNIX variant. Include helpful output to show script progress, and any other informational messages that can help the admin determine what has gone wrong in the case of a problem in script execution.  Such messages will be shown in the job execution log. Include necessary "clean up" steps for normal and error exit conditions Set non-zero exit codes when appropriate -- a non-zero exit code will cause an Operational Profile job to be marked failed, which is the admin's cue to look into the job details for diagnostic messages in the output from the script. That first bullet deserves some explanation.  If Operational Profiles are usually simple "one-time" scripts and binary content is not allowed, then how does the actual content, packages, binaries, and other scripts get delivered along with the script?  More specifically, how does one include such content without needing to first create some kind of traditional package?   All that is required is to simply encode the content and append it to the end of the Operational Profile.  The header portion of the Operational Profile will need to contain the commands to decode the embedded content that has been appended to the bottom of the script.  The header code can do whatever else is needed, and finally clean up any intermediate files that were created during the decoding and extraction of the content. One way to encode binary and other content for inclusion in a script is to use the "uuencode" utility to convert the content into simple base64 ASCII text -- a form that is suitable to be appended to an Operational Profile.   The behavior of the "uudecode" utility is such that it will skip over any parts of the input that do not fit the uuencoded "begin" and "end" clauses.  For that reason, your header script will be skipped over, and uudecode will find your embedded content, that you will uuencode and paste at the end of the Operational Profile.  You can have as many "begin" / "end" clauses as you need -- just separate each embedded file by an empty line between "begin" and "end" clauses. Example:  Install SUNWsneep and set the system serial number Script:  deploySUNWsneep.sh ( <- right-click / save to download) Highlights: #!/bin/sh # Required variables: OC_SERIAL="$OC_SERIAL" # The user-supplied serial number for the asset ... Above is a good practice, showing right up front what kind of input the Operational Profile will require.   The right-hand side where $OC_SERIAL appears in this example will be filled in by Ops Center based on the user input at deployment time. The script goes on to restrict the use of the program to the intended OS type (Solaris 10 or older, in this example, but other content might be suitable for Solaris 11, or Linux -- it depends on the content and the script that will handle it). A temporary working directory is created, and then we have the command that decodes the embedded content from "self" which in scripting terms is $0 (a variable that expands to the name of the currently executing script): # Pass myself through uudecode, which will extract content to the current dir uudecode $0 At that point, whatever content was appended in uuencoded form at the end of the script has been written out to the current directory.  In this example that yields a file, SUNWsneep.7.0.zip, which the rest of the script proceeds to unzip, and pkgadd, followed by running "/opt/SUNWsneep/bin/sneep -s $OC_SERIAL" which is the command that stores the system serial for future use by other programs such as Explorer.   Don't get hung up on the example having used a pkgadd command.  The content started as a zip file and it could have been a tar.gz, or any other file.  This approach simply decodes the file.  The header portion of the script has to make sense of the file and do the right thing (e.g. it's up to you). The script goes on to clean up after itself, whether or not the above was successful.  Errors are echo'd by the script and a non-zero exit code is set where appropriate. Second to last, we have: # just in case, exit explicitly, so that uuencoded content will not cause error OPCleanUP exit # The rest of the script is ignored, except by uudecode # # UUencoded content follows # # e.g. for each file needed, #  $ uuencode -m {source} {source} > {target}.uu5 # then paste the {target}.uu5 files below # they will be extracted into the workding dir at $TDIR # The commentary above also describes how to encode the content. Finally we have the uuencoded content: begin-base64 444 SUNWsneep.7.0.zip UEsDBBQAAAAIAPsRy0Di3vnukAAAAMcAAAAKABUAcmVhZG1lLnR4dFVUCQADOqnVT7up ... VXgAAFBLBQYAAAAAAgACAJEAAADTNwEAAAA= ==== That last line of "====" is the base64 uuencode equivalent of a blank line, followed by "end" and as mentioned you can have as many begin/end clauses as you need.  Just separate each embedded file by a blank line after each ==== and before each begin-base64. Deploying the example Operational Profile looks like this (where I have pasted the system serial number into the required field): The job succeeded, but here is an example of the kind of diagnostic messages that the example script produces, and how Ops Center displays them in the job details: This same general approach could be used to deploy Explorer, and other useful utilities and scripts. Please let us know what you think?  Until next time...\Leon-- Leon Shaner | Senior IT/Product ArchitectSystems Management | Ops Center Engineering @ Oracle The views expressed on this [blog; Web site] are my own and do not necessarily reflect the views of Oracle. For more information, please go to Oracle Enterprise Manager  web page or  follow us at :  Twitter | Facebook | YouTube | Linkedin | Newsletter

    Read the article

  • CodeStock 2012 Review: Eric Landes( @ericlandes ) - Automated Tests in to automated Builds! How to put the right type of automated tests in to the right automated builds.

    Automated Tests in to automated Builds! How to put the right type of automated tests in to the right automated builds.Speaker: Eric LandesTwitter: @ericlandesBlog: http://ericlandes.com/ This was one of the first sessions I attended during CodeStock 2012. Eric’s talk focused mostly on unit testing, and that the lack of proper unit testing can be compared to stealing from an employer. His point was that if you’re not doing proper unit testing then all of the time wasted on fixing issues that could have been detected with unit tests is like stealing money from employer. He makes the assumption that that time spent on fixing these issues could have been better spent developing new features that drive the business. To a point I can agree with Eric’s argument regarding unit testing and stealing from a company’s perspective. I can see how he relates resources being shifted from new development to bug fixes as stealing based on the fact that the resources used to fix bugs are directly taken from other projects. He also states that Boring/Redundant and Build/Test tasks should be automated because it reduces the changes of errors and frees up developer to do what they do best, DEVELOP! When he refers to testing, he breaks testing down in to four distinct types. Unit Test Acceptance Test (This also includes Integration Tests) Performance Test UI Test With this he also recommends that developers should not go buck wild striving for 100% code coverage because some test my not provide a great return on investment. In his experience he recommends that 70% test coverage was a very acceptable rate.

    Read the article

  • Simple Architecture Verification

    - by Jean Carlos Suárez Marranzini
    I just made an architecture for an application with the function of scoring, saving and loading tennis games. The architecture has 2 kinds of elements: components & layers. Components: Standalone elements that can be consumed by other components or by layers. They might also consume functionality from the model/bottom layer. Layers: Software components whose functionality rests on previous layers (except for the model layer). -Layers: -Models: Data and it's behavior. -Controllers: A layer that allows interaction between the views and the models. -Views: The presentation layer for interacting with the user. -Components: -Persistence: Makes sure the game data can be stored away for later retrieval. -Time Machine: Records changes in the game through time so it's possible to navigate the game back and forth. -Settings: Contains the settings that determine how some of the game logic will apply. -Game Engine: Contains all the game logic, which it applies to the game data to determine the path the game should take. This is an image of the architecture (I don't have enough rep to post images): http://i49.tinypic.com/35lt5a9.png The requierements which this architecture should satisfy are the following: Save & load games. Move through game history and see how the scoreboard changes as the game evolves. Tie-breaks must be properly managed. Games must be classified by hit-type. Every point can be modified. Match name and player names must be stored. Game logic must be configurable by the user. I would really appreciate any kind of advice or comments on this architecture. To see if it is well built and makes sense as a whole. I took the idea from this link. http://en.wikipedia.org/wiki/Model%E2%80%93view%E2%80%93controller

    Read the article

  • How can player actions be "judged morally" in a measurable way?

    - by Sebastien Diot
    While measuring the player "skills" and "effort" is usually easy, adding some "less objective" statistics can give the player supplementary goals, especially in a MUD/RPG context. What I mean is that apart from counting how many orcs were killed, and gems collected, it would be interesting to have something along the line of the traditional Good/Evil, Lawful/Chaotic ranking of paper-based RPG, to add "dimension" to the game. But computers cannot differentiate good/evil effectively (nor can humans in many cases), and if you have a set of "laws" which are precise enough that you can tell exactly when the player breaks them, then it generally makes more sense to actually prevent them from doing that action in the first place. One example could be the creation/destruction axis (if players are at all allowed to create/build things), possibly in the form of the general effect of the player actions on "ecology". So what else is there left that can be effectively measured and would provide a sense of "moral" for the player? The more axis I have to measure, the more goals the player can have, and therefore the longer the game can last. This also gives the players more ways of "differentiating" themselves among hordes of other players of the same "class" and similar "kit".

    Read the article

  • How to update entity states and animations in a component-based game

    - by mivic
    I'm trying to design a component-based entity system for learning purposes (and later use on some games) and I'm having some troubles when it comes to updating entity states. I don't want to have an update() method inside the Component to prevent dependencies between Components. What I currently have in mind is that components hold data and systems update components. So, if I have a simple 2D game with some entities (e.g. player, enemy1, enemy 2) that have Transform, Movement, State, Animation and Rendering components I think I should have: A MovementSystem that moves all the Movement components and updates the State components And a RenderSystem that updates the Animation components (the animation component should have one animation (i.e. a set of frames/textures) for each state and updating it means selecting the animation corresponding to the current state (e.g. jumping, moving_left, etc), and updating the frame index). Then, the RenderSystem updates the Render components with the texture corresponding to the current frame of each entity's Animation and renders everything on screen. I've seen some implementations like Artemis framework, but I don't know how to solve this situation: Let's say that my game has the following entities. Each entity have a set of states and one animation for each state: player: "idle", "moving_right", "jumping" enemy1: "moving_up", "moving_down" enemy2: "moving_left", "moving_right" What are the most accepted approaches in order to update the current state of each entity? The only thing that I can think of is having separate systems for each group of entities and separate State and Animation components so I would have PlayerState, PlayerAnimation, Enemy1State, Enemy1Animation... PlayerMovementSystem, PlayerRenderingSystem... but I think this is a bad solution and breaks the purpose of having a component-based system. As you can see, I'm quite lost here, so I'd very much appreciate any help.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Projected Results

    - by Sylvie MacKenzie, PMP
    Excerpt from PROFIT - ORACLE - by Monica Mehta Yasser Mahmud has seen a revolution in project management over the past decade. During that time, the former Primavera product strategist (who joined Oracle when his company was acquired in 2008) has not only observed a transformation in the way IT systems support corporate projects but the role project portfolio management (PPM) plays in the enterprise. “15 years ago project management was the domain of project management office (PMO),” Mahmud recalls of earlier days. “But over the course of the past decade, we've seen it transform into a mission critical enterprise discipline, that has made Primavera indispensable in the board room. Now, as a senior manager, a board member, or a C-level executive you have direct and complete visibility into what’s kind of going on in the organization—at a level of detail that you're going to consume that information.” Now serving as Oracle’s vice president of product strategy and industry marketing, Mahmud shares his thoughts on how Oracle’s Primavera solutions have evolved and how best-in-class project portfolio management systems can help businesses stay competitive. Profit: What do you feel are the market dynamics that are changing project management today? Mahmud: First, the data explosion. We're generating data at twice the rate at which we can actually store it. The same concept applies for project-intensive organizations. A lot of data is gathered, but what are we really doing with it? Are we turning data into insight? Are we using that insight and turning it into foresight with analytics tools? This is a key driver that will separate the very good companies—the very competitive companies—from those that are not as competitive. Another trend is centered on the explosion of mobile computing. By the year 2013, an estimated 35 percent of the world’s workforce is going to be mobile. That’s one billion people. So the question is not if you're going to go mobile, it’s how fast you are going to go mobile. What kind of impact does that have on how the workforce participates in projects? What worked ten to fifteen years ago is not going to work today. It requires a real rethink around the interfaces and how data is actually presented. Profit: What is the role of project management in this new landscape? Mahmud: We recently conducted a PPM study with the Economist Intelligence Unit centered to determine how important project management is considered within organizations. Our target was primarily CFOs, CIOs, and senior managers and we discovered that while 95 percent of participants believed it critical to their business, only six percent were confident that projects were delivered on time and on budget. That’s a huge gap. Most organizations are looking for efficiency, especially in these volatile financial times. But senior management can’t keep track of every project in a large organization. As a result, executives are attempting to inventory the work being conducted under their watch. What is often needed is a very high-level assessment conducted at the board level to say, “Here are the 50 initiatives that we have underway. How do they line up with our strategic drivers?” This line of questioning can provide early warning that work and strategy are out of alignment; finding the gap between what the business needs to do and the actual performance scorecard. That’s low-hanging fruit for any executive looking to increase efficiency and save money. But it can only be obtained through proper assessment of existing projects—and you need a project system of record to get that done. Over the next decade or so, project management is going to transform into holistic work management. Business leaders will want make sure key projects align with corporate strategy, but also the ability to drill down into daily activity and smaller projects to make sure they line up as well. Keeping employees from working on tasks—even for a few hours—that don’t line up with corporate goals will, in many ways, become a competitive differentiator. Profit: How do all of these market challenges and shifting trends impact Oracle’s Primavera solutions and meeting customers’ needs? Mahmud: For Primavera, it’s a transformation from being a project management application to a PPM system in the enterprise. Also making that system a mission-critical application by connecting to other key applications within the ecosystem, such as the enterprise resource planning (ERP), supply chain, and CRM systems. Analytics have also become a huge component. Business analytics have made Oracle’s Primavera applications pertinent in the boardroom. Now, as a senior manager, a board member, a CXO, CIO, or CEO, you have direct visibility into what’s going on in the organization at a level that you're able to consume that information. In addition, all of this information pairs up really well with your financials and other data. Certainly, when you're an Oracle shop, you have that visibility that you didn’t have before from a project execution perspective. Profit: What new strategies and tools are being implemented to create a more efficient workplace for users? Mahmud: We believe very strongly that just because you call something an enterprise project portfolio management system doesn’t make it so—you have to get people to want to participate in the system. This can’t be mandated down from the top. It simply doesn’t work that way. A truly adoptable solution is one that makes it super easy for all types users to participate, by providing them interfaces where they live. Keeping that in mind, a major area of development has been alternative user interfaces. This is increasingly resulting in the creation of lighter weight, targeted interfaces such as iOS applications, and smartphones interfaces such as for iPhone and Android platform. Profit: How does this translate into the development of Oracle’s Primavera solutions? Mahmud: Let me give you a few examples. We recently announced the launch of our Primavera P6 Team Member application, which is a native iOS application for the iPhone. This interface makes it easier for team members to do their jobs quickly and effectively. Similarly, we introduced the Primavera analytics application, which can be consumed via mobile devices, and when married with Oracle Spatial capabilities, users can get a geographical view of what’s going on and which projects are occurring in various locations around the world. Lastly, we introduced advanced email integration that allows project team members to status work via E-mail. This functionality leverages the fact that users are in E-mail system throughout the day and allows them to status their work without the need to launch the Primavera application. It comes back to a mantra: provide as many alternative user interfaces as possible, so you can give people the ability to work, to participate, to raise issues, to create projects, in the places where they live. Do it in such a way that it’s non-intrusive, do it in such a way that it’s easy and intuitive and they can get it done in a short amount of time. If you do that, workers can get back to doing what they're actually getting paid for.

    Read the article

  • PASS: The Budget Process

    - by Bill Graziano
    Every fiscal year PASS creates a detailed budget.  This helps us set priorities and communicate to our members what we’re going to do in the upcoming year.  You can review the current budget on the PASS Governance page.  That page currently requires you to login but I’m talking with HQ to see if there are any legal issues with opening that up. The Accounting Team The PASS accounting team is two people.  The Executive Vice-President of Finance (“EVP”) and the PASS Accounting Manager.  Sandy Cherry is the accounting manager and works at PASS HQ.  Sandy has been with PASS since we switched management companies in 2007.  Throughout this document when I talk about any actual work related to the budget that’s all Sandy :)  She’s the glue that gets us through this process.  Last year we went through 32 iterations of the budget before the Board approved so it’s a pretty busy time for her us – well, mostly her. Fiscal Year The PASS fiscal year runs from July 1st through June 30th the following year.  Right now we’re in fiscal year 2011.  Our 2010 Summit actually occurred in FY2011.  We switched to this schedule from a calendar year in 2006.  Our goal was to have the Summit occur early in our fiscal year.  That gives us the rest of the year to handle any significant financial impact from the Summit.  If registrations are down we can reduce spending.  If registrations are up we can decide how much to increase our reserves and how much to spend.  Keep in mind that the Summit is budgeted to generate 82% of our revenue this year.  How it performs has a significant impact on our financials.  The other benefit of this fiscal year is that it matches the Microsoft fiscal year.  We sign an annual sponsorship agreement with Microsoft and it’s very helpful that our fiscal years match. This year our budget process will probably start in earnest in March or April.  I’d like to be done in early June so we can publish before July 1st.  I was late publishing it this year and I’m trying not to repeat that. Our Budget Our actual budget is an Excel spreadsheet with 36 sheets.  We remove some of those when we publish it since they include salary information.  The budget is broken up into various portfolios or departments.  We have 20 portfolios.  They include chapters, marketing, virtual chapters, marketing, etc.  Ideally each portfolio is assigned to a Board member.  Each portfolio also typically has a staff person assigned to it.  Portfolios that aren’t assigned to a Board member are monitored by HQ and the ExecVP-Finance (me).  These are typically smaller portfolios such as deferred membership or Summit futures.  (More on those in a later post.)  All portfolios are reviewed by all Board members during the budget approval process, when interim financials are released internally and at year-end. The Process Our first step is to budget revenues.  The Board determines a target attendee number.  We have formulas based on historical performance that convert that to an overall attendee revenue number.  Other revenue projections (such as vendor sponsorships) come from different parts of the organization.  I hope to have another post with more details on how we project revenues. The next step is to budget expenses.  Board members fill out a sample spreadsheet with their budget for the year.  They can add line items and notes describing what the amounts are for.  Each Board portfolio typically has from 10 to 30 line items.  Any new initiatives they want to pursue needs to be budgeted.  The Summit operations budget is managed by HQ.  It includes the cost for food, electrical, internet, etc.  Most of these come from our estimate of attendees and our contract with the convention center.  During this process the Board can ask for more or less to be spent on various line items.  For example, if we weren’t happy with the Internet at the last Summit we can ask them to look into different options and/or increasing the budget.  HQ will also make adjustments to these numbers based on what they see at the events and the feedback we receive on the surveys. After we have all the initial estimates we start reviewing the entire budget.  It is sent out to the Board and we can see what each portfolio requested and what the overall profit and loss number is.  We usually start with too much in expenses and need to cut.  In years past the Board started haggling over these numbers as a group.  This past year they decided I should take a first cut and present them with a reasonable budget and a list of what I changed.  That worked well and I think we’ll continue to do that in the future. We go through a number of iterations on the budget.  If I remember correctly, we went through 32 iterations before we passed the budget.  At each iteration various revenue and expense numbers can change.  Keep in mind that the PASS budget has 200+ line items spread over 20 portfolios.  Many of these depend on other numbers.  For example, if we decide increase the projected attendees that cascades through our budget.  At each iteration we list what changed and the impact.  Ideally these discussions will take place at a face-to-face Board meeting.  Many of them also take place over the phone.  Board members explain any increase they are asking for while performing due diligence on other budget requests.  Eventually a budget emerges and is passed. Publishing After the budget is passed we create a version without the formulas and salaries for posting on the web site.  Sandy also creates some charts to help our members understand the budget.  The EVP writes a nice little letter describing some of the changes from last year’s budget.  You can see my letter and our budget on the PASS Governance page. And then, eight months later, we start all over again.

    Read the article

  • Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

    - by user1848361
    First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

    Read the article

  • Regular Expressions Cookbook Code Samples

    - by Jan Goyvaerts
    %COOKBOOKFRAME% One of the common criticisms against the first edition was that we didn’t have the regular expressions and code samples available for download. Since our book only has very short code snippets rather than complete programs, we (the authors) did not have these available as separate files either. But for the second edition we’re trying to do better. You can now download the code samples from the 2nd edition of Regular Expressions Cookbook. This HTML file contains all the blocks with regular expressions and source code from the book, along with the titles of the chapters, recipes, and sections that they are found in. If you have purchased the book, you can use this file to easily copy and paste the regular expressions and source code snippets. Even if you purchased the ebook, you may prefer to use this file. The regexes in the ebook are formatted with line breaks and gray dots for spaces to make them easier to read in print. The HTML file does not use such formatting, so you can copy and paste them directly. This means that some very regexes will run beyond the edge of your browser window.

    Read the article

  • ODEE Green Field (Windows) Part 4 - Documaker

    - by AndyL-Oracle
    Welcome back! We're about nearing completion of our installation of Oracle Documaker Enterprise Edition ("ODEE") in a green field. In my previous post, I covered the installation of SOA Suite for WebLogic. Before that, I covered the installation of WebLogic, and Oracle 11g database - all of which constitute the prerequisites for installing ODEE. Naturally, if your environment already has a WebLogic server and Oracle database, then you can skip all those components and go straight for the heart of the installation of ODEE. The ODEE installation is comprised of two procedures, the first covers the installation, which is running the installer and answering some questions. This will lay down the files necessary to install into the tiers (e.g. database schemas, WebLogic domains, etcetera). The second procedure is to deploy the configuration files into the various components (e.g. deploy the database schemas, WebLogic domains, SOA composites, etcetera). I will segment my posts accordingly! Let's get started, shall we? Unpack the installation files into a temporary directory location. This should extract a zip file. Extract that zip file into the temporary directory location. Navigate to and execute the installer in Disk1/setup.exe. You may have to allow the program to run if User Account Control is enabled. Once the dialog below is displayed, click Next. Select your ODEE Home - inside this directory is where all the files will be deployed. For ease of support, I recommend using the default, however you can put this wherever you want. Click Next. Select the database type, database connection type – note that the database name should match the value used for the connection type (e.g. if using SID, then the name should be IDMAKER; if using ServiceName, the name should be “idmaker.us.oracle.com”). Verify whether or not you want to enable advanced compression. Note: if you are not licensed for Oracle 11g Advanced Compression option do not use this option! Terrible, terrible calamities will befall you if you do! Click Next. Enter the Documaker Admin user name (default "dmkr_admin" is recommended for support purposes) and set the password. Update the System name and ID (must be unique) if you want/need to - since this is a green field install you should be able to use the default System ID. The only time you'd change this is if you were, for some reason, installing a new ODEE system into an existing schema that already had a system. Click Next. Enter the Assembly Line user name (default "dmkr_asline" is recommended) and set the password. Update the Assembly Line name and ID (must be unique) if you want/need to - it's quite possible that at some point you will create another assembly line, in which case you have several methods of doing so. One is to re-run the installer, and in this case you would pick a different assembly line ID and name. Click Next. Note: you can set the DB folder if needed (typically you don’t – see ODEE Installation Guide for specifics. Select the appropriate Application Server type - in this case, our green field install is going to use WebLogic - set the username to weblogic (this is required) and specify your chosen password. This credential will be used to access the application server console/control panel. Keep in mind that there are specific criteria on password choices that are required by WebLogic, but are not enforced by the installer (e.g. must contain a number, must be of a certain length, etcetera). Choose a strong password. Set the connection information for the JMS server. Note that for the 12.3.x version, the installer creates a separate JVM (WebLogic managed server) that hosts the JMS server, whereas prior editions place the JMS server on the AdminServer.  You may also specify a separate URL to the JMS server in case you intend to move the JMS resources to a separate/different server (e.g. back to AdminServer). You'll need to provide a login principal and credentials - for simplicity I usually make this the same as the WebLogic domain user, however this is not a secure practice! Make your JMS principal different from the WebLogic principal and choose a strong password, then click Next. Specify the Hot Folder(s) (comma-delimited if more than one) - this is the directory/directories that is/are monitored by ODEE for jobs to process. Click Next. If you will be setting up an SMTP server for ODEE to send emails, you may configure the connection details here. The details required are simple: hostname, port, user/password, and the sender's address (e.g. emails will appear to be sent by the address shown here so if the recipient clicks "reply", this is where it will go). Click Next. If you will be using Oracle WebCenter:Content (formerly known as Oracle UCM) you can enable this option and set the endpoints/credentials here. If you aren't sure, select False - you can always go back and enable this later. I'm almost 76% certain there will be a post sometime in the future that details how to configure ODEE + WCC:C! Click Next. If you will be using Oracle UMS for sending MMS/text messages, you can enable and set the endpoints/credentials here. As with UCM, if you're not sure, don't enable it - you can always set it later. Click Next. On this screen you can change the endpoints for the Documaker Web Service (DWS), and the endpoints for approval processing in Documaker Interactive. The deployment process for ODEE will create 3 managed WebLogic servers for hosting various Documaker components (JMS, Interactive, DWS, Dashboard, Documaker Administrator, etcetera) and it will set the ports used for each of these services. In this screen you can change these values if you know how you want to deploy these managed servers - but for now we'll just accept the defaults. Click Next. Verify the installation details and click Install. You can save the installation into a response file if you need to (which might be useful if you want to rerun this installation in an unattended fashion). Allow the installation to progress... Click Next. You can save the response file if needed (e.g. in case you forgot to save it earlier!) Click Finish. That's it, you're done with the initial installation. Have a look around the ODEE_HOME that you just installed (remember we selected c:\oracle\odee_1?) and look at the files that are laid down. Don't change anything just yet! Stay tuned for the next segment where we complete and verify the installation. 

    Read the article

< Previous Page | 311 312 313 314 315 316 317 318 319 320 321 322  | Next Page >