Search Results

Search found 22246 results on 890 pages for 'microsoft expression'.

Page 317/890 | < Previous Page | 313 314 315 316 317 318 319 320 321 322 323 324  | Next Page >

  • Using ms: xpath functions inside XPathExpression

    - by Filini
    I am trying to use Microsoft XPath Extension Functions (such as ms:string-compare http://msdn.microsoft.com/en-us/library/ms256114.aspx) inside an XPathExpression object. These functions are extensions inside the MSXML library, and if I use them in an XslCompiledTransform (simply adding the "ms" namespace) they work like a charm: var xsl = @" <?xml version=""1.0"" encoding=""UTF-8""?> <xsl:stylesheet version=""2.0"" xmlns:xsl=""http://www.w3.org/1999/XSL/Transform"" xmlns:xs=""http://www.w3.org/2001/XMLSchema"" xmlns:fn=""http://www.w3.org/2005/xpath-functions"" xmlns:ms=""urn:schemas-microsoft-com:xslt""> <xsl:output method=""xml"" version=""1.0"" encoding=""UTF-8"" indent=""yes""/> <xsl:template match=""/Data""> <xsl:element name=""Result""> <xsl:value-of select=""ms:string-compare(@timeout1, @timeout2)""/> </xsl:element> </xsl:template> </xsl:stylesheet>"; var xslDocument = new XmlDocument(); xslDocument.LoadXml(xsl); var transform = new XslCompiledTransform(); transform.Load(xslDocument); Then I tried using them in an XPathExpression: XPathNavigator nav = document.DocumentElement.CreateNavigator(); XPathExpression expr = nav.Compile("ms:string-compare(/Data/@timeout1, /Data/@timeout2)"); XmlNamespaceManager manager = new XmlNamespaceManager(document.NameTable); manager.AddNamespace("ms", "urn:schemas-microsoft-com:xslt"); expr.SetContext(manager); nav.Evaluate(expr); But I get an exception "XsltContext is needed for this query because of an unknown function". XsltContext is a specific XmlNamespaceManager, but I don't know if it's possible to instantiate it without an actual XslCompiledTransform (it's abstract) and use it as my expression context. Is there any way to do this (or any other way to use ms: extensions inside an XPathExpression)?

    Read the article

  • Recoverable error while running XSL

    - by Kate
    XSL: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:ve="http://schemas.openxmlformats.org/markup-compatibility/2006" xmlns:o="urn:schemas-microsoft-com:office:office" xmlns:r="http://schemas.openxmlformats.org/officeDocument/2006/relationships" xmlns:m="http://schemas.openxmlformats.org/officeDocument/2006/math" xmlns:v="urn:schemas-microsoft-com:vml" xmlns:wp="http://schemas.openxmlformats.org/drawingml/2006/wordprocessingDrawing" xmlns:w10="urn:schemas-microsoft-com:office:word" xmlns:w="http://schemas.openxmlformats.org/wordprocessingml/2006/main" xmlns:wne="http://schemas.microsoft.com/office/word/2006/wordml" exclude-result-prefixes="wp wne w10 w ve o r m v" version="2.0"> <xsl:output method="text"/> <xsl:param name="styleName"/> <xsl:template match="w:p"> <xsl:apply-templates/><xsl:text>&#10;</xsl:text> </xsl:template> <xsl:template match="w:r[not ((parent::w:hyperlink[@w:anchor[matches(.,concat('^(',$styleName,')')),'i']]))]"> <xsl:value-of select="replace(., '.', '&#xFF00;')"/> </xsl:template> </xsl:stylesheet> While processing the above XSL, I am getting the below error, Recoverable Error: Recoverable error on line 11 FORG0006: An error occurred matching pattern {w:r[not ((parent::w:hyperlink[@w:anchor[matches(.,concat('^(',$styleName,')')),'i']]))]}: Effective boolean value is not defined for a sequence of two or more items starting with a boolean Please Help. I am not able to figure out this.

    Read the article

  • Save PowerPoint slides as images

    - by nihi_l_ist
    I want to save some presentation file as images into some directory and use the code: OpenFileDialog o = new OpenFileDialog(); o.ShowDialog(); if (o.FileName != null) { ApplicationClass pptApplication = new ApplicationClass(); Presentation pptPresentation = pptApplication.Presentations.Open(o.FileName, MsoTriState.msoFalse, MsoTriState.msoFalse, MsoTriState.msoFalse); FolderBrowserDialog fb = new FolderBrowserDialog(); fb.ShowDialog(); for (int i = 0; i < pptPresentation.Slides.Count; i++) { pptPresentation.Slides[i].Export(fb.SelectedPath + "Slide" + (i + 1) + ".jpg", "jpg", 320, 240); } } use namespaces: using Microsoft.Office.Core; using Microsoft.Office.Interop.PowerPoint; But i get the following error: 'Microsoft.Office.Interop.PowerPoint.ApplicationClass' does not contain a definition for 'Presentations' and no extension method 'Presentations' accepting a first argument of type 'Microsoft.Office.Interop.PowerPoint.ApplicationClass' could be found (are you missing a using directive or an assembly reference?) Tho it seems that it has property called Presentations.. What am i doing incorrectly?

    Read the article

  • Why null reference exception in SetMolePublicInstance?

    - by OldGrantonian
    I get a "null reference" exception in the following line: MoleRuntime.SetMolePublicInstance(stub, receiverType, objReceiver, name, null); The program builds and compiles correctly. There are no complaints about any of the parameters to the method. Here's the specification of SetMolePublicInstance, from the object browser: SetMolePublicInstance(System.Delegate _stub, System.Type receiverType, object _receiver, string name, params System.Type[] parameterTypes) Here are the parameter values for "Locals": + stub {Method = {System.String <StaticMethodUnitTestWithDeq>b__0()}} System.Func<string> + receiverType {Name = "OrigValue" FullName = "OrigValueP.OrigValue"} System.Type {System.RuntimeType} objReceiver {OrigValueP.OrigValue} object {OrigValueP.OrigValue} name "TestString" string parameterTypes null object[] I know that TestString() takes no parameters and returns string, so as a starter to try to get things working, I specified "null" for the final parameter to SetMolePublicInstance. As already mentioned, this compiles OK. Here's the stack trace: Unhandled Exception: System.NullReferenceException: Object reference not set to an instance of an object. at Microsoft.ExtendedReflection.Collections.Indexable.ConvertAllToArray[TInput,TOutput](TInput[] array, Converter`2 converter) at Microsoft.Moles.Framework.Moles.MoleRuntime.SetMole(Delegate _stub, Type receiverType, Object _receiver, String name, MoleBindingFlags flags, Type[] parameterTypes) at Microsoft.Moles.Framework.Moles.MoleRuntime.SetMolePublicInstance(Delegate _stub, Type receiverType, Object _receiver, String name, Type[] parameterTypes) at DeqP.Deq.Replace[T](Func`1 stub, Type receiverType, Object objReceiver, String name) in C:\0VisProjects\DecP_04\DecP\DeqC.cs:line 38 at DeqPTest.DecCTest.StaticMethodUnitTestWithDeq() in C:\0VisProjects\DecP_04\DecPTest\DeqCTest.cs:line 28 at Starter.Start.Main(String[] args) in C:\0VisProjects\DecP_04\Starter\Starter.cs:line 14 Press any key to continue . . . To avoid the null parameter, I changed the final "null" to "parameterTypes" as in the following line: MoleRuntime.SetMolePublicInstance(stub, receiverType, objReceiver, name, parameterTypes); I then tried each of the following (before the line): int[] parameterTypes = null; // if this is null, I don't think the type will matter int[] parameterTypes = new int[0]; object[] parameterTypes = new object[0]; // this would allow for various parameter types All three attempts produce a red squiggly line under the entire line for SetMolePublicInstance Mouseover showed the following message: The best overloaded method match for 'Microsoft.Moles.Framework.Moles.MoleRuntime.SetMolePublicInstance(System.Delegate, System.Type, object, string, params System.Type[])' has some invalid arguments. I'm assuming that the first four arguments are OK, and that the problem is with the params array.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Problem with derived ControlTemplates in WPF

    - by Frank Fella
    The following xaml code works: <Window x:Class="DerivedTemplateBug.Window1" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:local="clr-namespace:DerivedTemplateBug" Title="Window1" Height="300" Width="300"> <Button> <Button.Template> <ControlTemplate> <Border BorderBrush="Black" BorderThickness="2"> <TextBlock>Testing!</TextBlock> </Border> </ControlTemplate> </Button.Template> </Button> </Window> Now, if you define the following data template: using System.Windows.Controls; namespace DerivedTemplateBug { public class DerivedTemplate : ControlTemplate { } } And then swap the ControlTemplate for the derived class: <Window x:Class="DerivedTemplateBug.Window1" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:local="clr-namespace:DerivedTemplateBug" Title="Window1" Height="300" Width="300"> <Button> <Button.Template> <local:DerivedTemplate> <Border BorderBrush="Black" BorderThickness="2"> <TextBlock>Testing!</TextBlock> </Border> </local:DerivedTemplate> </Button.Template> </Button> </Window> You get the following error: Invalid ContentPropertyAttribute on type 'DerivedTemplateBug.DerivedTemplate', property 'Content' not found. Can anyone tell me why this is the case?

    Read the article

  • Reverse engineering and redistributing code from .NET Framework

    - by ToxicAvenger
    Once or twice I have been running into the following issue: Classes I want to reuse in my applications (and possibly redistribute) exist in the .NET Framework assemblies, but are marked internal or private. So it is impossible to reuse them directly. One way is to disassemble them, pick the pieces you need, put them in a different namespace, recompile (this can be some effort, but usually works quite well). My question is: Is this legal? Is this only legal for the classes of the Framework which are available as source code anyway? Is it illegal? I think that Microsoft marks them internal or private primarily so that they don't have to support them or can change the interfaces later. But some pieces - be it SharePoint or WCF - are almost impossible to properly extend by only using public classes from the apis. And rewriting everything from scratch generates a huge amount of effort, before you even start solving the problem you intended to solve. This is in my eyes not a "dirty" approach per se. The classes Microsoft ships are obviously well tested, if I reuse them under a different namespace I have "control" over them. If Microsoft changes the original implementation, my code won't be affected (some internals in WCF changed quite a bit with v4). It is not a super-clean approach. I would much prefer Microsoft making several classes public, because there are some nice classes hidden inside the framework.

    Read the article

  • How to specify Multiple Secure Webpages with .htaccess RewriteCond

    - by Patrick Ndille
    I have 3 pages that I want to make secure on my website using .htaccess -login.php -checkout.php -account.php I know how to make just one work page at a time using .htaccess RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] I and trying to figure out how to include the other 2 specific pages to make them also secure and used the expression below but it didn't work RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteCond %{REQUEST_URI} /checkout.php RewriteCond %{REQUEST_URI} /account.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] Can someone help me the right expression that will work with multiple pages? The second part of the code is that, if https is already on and a user move to a page that Is not any of the pages i specified about, I want that it should get back to http. how should I write the statement for it to redirect back to http if its not any of the pages above? I have my statement like this but its not working RewriteCond %{HTTPS} on RewriteRule !(checkout|login|account|payment)\.php http://%{HTTP_HOST}%{REQUEST_URI} [L,R] Any thoughts?

    Read the article

  • VB.NET CInt(Long) behaving differently in 32- and 64-bit environments

    - by LocoDelAssembly
    Hello everybody, this is my first message here. Today I had a problem converting a Long (Int64) to an Integer (Int32). The problem is that my code was always working in 32-bit environments, but when I try THE SAME executable in a 64-bit computer it crashes with a System.OverflowException exception. I've prepared this test code in VS2008 in a new project with default settings: Module Module1 Sub Main() Dim alpha As Long = -1 Dim delta As Integer Try delta = CInt(alpha And UInteger.MaxValue) Console.WriteLine("CINT OK") delta = Convert.ToInt32(alpha And UInteger.MaxValue) Console.WriteLine("Convert.ToInt32 OK") Catch ex As Exception Console.WriteLine(ex.GetType().ToString()) Finally Console.ReadLine() End Try End Sub End Module On my 32-bit setups (Windows XP SP3 32-bit and Windows 7 32-bit) it prints "CINT OK", but in the 64-bit computer (Windows 7 64-bit) that I've tested THE SAME executable it prints the exception name only. Is this behavior documented? I tried to find a reference but failed miserably. For reference I leave the MSIL code too: .method public static void Main() cil managed { .entrypoint .custom instance void [mscorlib]System.STAThreadAttribute::.ctor() = ( 01 00 00 00 ) // Code size 88 (0x58) .maxstack 2 .locals init ([0] int64 alpha, [1] int32 delta, [2] class [mscorlib]System.Exception ex) IL_0000: nop IL_0001: ldc.i4.m1 IL_0002: conv.i8 IL_0003: stloc.0 IL_0004: nop .try { .try { IL_0005: ldloc.0 IL_0006: ldc.i4.m1 IL_0007: conv.u8 IL_0008: and IL_0009: conv.ovf.i4 IL_000a: stloc.1 IL_000b: ldstr "CINT OK" IL_0010: call void [mscorlib]System.Console::WriteLine(string) IL_0015: nop IL_0016: ldloc.0 IL_0017: ldc.i4.m1 IL_0018: conv.u8 IL_0019: and IL_001a: call int32 [mscorlib]System.Convert::ToInt32(int64) IL_001f: stloc.1 IL_0020: ldstr "Convert.ToInt32 OK" IL_0025: call void [mscorlib]System.Console::WriteLine(string) IL_002a: nop IL_002b: leave.s IL_0055 } // end .try catch [mscorlib]System.Exception { IL_002d: dup IL_002e: call void [Microsoft.VisualBasic]Microsoft.VisualBasic.CompilerServices.ProjectData::SetProjectError(class [mscorlib]System.Exception) IL_0033: stloc.2 IL_0034: nop IL_0035: ldloc.2 IL_0036: callvirt instance class [mscorlib]System.Type [mscorlib]System.Exception::GetType() IL_003b: callvirt instance string [mscorlib]System.Type::ToString() IL_0040: call void [mscorlib]System.Console::WriteLine(string) IL_0045: nop IL_0046: call void [Microsoft.VisualBasic]Microsoft.VisualBasic.CompilerServices.ProjectData::ClearProjectError() IL_004b: leave.s IL_0055 } // end handler } // end .try finally { IL_004d: nop IL_004e: call string [mscorlib]System.Console::ReadLine() IL_0053: pop IL_0054: endfinally } // end handler IL_0055: nop IL_0056: nop IL_0057: ret } // end of method Module1::Main I suspect that the instruction that is behaving differently is either conv.ovf.i4 or the ldc.i4.m1/conv.u8 pair. If you know what is going on here please let me know Thanks

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

  • WPF problem modify style of images in multiple Button Templates

    - by user556415
    I'm trying to create a control panel for a video camera, the panel has buttons for up, down, left and right etc. Each camera function up, down, left and right is represented by three images (see code below) for the left side, middle and right side. The control panel is circular so the corner images kind of overlap (its complicated to explain this without a visual). When I click on up for example I have to hide the initial three images (leftside, middle and right side) and display another three images for left , middle and right that indicate that the button is pressed. I am achieving this by having a grid inside a button template. The problem I have is that for the corner images for the control there are really four images that represent this. For example for the top left corner the four images would be represent 1. Top not clicked. 2. Top Clicked and 3. Left Not clicked and 4. Left Clicked. My problem is if I need to make the images contained within the Top button have precedence when the top control is clicked or the images in the left button have precedence when the left button is clicked. So it's like I want to modify the left button's image visible property when the top button is clicked and vise versa. This is really difficult to explain so I apologize if it makes little sense but I can email the source code on request if anyone is interested in my predicament. <Grid> <Canvas> <!--<StackPanel>--> <Button Name="TopSide" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" Height="34" Width="102" Canvas.Left="97" Canvas.Top="60" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" > <Button.Template> <ControlTemplate TargetType="{x:Type Button}"> <Grid Width="100"> <Canvas> <Image Name="TopRightNormal" Source="Resources/topright_off.jpg" Height="34" Width="34" Canvas.Left="66"></Image> <Image Name="TopRightDown" Source="Resources/topright_down.jpg" Height="34" Width="34" Canvas.Left="66" Visibility="Hidden" ></Image> <Image Name="TopNormal" Source="Resources/topcenter_off.jpg" Height="34" Width="34" Canvas.Left="34" /> <Image Name="TopPressed" Source="Resources/topcenter_down.jpg" Height="34" Width="34" Canvas.Left="34" Visibility="Hidden" /> <Image Name="TopDisabled" Source="Resources/topcenter_off.jpg" Height="34" Width="34" Canvas.Left="34" Visibility="Hidden" /> <Image Name="TopLeftNormal" Source="Resources/topleft_off.jpg" Height="34" Width="34" Canvas.Left="2" ></Image> <Image Name="TopLeftDown" Opacity="0" Source="Resources/topleft_down.jpg" Height="34" Width="34" Canvas.Left="2" Visibility="Hidden" ></Image> </Canvas> </Grid> <ControlTemplate.Triggers> <Trigger Property="IsPressed" Value="True"> <Setter TargetName="TopNormal" Property="Visibility" Value="Hidden" /> <Setter TargetName="TopPressed" Property="Visibility" Value="Visible" /> <Setter TargetName="TopRightNormal" Property="Visibility" Value="Hidden" /> <Setter TargetName="TopRightDown" Property="Visibility" Value="Visible" /> <Setter TargetName="TopLeftNormal" Property="Visibility" Value="Hidden" /> <Setter TargetName="TopLeftDown" Property="Visibility" Value="Visible" /> <Setter TargetName="TopLeftDown" Property="Opacity" Value="100" /> </Trigger> <Trigger Property="IsEnabled" Value="False"> <Setter TargetName="TopNormal" Property="Visibility" Value="Hidden" /> <Setter TargetName="TopDisabled" Property="Visibility" Value="Visible" /> </Trigger> </ControlTemplate.Triggers> </ControlTemplate> </Button.Template> </Button> <!--</StackPanel>--> <!--<StackPanel>--> <Button Name="LeftSide" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" Canvas.Left="100" Canvas.Top="60" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" MouseDown="Button_MouseDown_1"> <Button.Template> <ControlTemplate TargetType="{x:Type Button}"> <Grid Width="34" Height="100"> <Canvas> <Image Name="TopLeftNormal" Source="Resources/topleft_off.jpg" Height="34" Width="34" Canvas.Left="0"></Image> <Image Name="TopLeftDown" Opacity="0" Source="Resources/topleft_leftdown.jpg" Height="34" Width="34" Canvas.Left="0" Visibility="Hidden" ></Image> <Image Name="Normal" Source="Resources/leftcenter_off.jpg" Height="34" Width="34" Canvas.Top="32" Canvas.Left="0"/> <Image Name="Pressed" Source="Resources/leftcenter_down.jpg" Visibility="Hidden" Canvas.Top="32" Height="34" Width="34" /> <Image Name="Disabled" Source="Resources/leftcenter_off.jpg" Visibility="Hidden" Height="34" Width="34" Canvas.Top="32" /> </Canvas> </Grid> <ControlTemplate.Triggers> <Trigger Property="IsPressed" Value="True"> <Setter TargetName="Normal" Property="Visibility" Value="Hidden" /> <Setter TargetName="Pressed" Property="Visibility" Value="Visible" /> <Setter TargetName="TopLeftNormal" Property="Visibility" Value="Hidden" /> <Setter TargetName="TopLeftNormal" Property="Opacity" Value="0" /> <Setter TargetName="TopLeftDown" Property="Visibility" Value="Visible" /> <Setter TargetName="TopLeftDown" Property="Opacity" Value="100" /> </Trigger> <Trigger Property="IsEnabled" Value="False"> <Setter TargetName="Normal" Property="Visibility" Value="Hidden" /> <Setter TargetName="Disabled" Property="Visibility" Value="Visible" /> </Trigger> </ControlTemplate.Triggers> </ControlTemplate> </Button.Template> </Button> <!--</StackPanel>--> <!--<StackPanel>--> <Button xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" Height="34" Width="34" Canvas.Left="165" Canvas.Top="92" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" MouseDown="Button_MouseDown_2" > <Button.Template> <ControlTemplate TargetType="{x:Type Button}"> <Grid> <Image Name="Normal" Source="Resources/rightcenter_off.jpg" /> <Image Name="Pressed" Source="Resources/rightcenter_down.jpg" Visibility="Hidden" /> <Image Name="Disabled" Source="Resources/rightcenter_off.jpg" Visibility="Hidden" /> </Grid> <ControlTemplate.Triggers> <Trigger Property="IsPressed" Value="True"> <Setter TargetName="Normal" Property="Visibility" Value="Hidden" /> <Setter TargetName="Pressed" Property="Visibility" Value="Visible" /> </Trigger> <Trigger Property="IsEnabled" Value="False"> <Setter TargetName="Normal" Property="Visibility" Value="Hidden" /> <Setter TargetName="Disabled" Property="Visibility" Value="Visible" /> </Trigger> </ControlTemplate.Triggers> </ControlTemplate> </Button.Template> </Button> <!--</StackPanel>--> <!--<StackPanel>--> <Button xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" Height="34" Width="34" Canvas.Left="133" Canvas.Top="124" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" > <Button.Template> <ControlTemplate TargetType="{x:Type Button}"> <Grid> <Image Name="BottomNormal" Source="Resources/bottomcenter_off.jpg" /> <Image Name="BottomPressed" Source="Resources/bottomcenter_down.jpg" Visibility="Hidden" /> <Image Name="BottomDisabled" Source="Resources/bottomcenter_off.jpg" Visibility="Hidden" /> </Grid> <ControlTemplate.Triggers> <Trigger Property="IsPressed" Value="True"> <Setter TargetName="BottomNormal" Property="Visibility" Value="Hidden" /> <Setter TargetName="BottomPressed" Property="Visibility" Value="Visible" /> </Trigger> <Trigger Property="IsEnabled" Value="False"> <Setter TargetName="BottomNormal" Property="Visibility" Value="Hidden" /> <Setter TargetName="BottomDisabled" Property="Visibility" Value="Visible" /> </Trigger> </ControlTemplate.Triggers> </ControlTemplate> </Button.Template> </Button> <!--</StackPanel>--> <Image Source="Resources/bottomright_off.jpg" Height="34" Width="34" Canvas.Left="165" Canvas.Top="124"></Image> <Image Source="Resources/bottomleft_off.jpg" Height="34" Width="34" Canvas.Left="100" Canvas.Top="124"></Image> <!--<ToggleButton Style="{StaticResource MyToggleButtonStyle}" Height="34" Width="34" Margin="150,100"/>--> </Canvas> </Grid>

    Read the article

  • Management API - The request body XML was invalid or not correctly specified

    - by maartenba
    Cross posting from http://social.msdn.microsoft.com/Forums/en-US/windowsazuretroubleshooting/thread/31b6aedc-c069-4e32-8e8f-2ff4b7c30793 I'm getting this error on changing configuration through the service management API: The request body XML was invalid or not correctly specified The request body payload: <?xml version="1.0" encoding="utf-8"?> <ChangeConfiguration xmlns="http://schemas.microsoft.com/windowsazu re"> <Configuration>PD94bWwgdmVyc2lvbj0iMS4wIj8+CjxTZXJ2aWNlQ29uZmlndX JhdGlvbiB4bWxuczp4c2k9Imh0dHA6Ly93d3cudzMub3JnLzIwMDEvWE1MU2NoZW1hLWluc3RhbmNlIi B4bWxuczp4c2Q9Imh0dHA6Ly93d3cudzMub3JnLzIwMDEvWE1MU2NoZW1hIiB4bWxucz0iaHR0cDovL3 NjaGVtYXMubWljcm9zb2Z0LmNvbS9TZXJ2aWNlSG9zdGluZy8yMDA4LzEwL1NlcnZpY2VDb25maWd1cm F0aW9uIiBzZXJ2aWNlTmFtZT0iIiBvc0ZhbWlseT0iMSIgb3NWZXJzaW9uPSIqIj4KICA8Um9sZSBuYW 1lPSJXZWJSb2xlMSI+CiAgICA8Q29uZmlndXJhdGlvblNldHRpbmdzPgogICAgICA8U2V0dGluZyBuYW 1lPSJNaWNyb3NvZnQuV2luZG93c0F6dXJlLlBsdWdpbnMuRGlhZ25vc3RpY3MuQ29ubmVjdGlvblN0cm luZyIgdmFsdWU9IlVzZURldmVsb3BtZW50U3RvcmFnZT10cnVlIi8+CiAgICA8L0NvbmZpZ3VyYXRpb2 5TZXR0aW5ncz4KICAgIDxJbnN0YW5jZXMgY291bnQ9IjIiLz4KICAgIDxDZXJ0aWZpY2F0ZXMvPgogID wvUm9sZT4KPC9TZXJ2aWNlQ29uZmlndXJhdGlvbj4K</Configuration> </ChangeConfiguration> I'm passing it the following configuration: $configuration = '<?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" serviceName="" osFamily="1" osVersion="*"> <Role name="WebRole1"> <ConfigurationSettings> <Setting name="Microsoft.WindowsAzure.Plugins.Diagnostics.ConnectionString" value="UseDevelopmentStorage=true"/> </ConfigurationSettings> <Instances count="2"/> <Certificates/> </Role> </ServiceConfiguration>'; Does anyone know why this error occurs? I suspect it has something to do with encoding but not sure.

    Read the article

  • This task is currently locked by a running workflow and cannot be edited. Limitation to both Nintex and SPD workflow

    - by ybbest
    Note, this post is from Nintex Forum here. These limitations apply to both SharePoint designer Workflow and Nintex Workflow as Nintex using the SharePoint workflow engine. The common cause that I experience is that ‘parent’ workflow is generating more than one task at once. This is common as you can have multiple approvers for certain approval process. You could also have workflow running when the task is created, one of the common scenario is you would like to set a custom column value in your approval task. For me this is huge limitation, as Nintex lover I really hope Nintex could solve this problem with Microsoft going forward. Introduction “This task is currently locked by a running workflow and cannot be edited” is a common message that is seen when an error occurs while the SharePoint workflow engine is processing a task item associated with a workflow. When a workflow processes a task normally, the following sequence of events is expected to occur: 1.       The process begins. 2.       The workflow places a ‘lock’ on the task so nothing else can change the values while the workflow is processing. 3.       The workflow processes the task. 4.       The lock is released when the task processing is finished. When the message is encountered, it usually indicates that an error occurred between step 2 and 4. As a result, the lock is never released. Therefore, the ‘task locked’ message is not an error itself, rather a symptom of another error – the ‘task locked’ message does not indicate what went wrong. In most cases, once this message is encountered, the workflow cannot be made to continue and must be terminated and started again. The following is a guide that can help troubleshoot the cause of these messages.  Some initial observations to narrow down the potential causes are: Is the error consistent or intermittent? When the error is consistent, it will happen every time the workflow is run. When it is intermittent, it may happen regularly, but not every time. Does the error occur the first time the user tries to respond to a task, or do they respond and notice the workflow does not continue, and when they respond again the error occurs? If the message is present when the user first responds to the task, the issue would have occurred when the task was created. Otherwise, it would have occurred when the user attempted to respond to the task. Causes Modifying the task list A cause of this error appearing consistently the first time a user tries to respond to a task is a modification to the default task list schema. For example, changing the ‘Assigned to’ field in a task list to be a multiple selection will cause the behaviour. Deleting the workflow task then restoring it from the Recycle bin If you start a workflow, delete the workflow task then restore it from the Recycle Bin in SharePoint, the workflow will fail with the ‘task locked’ error.  This is confirmed behaviour whether using a SharePoint Designer or a Nintex workflow.  You will need to terminate the workflow and start it again. Parallel simultaneous responses A cause of this error appearing inconsistently is multiple users responding to tasks in parallel at the same time. In this scenario, one task will complete correctly and the other will not process. When the user tries again, the ‘task locked’ message will display. Nintex included a workaround for this issue in build 11000. In build 11000 and later, one of the users will receive a message on the task form when they attempt to respond, stating that they need to try again in a few moments. Additional processing on the task A cause of this error appearing consistently and inconsistently is having an additional system running on the items in the task list. Some examples include: a workflow running on the task list, an event receiver running on the task list or another automated process querying and updating workflow tasks. Note: This Microsoft help article (http://office.microsoft.com/en-us/sharepointdesigner/HA102376561033.aspx#5) explains creating a workflow that runs on the task list to update a field on the task. Our experience shows that this causes the ‘Task Locked’ issues when the ‘parent’ workflow is generating more than one task at once. Isolated system error If the error is a rare event, or a ‘one off’ event, then an isolated system error may have occurred. For example, if there is a database connectivity issue while the workflow is processing the task response, the task will lock. In this case, the user will respond to a task but the workflow will not continue. When they respond again, the ‘task locked’ message will display. In this case, there will be an error in the SharePoint ULS Logs at the time that the user originally responded. Temporary delay while workflow processes If the workflow is taking a long time to process after a user submits a task, they may notice and try to respond to the task again. They will see the task locked error, but after a number of attempts (or after waiting some time) the task response page eventually indicates the task has been responded to. In this case, nothing actually went wrong, and the error message gives an accurate indication of what is happening – the workflow temporarily locked the task while it was processing. This scenario may occur in a very large workflow, or after the SharePoint application pool has just started. Modifying the task via a web service with an invalid url If the Nintex Workflow web service is used to respond to or delegate a task, the site context part of the url must be a valid alternative access mapping url. For example, if you access the web service via the IP address of the SharePoint server, and the IP address is not a valid AAM, the task can become locked. The workflow has become stuck without any apparent errors This behaviour can occur as a result of a bug in the SharePoint 2010 workflow engine.  If you do not have the August 2010 Cumulative Update (or later) for SharePoint, and your workflow uses delays, “Flexi-task”, State machine”, “Task Reminder” actions or variables, you could be affected. Check the SharePoint 2010 Updates site here: http://technet.microsoft.com/en-us/sharepoint/ff800847.  The October CU is recommended http://support.microsoft.com/kb/2553031.   The fix is described as “Consider the following scenario. You add a Delay activity to a workflow. Then, you set the duration for the Delay activity. You deploy the workflow in SharePoint Foundation 2010. In this scenario, the workflow is not resumed after the duration of the Delay activity”. If you find this is occurring in your environment, install the October CU, terminate all the running workflows affected and run them afresh. Investigative steps The first step to isolate the issue is to create a new task list on the site and configure the workflow to use it.  Any customizations that were made to the original task list should not be made to the new task list. If the new task list eliminates the issue, then the cause can be attributed to the original task list or a change that was made to it. To change the task list that the workflow uses: In Workflow Designer select Settings -> Startup Options Then configure the task list as required If any of the scenarios above do not help, check the SharePoint logs for any messages with a category of ‘Workflow Infrastructure’. Conclusion The information in this article has been gathered from observations and investigations by Nintex. The sources of these issues are the underlying SharePoint workflow engine. This article will be updated if further causes are discovered. From <http://connect.nintex.com/forums/thread/6503.aspx>

    Read the article

  • Week in Geek: New Security Flaw Confirmed for Internet Explorer Edition

    - by Asian Angel
    This week we learned how to use a PC to stay entertained while traveling for the holidays, create quality photo prints with free software, share links between any browser and any smartphone, create perfect Christmas photos using How-To Geek’s 10 best how-to photo guides, and had fun decorating Firefox with a collection of Holiday 2010 Personas themes. Photo by Repoort. Random Geek Links Photo by Asian Angel. Critical 0-Day Flaw Affects All Internet Explorer Versions, Microsoft Warns Microsoft has confirmed a zero-day vulnerability affecting all supported versions of Internet Explorer, including IE8, IE7 and IE6. Note: Article contains link to Microsoft Security Advisory detailing two work-arounds until a security update is released. Hackers targeting human rights, indie media groups Hackers are increasingly hitting the Web sites of human rights and independent media groups in an attempt to silence them, says a new study released this week by Harvard University’s Berkman Center for Internet & Society. OpenBSD: audits give no indication of back doors So far, the analyses of OpenBSD’s crypto and IPSec code have not provided any indication that the system contains back doors for listening to encrypted VPN connections. But the developers have already found two bugs during their current audits. Sophos: Beware Facebook’s new facial-recognition feature Facebook’s new facial recognition software might result in undesirable photos of users being circulated online, warned a security expert, who urged users to keep abreast with the social network’s privacy settings to prevent the abovementioned scenario from becoming a reality. Microsoft withdraws flawed Outlook update Microsoft has withdrawn update KB2412171 for Outlook 2007, released last Patch Tuesday, after a number of user complaints. Skype: Millions still without service Skype was still working to right itself going into the holiday weekend from a major outage that began this past Wednesday. Mozilla improves sync setup and WebGL in Firefox 4 beta 8 Firefox 4.0 beta 8 brings better support for WebGL and introduces an improved setup process for Firefox Sync that simplifies the steps for configuring the synchronization service across multiple devices. Chrome OS the litmus test for cloud The success or failure of Google’s browser-oriented Chrome OS will be the litmus test to decide if the cloud is capable of addressing user needs for content and services, according to a new Ovum report released Monday. FCC Net neutrality rules reach mobile apps The Federal Communications Commission (FCC) finally released its long-expected regulations on Thursday and the related explanations total a whopping 194 pages. One new item that was not previously disclosed: mobile wireless providers can’t block “applications that compete with the provider’s” own voice or video telephony services. KDE and the Document Foundation join Open Invention Network The KDE e.V. and the Document Foundation (TDF) have both joined the Open Invention Network (OIN) as licensees, expanding the organization’s roster of supporters. Report: SEC looks into Hurd’s ousting from HP The scandal surrounding Mark Hurd’s departure from the world’s largest technology company in August has officially drawn attention from the U.S. Securities and Exchange Commission. Report: Google requests delay of new Google TVs Google TV is apparently encountering a bit of static that has resulted in a programming change. Geek Video of the Week This week we have a double dose of geeky video goodness for you with the original Mac vs PC video and the trailer for the sequel. Photo courtesy of Peacer. Mac vs PC Photo courtesy of Peacer. Mac vs PC 2 Trailer Random TinyHacker Links Awesome Tools To Extract Audio From Video Here’s a list of really useful, and free tools to rip audio from videos. Getting Your iPhone Out of Recovery Mode Is your iPhone stuck in recovery mode? This tutorial will help you get it out of that state. Google Shared Spaces Quickly create a shared space and collaborate with friends online. McAfee Internet Security 2011 – Upgrade not worthy of a version change McAfee has released their 2011 version of security products. And as this review details, the upgrades are minimal when compared to their 2010 products. For more information, check out the review. 200 Countries Plotted Hans Rosling’s famous lectures combine enormous quantities of public data with a sport’s commentator’s style to reveal the story of the world’s past, present and future development. Now he explores stats in a way he has never done before – using augmented reality animation. Super User Questions Enjoy looking through this week’s batch of popular questions and answers from Super User. How to restore windows 7 to a known working state every time it boots? Is there an easy way to mass-transfer all files between two computers? Coffee spilled inside computer, damaged hard drive Computer does not boot after ram upgrade Keyboard not detected when trying to install Ubuntu 10.10 How-To Geek Weekly Article Recap Have you had a super busy week while preparing for the holiday weekend? Then here is your chance to get caught up on your reading with our five hottest articles for the week. Ask How-To Geek: Rescuing an Infected PC, Installing Bloat-free iTunes, and Taming a Crazy Trackpad How to Use the Avira Rescue CD to Clean Your Infected PC Eight Geektacular Christmas Projects for Your Day Off VirtualBox 4.0 Rocks Extensions and a Simplified GUI Ask the Readers: How Many Monitors Do You Use with Your Computer? One Year Ago on How-To Geek Here are more great articles from one year ago for you to read and enjoy during the holiday break. Enjoy Distraction-Free Writing with WriteMonkey Shutter is a State of Art Screenshot Tool for Ubuntu Get Hex & RGB Color Codes the Easy Way Find User Scripts for Your Favorite Websites the Easy Way Access Your Unsorted Bookmarks the Easy Way (Firefox) The Geek Note That “wraps” things up for this week and we hope that everyone enjoys the rest of their holiday break! Found a great tip during the break? Then be sure to send it in to us at [email protected]. Photo by ArSiSa7. Latest Features How-To Geek ETC How to Use the Avira Rescue CD to Clean Your Infected PC The Complete List of iPad Tips, Tricks, and Tutorials Is Your Desktop Printer More Expensive Than Printing Services? 20 OS X Keyboard Shortcuts You Might Not Know HTG Explains: Which Linux File System Should You Choose? HTG Explains: Why Does Photo Paper Improve Print Quality? Simon’s Cat Explores the Christmas Tree! [Video] The Outdoor Lights Scene from National Lampoon’s Christmas Vacation [Video] The Famous Home Alone Pizza Delivery Scene [Classic Video] Chronicles of Narnia: The Voyage of the Dawn Treader Theme for Windows 7 Cardinal and Rabbit Sharing a Tree on a Cold Winter Morning Wallpaper An Alternate Star Wars Christmas Special [Video]

    Read the article

  • ASP.NET MVC Paging/Sorting/Filtering a list using ModelMetadata

    - by rajbk
    This post looks at how to control paging, sorting and filtering when displaying a list of data by specifying attributes in your Model using the ASP.NET MVC framework and the excellent MVCContrib library. It also shows how to hide/show columns and control the formatting of data using attributes.  This uses the Northwind database. A sample project is attached at the end of this post. Let’s start by looking at a class called ProductViewModel. The properties in the class are decorated with attributes. The OrderBy attribute tells the system that the Model can be sorted using that property. The SearchFilter attribute tells the system that filtering is allowed on that property. Filtering type is set by the  FilterType enum which currently supports Equals and Contains. The ScaffoldColumn property specifies if a column is hidden or not The DisplayFormat specifies how the data is formatted. public class ProductViewModel { [OrderBy(IsDefault = true)] [ScaffoldColumn(false)] public int? ProductID { get; set; }   [SearchFilter(FilterType.Contains)] [OrderBy] [DisplayName("Product Name")] public string ProductName { get; set; }   [OrderBy] [DisplayName("Unit Price")] [DisplayFormat(DataFormatString = "{0:c}")] public System.Nullable<decimal> UnitPrice { get; set; }   [DisplayName("Category Name")] public string CategoryName { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? CategoryID { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? SupplierID { get; set; }   [OrderBy] public bool Discontinued { get; set; } } Before we explore the code further, lets look at the UI.  The UI has a section for filtering the data. The column headers with links are sortable. Paging is also supported with the help of a pager row. The pager is rendered using the MVCContrib Pager component. The data is displayed using a customized version of the MVCContrib Grid component. The customization was done in order for the Grid to be aware of the attributes mentioned above. Now, let’s look at what happens when we perform actions on this page. The diagram below shows the process: The form on the page has its method set to “GET” therefore we see all the parameters in the query string. The query string is shown in blue above. This query gets routed to an action called Index with parameters of type ProductViewModel and PageSortOptions. The parameters in the query string get mapped to the input parameters using model binding. The ProductView object created has the information needed to filter data while the PageAndSorting object is used for paging and sorting the data. The last block in the figure above shows how the filtered and paged list is created. We receive a product list from our product repository (which is of type IQueryable) and first filter it by calliing the AsFiltered extension method passing in the productFilters object and then call the AsPagination extension method passing in the pageSort object. The AsFiltered extension method looks at the type of the filter instance passed in. It skips properties in the instance that do not have the SearchFilter attribute. For properties that have the SearchFilter attribute, it adds filter expression trees to filter against the IQueryable data. The AsPagination extension method looks at the type of the IQueryable and ensures that the column being sorted on has the OrderBy attribute. If it does not find one, it looks for the default sort field [OrderBy(IsDefault = true)]. It is required that at least one attribute in your model has the [OrderBy(IsDefault = true)]. This because a person could be performing paging without specifying an order by column. As you may recall the LINQ Skip method now requires that you call an OrderBy method before it. Therefore we need a default order by column to perform paging. The extension method adds a order expressoin tree to the IQueryable and calls the MVCContrib AsPagination extension method to page the data. Implementation Notes Auto Postback The search filter region auto performs a get request anytime the dropdown selection is changed. This is implemented using the following jQuery snippet $(document).ready(function () { $("#productSearch").change(function () { this.submit(); }); }); Strongly Typed View The code used in the Action method is shown below: public ActionResult Index(ProductViewModel productFilters, PageSortOptions pageSortOptions) { var productPagedList = productRepository.GetProductsProjected().AsFiltered(productFilters).AsPagination(pageSortOptions);   var productViewFilterContainer = new ProductViewFilterContainer(); productViewFilterContainer.Fill(productFilters.CategoryID, productFilters.SupplierID, productFilters.ProductName);   var gridSortOptions = new GridSortOptions { Column = pageSortOptions.Column, Direction = pageSortOptions.Direction };   var productListContainer = new ProductListContainerModel { ProductPagedList = productPagedList, ProductViewFilterContainer = productViewFilterContainer, GridSortOptions = gridSortOptions };   return View(productListContainer); } As you see above, the object that is returned to the view is of type ProductListContainerModel. This contains all the information need for the view to render the Search filter section (including dropdowns),  the Html.Pager (MVCContrib) and the Html.Grid (from MVCContrib). It also stores the state of the search filters so that they can recreate themselves when the page reloads (Viewstate, I miss you! :0)  The class diagram for the container class is shown below.   Custom MVCContrib Grid The MVCContrib grid default behavior was overridden so that it would auto generate the columns and format the columns based on the metadata and also make it aware of our custom attributes (see MetaDataGridModel in the sample code). The Grid ensures that the ShowForDisplay on the column is set to true This can also be set by the ScaffoldColumn attribute ref: http://bradwilson.typepad.com/blog/2009/10/aspnet-mvc-2-templates-part-2-modelmetadata.html) Column headers are set using the DisplayName attribute Column sorting is set using the OrderBy attribute. The data is formatted using the DisplayFormat attribute. Generic Extension methods for Sorting and Filtering The extension method AsFiltered takes in an IQueryable<T> and uses expression trees to query against the IQueryable data. The query is constructed using the Model metadata and the properties of the T filter (productFilters in our case). Properties in the Model that do not have the SearchFilter attribute are skipped when creating the filter expression tree.  It returns an IQueryable<T>. The extension method AsPagination takes in an IQuerable<T> and first ensures that the column being sorted on has the OrderBy attribute. If not, we look for the default OrderBy column ([OrderBy(IsDefault = true)]). We then build an expression tree to sort on this column. We finally hand off the call to the MVCContrib AsPagination which returns an IPagination<T>. This type as you can see in the class diagram above is passed to the view and used by the MVCContrib Grid and Pager components. Custom Provider To get the system to recognize our custom attributes, we create our MetadataProvider as mentioned in this article (http://bradwilson.typepad.com/blog/2010/01/why-you-dont-need-modelmetadataattributes.html) protected override ModelMetadata CreateMetadata(IEnumerable<Attribute> attributes, Type containerType, Func<object> modelAccessor, Type modelType, string propertyName) { ModelMetadata metadata = base.CreateMetadata(attributes, containerType, modelAccessor, modelType, propertyName);   SearchFilterAttribute searchFilterAttribute = attributes.OfType<SearchFilterAttribute>().FirstOrDefault(); if (searchFilterAttribute != null) { metadata.AdditionalValues.Add(Globals.SearchFilterAttributeKey, searchFilterAttribute); }   OrderByAttribute orderByAttribute = attributes.OfType<OrderByAttribute>().FirstOrDefault(); if (orderByAttribute != null) { metadata.AdditionalValues.Add(Globals.OrderByAttributeKey, orderByAttribute); }   return metadata; } We register our MetadataProvider in Global.asax.cs. protected void Application_Start() { AreaRegistration.RegisterAllAreas();   RegisterRoutes(RouteTable.Routes);   ModelMetadataProviders.Current = new MvcFlan.QueryModelMetaDataProvider(); } Bugs, Comments and Suggestions are welcome! You can download the sample code below. This code is purely experimental. Use at your own risk. Download Sample Code (VS 2010 RTM) MVCNorthwindSales.zip

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^d{3}-d{2}-d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^d{3}-d{2}-d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • Adding Volcanos and Options - Earthquake Locator, part 2

    - by Bobby Diaz
    Since volcanos are often associated with earthquakes, and vice versa, I decided to show recent volcanic activity on the Earthquake Locator map.  I am pulling the data from a website created for a joint project between the Smithsonian's Global Volcanism Program and the US Geological Survey's Volcano Hazards Program, found here.  They provide a Weekly Volcanic Activity Report as an RSS feed.   I started implementing this new functionality by creating a new Volcano entity in the domain model and adding the following to the EarthquakeService class (I also factored out the common reading/parsing helper methods to a separate FeedReader class that can be used by multiple domain service classes):           private static readonly string VolcanoFeedUrl =             ConfigurationManager.AppSettings["VolcanoFeedUrl"];           /// <summary>         /// Gets the volcano data for the previous week.         /// </summary>         /// <returns>A queryable collection of <see cref="Volcano"/> objects.</returns>         public IQueryable<Volcano> GetVolcanos()         {             var feed = FeedReader.Load(VolcanoFeedUrl);             var list = new List<Volcano>();               if ( feed != null )             {                 foreach ( var item in feed.Items )                 {                     var quake = CreateVolcano(item);                     if ( quake != null )                     {                         list.Add(quake);                     }                 }             }               return list.AsQueryable();         }           /// <summary>         /// Creates a <see cref="Volcano"/> object for each item in the RSS feed.         /// </summary>         /// <param name="item">The RSS item.</param>         /// <returns></returns>         private Volcano CreateVolcano(SyndicationItem item)         {             Volcano volcano = null;             string title = item.Title.Text;             string desc = item.Summary.Text;             double? latitude = null;             double? longitude = null;               FeedReader.GetGeoRssPoint(item, out latitude, out longitude);               if ( !String.IsNullOrEmpty(title) )             {                 title = title.Substring(0, title.IndexOf('-'));             }             if ( !String.IsNullOrEmpty(desc) )             {                 desc = String.Join("\n\n", desc                         .Replace("<p>", "")                         .Split(                             new string[] { "</p>" },                             StringSplitOptions.RemoveEmptyEntries)                         .Select(s => s.Trim())                         .ToArray())                         .Trim();             }               if ( latitude != null && longitude != null )             {                 volcano = new Volcano()                 {                     Id = item.Id,                     Title = title,                     Description = desc,                     Url = item.Links.Select(l => l.Uri.OriginalString).FirstOrDefault(),                     Latitude = latitude.GetValueOrDefault(),                     Longitude = longitude.GetValueOrDefault()                 };             }               return volcano;         } I then added the corresponding LoadVolcanos() method and Volcanos collection to the EarthquakeViewModel class in much the same way I did with the Earthquakes in my previous article in this series. Now that I am starting to add more information to the map, I wanted to give the user some options as to what is displayed and allowing them to choose what gets turned off.  I have updated the MainPage.xaml to look like this:   <UserControl x:Class="EarthquakeLocator.MainPage"     xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"     xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"     xmlns:d="http://schemas.microsoft.com/expression/blend/2008"     xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"     xmlns:basic="clr-namespace:System.Windows.Controls;assembly=System.Windows.Controls"     xmlns:bing="clr-namespace:Microsoft.Maps.MapControl;assembly=Microsoft.Maps.MapControl"     xmlns:vm="clr-namespace:EarthquakeLocator.ViewModel"     mc:Ignorable="d" d:DesignWidth="640" d:DesignHeight="480" >     <UserControl.Resources>         <DataTemplate x:Key="EarthquakeTemplate">             <Ellipse Fill="Red" Stroke="Black" StrokeThickness="1"                      Width="{Binding Size}" Height="{Binding Size}"                      bing:MapLayer.Position="{Binding Location}"                      bing:MapLayer.PositionOrigin="Center">                 <ToolTipService.ToolTip>                     <StackPanel>                         <TextBlock Text="{Binding Title}" FontSize="14" FontWeight="Bold" />                         <TextBlock Text="{Binding UtcTime}" />                         <TextBlock Text="{Binding LocalTime}" />                         <TextBlock Text="{Binding DepthDesc}" />                     </StackPanel>                 </ToolTipService.ToolTip>             </Ellipse>         </DataTemplate>           <DataTemplate x:Key="VolcanoTemplate">             <Polygon Fill="Gold" Stroke="Black" StrokeThickness="1" Points="0,10 5,0 10,10"                      bing:MapLayer.Position="{Binding Location}"                      bing:MapLayer.PositionOrigin="Center"                      MouseLeftButtonUp="Volcano_MouseLeftButtonUp">                 <ToolTipService.ToolTip>                     <StackPanel>                         <TextBlock Text="{Binding Title}" FontSize="14" FontWeight="Bold" />                         <TextBlock Text="Click icon for more information..." />                     </StackPanel>                 </ToolTipService.ToolTip>             </Polygon>         </DataTemplate>     </UserControl.Resources>       <UserControl.DataContext>         <vm:EarthquakeViewModel AutoLoadData="True" />     </UserControl.DataContext>       <Grid x:Name="LayoutRoot">           <bing:Map x:Name="map" CredentialsProvider="--Your-Bing-Maps-Key--"                   Center="{Binding MapCenter, Mode=TwoWay}"                   ZoomLevel="{Binding ZoomLevel, Mode=TwoWay}">               <bing:MapItemsControl ItemsSource="{Binding Earthquakes}"                                   ItemTemplate="{StaticResource EarthquakeTemplate}" />               <bing:MapItemsControl ItemsSource="{Binding Volcanos}"                                   ItemTemplate="{StaticResource VolcanoTemplate}" />         </bing:Map>           <basic:TabControl x:Name="tabs" VerticalAlignment="Bottom" MaxHeight="25" Opacity="0.7">             <basic:TabItem Margin="90,0,-90,0" MouseLeftButtonUp="TabItem_MouseLeftButtonUp">                 <basic:TabItem.Header>                     <TextBlock x:Name="txtHeader" Text="Options"                                FontSize="13" FontWeight="Bold" />                 </basic:TabItem.Header>                   <StackPanel Orientation="Horizontal">                     <TextBlock Text="Earthquakes:" FontWeight="Bold" Margin="3" />                     <StackPanel Margin="3">                         <CheckBox Content=" &lt; 4.0"                                   IsChecked="{Binding ShowLt4, Mode=TwoWay}" />                         <CheckBox Content="4.0 - 4.9"                                   IsChecked="{Binding Show4s, Mode=TwoWay}" />                         <CheckBox Content="5.0 - 5.9"                                   IsChecked="{Binding Show5s, Mode=TwoWay}" />                     </StackPanel>                       <StackPanel Margin="10,3,3,3">                         <CheckBox Content="6.0 - 6.9"                                   IsChecked="{Binding Show6s, Mode=TwoWay}" />                         <CheckBox Content="7.0 - 7.9"                                   IsChecked="{Binding Show7s, Mode=TwoWay}" />                         <CheckBox Content="8.0 +"                                   IsChecked="{Binding ShowGe8, Mode=TwoWay}" />                     </StackPanel>                       <TextBlock Text="Other:" FontWeight="Bold" Margin="50,3,3,3" />                     <StackPanel Margin="3">                         <CheckBox Content="Volcanos"                                   IsChecked="{Binding ShowVolcanos, Mode=TwoWay}" />                     </StackPanel>                 </StackPanel>               </basic:TabItem>         </basic:TabControl>       </Grid> </UserControl> Notice that I added a VolcanoTemplate that uses a triangle-shaped Polygon to represent the Volcano locations, and I also added a second <bing:MapItemsControl /> tag to the map to bind to the Volcanos collection.  The TabControl found below the map houses the options panel that will present the user with several checkboxes so they can filter the different points based on type and other properties (i.e. Magnitude).  Initially, the TabItem is collapsed to reduce it's footprint, but the screen shot below shows the options panel expanded to reveal the available settings:     I have updated the Source Code and Live Demo to include these new features.   Happy Mapping!

    Read the article

  • Looking for good Regex book

    - by Cyberherbalist
    I've been trying to get a good grounding with Regular Expressions, and am looking for a single book to do so. I've been going through Amazon.com's listings on this subject, and I've identified a few possibilities, but am unsure which would be best for a C# developer who can write very simple Regexs, but wants to learn more. On a scale of 0-9 where 0 is knowing how to spell "Regex" but nothing else, and 9 where I could write a book on the subject out of my own head, I would place myself at 2. Which of the following would be your choice: Mastering Regular Expressions by Jeffrey E F Friedl Regular Expressions Cookbook by Jan Goyvaerts and Steven Levithan Sams Teach Yourself Regular Expressions in 10 Minutes by Ben Forta Beginning Regular Expressions (Programmer to Programmer) by Andrew Watt Regular Expression Recipes for Windows Developers: A Problem-Solution Approach by Nathan A. Good Regular Expression Recipes: A Problem-Solution Approach by Nathan A. Good Now, according to Amazon, "Regular Expressions Cookbook" (REC) above is rated the highest according to user ratings, but only based on 20 reviews. The first one, "Mastering Regular Expressions" (MRE) is rated second based on 140 reviews. This alone suggests that MRE might be by far the best one. But is it best for a relative beginner? Would I perhaps be better getting "Beginning Regular Expressions" (BRE) instead, to start with? Please help me resolve my confusion!

    Read the article

  • Win a place at a SQL Server Masterclass with Kimberly Tripp and Paul Randal

    - by Testas
    The top things YOU need to know about managing SQL Server - in one place, on one day - presented by two of the best SQL Server industry trainers!And you could be there courtesy of UK SQL Server User Group and SQL Server Magazine! This week the UK SQL Server User Group will provide you with details of how to win a place at this must see seminar   You can also register for the seminar yourself at:www.regonline.co.uk/kimtrippsql More information about the seminar   Where: Radisson Edwardian Heathrow Hotel, London When: Thursday 17th June 2010 This one-day MasterClass will focus on many of the top issues companies face when implementing and maintaining a SQL Server-based solution. In the case where a company has no dedicated DBA, IT managers sometimes struggle to keep the data tier performing well and the data available. This can be especially troublesome when the development team is unfamiliar with the affect application design choices have on database performance. The Microsoft SQL Server MasterClass 2010 is presented by Paul S. Randal and Kimberly L. Tripp, two of the most experienced and respected people in the SQL Server world. Together they have over 30 years combined experience working with SQL Server in the field, and on the SQL Server product team itself. This is a unique opportunity to hear them present at a UK event which will:·         Debunk many of the ingrained misconceptions around SQL Server's behaviour   ·         Show you disaster recovery techniques critical to preserving your company's life-blood - the data   ·         Explain how a common application design pattern can wreak havoc in the database ·         Walk through the top-10 points to follow around operations and maintenance for a well-performing and available data tier! Please Note: Agenda may be subject to changeSessions AbstractsKEYNOTE: Bridging the Gap Between Development and Production  Applications are commonly developed with little regard for how design choices will affect performance in production. This is often because developers don't realize the implications of their design on how SQL Server will be able to handle a high workload (e.g. blocking, fragmentation) and/or because there's no full-time trained DBA that can recognize production problems and help educate developers. The keynote sets the stage for the rest of the day. Discussing some of the issues that can arise, explaining how some can be avoided and highlighting some of the features in SQL 2008 that can help developers and DBAs make better use of SQL Server, and troubleshoot when things go wrong.  SESSION ONE: SQL Server MythbustersIt's amazing how many myths and misconceptions have sprung up and persisted over the years about SQL Server - after many years helping people out on forums, newsgroups, and customer engagements, Paul and Kimberly have heard it all. Are there really non-logged operations? Can interrupting shrinks or rebuilds cause corruption? Can you override the server's MAXDOP setting? Will the server always do a table-scan to get a row count? Many myths lead to poor design choices and inappropriate maintenance practices so these are just a few of many, many myths that Paul and Kimberly will debunk in this fast-paced session on how SQL Server operates and should be managed and maintained. SESSION TWO: Database Recovery Techniques Demo-Fest Even if a company has a disaster recovery strategy in place, they need to practice to make sure that the plan will work when a disaster does strike. In this fast-paced demo session Paul and Kimberly will repeatedly do nasty things to databases and then show how they are recovered - demonstrating many techniques that can be used in production for disaster recovery. Not for the faint-hearted! SESSION THREE: GUIDs: Use, Abuse, and How To Move Forward Since the addition of the GUID (Microsoft’s implementation of the UUID), my life as a consultant and "tuner" has been busy. I’ve seen databases designed with GUID keys run fairly well with small workloads but completely fall over and fail because they just cannot scale. And, I know why GUIDs are chosen - it simplifies the handling of parent/child rows in your batches so you can reduce round-trips or avoid dealing with identity values. And, yes, sometimes it's even for distributed databases and/or security that GUIDs are chosen. I'm not entirely against ever using a GUID but overusing and abusing GUIDs just has to be stopped! Please, please, please let me give you better solutions and explanations on how to deal with your parent/child rows, round-trips and clustering keys! SESSION 4: Essential Database MaintenanceIn this session, Paul and Kimberly will run you through their top-ten database maintenance recommendations, with a lot of tips and tricks along the way. These are distilled from almost 30 years combined experience working with SQL Server customers and are geared towards making your databases more performant, more available, and more easily managed (to save you time!). Everything in this session will be practical and applicable to a wide variety of databases. Topics covered include: backups, shrinks, fragmentation, statistics, and much more! Focus will be on 2005 but we'll explain some of the key differences for 2000 and 2008 as well.    Speaker Biographies     Paul S.Randal  Kimberley L. Tripp Paul and Kimberly are a husband-and-wife team who own and run SQLskills.com, a world-renowned SQL Server consulting and training company. They are both SQL Server MVPs and Microsoft Regional Directors, with over 30 years of combined experience on SQL Server. Paul worked on the SQL Server team for nine years in development and management roles, writing many of the DBCC commands, and ultimately with responsibility for core Storage Engine for SQL Server 2008. Paul writes extensively on his blog (SQLskills.com/blogs/Paul) and for TechNet Magazine, for which he is also a Contributing Editor. Kimberly worked on the SQL Server team in the early 1990s as a tester and writer before leaving to found SQLskills and embrace her passion for teaching and consulting. Kimberly has been a staple at worldwide conferences since she first presented at TechEd in 1996, and she blogs at SQLskills.com/blogs/Kimberly. They have written Microsoft whitepapers and books for SQL Server 2000, 2005 and 2008, and are regular, top-rated presenters worldwide on database maintenance, high availability, disaster recovery, performance tuning, and SQL Server internals. Together they teach the SQL MCM certification and throughout Microsoft.In their spare time, they like to find frogfish in remote corners of the world.  

    Read the article

  • Optimize SUMMARIZE with ADDCOLUMNS in Dax #ssas #tabular #dax #powerpivot

    - by Marco Russo (SQLBI)
    If you started using DAX as a query language, you might have encountered some performance issues by using SUMMARIZE. The problem is related to the calculation you put in the SUMMARIZE, by adding what are called extension columns, which compute their value within a filter context defined by the rows considered in the group that the SUMMARIZE uses to produce each row in the output. Most of the time, for simple table expressions used in the first parameter of SUMMARIZE, you can optimize performance by removing the extended columns from the SUMMARIZE and adding them by using an ADDCOLUMNS function. In practice, instead of writing SUMMARIZE( <table>, <group_by_column>, <column_name>, <expression> ) you can write: ADDCOLUMNS(     SUMMARIZE( <table>, <group by column> ),     <column_name>, CALCULATE( <expression> ) ) The performance difference might be huge (orders of magnitude) but this optimization might produce a different semantic and in these cases it should not be used. A longer discussion of this topic is included in my Best Practices Using SUMMARIZE and ADDCOLUMNS article on SQLBI, which also include several details about the DAX syntax with extended columns. For example, did you know that you can create an extended column in SUMMARIZE and ADDCOLUMNS with the same name of existing measures? It is *not* a good thing to do, and by reading the article you will discover why. Enjoy DAX!

    Read the article

  • Unable to uninstall maas completely

    - by user210844
    I'm not able to uninstall MAAS sudo apt-get purge maas ; sudo apt-get autoremove Reading package lists... Done Building dependency tree Reading state information... Done Package 'maas' is not installed, so not removed 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1) Reading package lists... Done Building dependency tree Reading state information... Done 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

  • New Validation Attributes in ASP.NET MVC 3 Future

    - by imran_ku07
         Introduction:             Validating user inputs is an very important step in collecting information from users because it helps you to prevent errors during processing data. Incomplete or improperly formatted user inputs will create lot of problems for your application. Fortunately, ASP.NET MVC 3 makes it very easy to validate most common input validations. ASP.NET MVC 3 includes Required, StringLength, Range, RegularExpression, Compare and Remote validation attributes for common input validation scenarios. These validation attributes validates most of your user inputs but still validation for Email, File Extension, Credit Card, URL, etc are missing. Fortunately, some of these validation attributes are available in ASP.NET MVC 3 Future. In this article, I will show you how to leverage Email, Url, CreditCard and FileExtensions validation attributes(which are available in ASP.NET MVC 3 Future) in ASP.NET MVC 3 application.       Description:             First of all you need to download ASP.NET MVC 3 RTM Source Code from here. Then extract all files in a folder. Then open MvcFutures project from mvc3-rtm-sources\mvc3\src\MvcFutures folder. Build the project. In case, if you get compile time error(s) then simply remove the reference of System.Web.WebPages and System.Web.Mvc assemblies and add the reference of System.Web.WebPages and System.Web.Mvc 3 assemblies again but from the .NET tab and then build the project again, it will create a Microsoft.Web.Mvc assembly inside mvc3-rtm-sources\mvc3\src\MvcFutures\obj\Debug folder. Now we can use Microsoft.Web.Mvc assembly inside our application.             Create a new ASP.NET MVC 3 application. For demonstration purpose, I will create a dummy model UserInformation. So create a new class file UserInformation.cs inside Model folder and add the following code,   public class UserInformation { [Required] public string Name { get; set; } [Required] [EmailAddress] public string Email { get; set; } [Required] [Url] public string Website { get; set; } [Required] [CreditCard] public string CreditCard { get; set; } [Required] [FileExtensions(Extensions = "jpg,jpeg")] public string Image { get; set; } }             Inside UserInformation class, I am using Email, Url, CreditCard and FileExtensions validation attributes which are defined in Microsoft.Web.Mvc assembly. By default FileExtensionsAttribute allows png, jpg, jpeg and gif extensions. You can override this by using Extensions property of FileExtensionsAttribute class.             Then just open(or create) HomeController.cs file and add the following code,   public class HomeController : Controller { public ActionResult Index() { return View(); } [HttpPost] public ActionResult Index(UserInformation u) { return View(); } }             Next just open(or create) Index view for Home controller and add the following code,  @model NewValidationAttributesinASPNETMVC3Future.Model.UserInformation @{ ViewBag.Title = "Index"; Layout = "~/Views/Shared/_Layout.cshtml"; } <h2>Index</h2> <script src="@Url.Content("~/Scripts/jquery.validate.min.js")" type="text/javascript"></script> <script src="@Url.Content("~/Scripts/jquery.validate.unobtrusive.min.js")" type="text/javascript"></script> @using (Html.BeginForm()) { @Html.ValidationSummary(true) <fieldset> <legend>UserInformation</legend> <div class="editor-label"> @Html.LabelFor(model => model.Name) </div> <div class="editor-field"> @Html.EditorFor(model => model.Name) @Html.ValidationMessageFor(model => model.Name) </div> <div class="editor-label"> @Html.LabelFor(model => model.Email) </div> <div class="editor-field"> @Html.EditorFor(model => model.Email) @Html.ValidationMessageFor(model => model.Email) </div> <div class="editor-label"> @Html.LabelFor(model => model.Website) </div> <div class="editor-field"> @Html.EditorFor(model => model.Website) @Html.ValidationMessageFor(model => model.Website) </div> <div class="editor-label"> @Html.LabelFor(model => model.CreditCard) </div> <div class="editor-field"> @Html.EditorFor(model => model.CreditCard) @Html.ValidationMessageFor(model => model.CreditCard) </div> <div class="editor-label"> @Html.LabelFor(model => model.Image) </div> <div class="editor-field"> @Html.EditorFor(model => model.Image) @Html.ValidationMessageFor(model => model.Image) </div> <p> <input type="submit" value="Save" /> </p> </fieldset> } <div> @Html.ActionLink("Back to List", "Index") </div>             Now just run your application. You will find that both client side and server side validation for the above validation attributes works smoothly.                      Summary:             Email, URL, Credit Card and File Extension input validations are very common. In this article, I showed you how you can validate these input validations into your application. I explained this with an example. I am also attaching a sample application which also includes Microsoft.Web.Mvc.dll. So you can add a reference of Microsoft.Web.Mvc assembly directly instead of doing any manual work. Hope you will enjoy this article too.   SyntaxHighlighter.all()

    Read the article

  • What do you think of this generator syntax?

    - by ChaosPandion
    I've been working on an ECMAScript dialect for quite some time now and have reached a point where I am comfortable adding new language features. I would love to hear some thoughts and suggestions on the syntax. Example generator { yield 1; yield 2; yield 3; if (true) { yield break; } yield continue generator { yield 4; yield 5; yield 6; }; } Syntax GeneratorExpression:     generator  {  GeneratorBody  } GeneratorBody:     GeneratorStatementsopt GeneratorStatements:     StatementListopt GeneratorStatement GeneratorStatementsopt GeneratorStatement:     YieldStatement     YieldBreakStatement     YieldContinueStatement YieldStatement:     yield  Expression  ; YieldBreakStatement:     yield  break  ; YieldContinueStatement:     yield  continue  Expression  ; Semantics The YieldBreakStatement allows you to end iteration early. This helps avoid deeply indented code. You'll be able to write something like this: generator { yield something1(); if (condition1 && condition2) yield break; yield something2(); if (condition3 && condition4) yield break; yield something3(); } instead of: generator { yield something1(); if (!condition1 && !condition2) { yield something2(); if (!condition3 && !condition4) { yield something3(); } } } The YieldContinueStatement allows you to combine generators: function generateNumbers(start) { return generator { yield 1 + start; yield 2 + start; yield 3 + start; if (start < 100) { yield continue generateNumbers(start + 1); } }; }

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^\d{3}-\d{2}-\d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^\d{3}-\d{2}-\d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • Fragmented Log files could be slowing down your database

    - by Fatherjack
    Something that is sometimes forgotten by a lot of DBAs is the fact that database log files get fragmented in the same way that you get fragmentation in a data file. The cause is very different but the effect is the same – too much effort reading and writing data. Data files get fragmented as data is changed through normal system activity, INSERTs, UPDATEs and DELETEs cause fragmentation and most experienced DBAs are monitoring their indexes for fragmentation and dealing with it accordingly. However, you don’t hear about so many working on their log files. How can a log file get fragmented? I’m glad you asked. When you create a database there are at least two files created on the disk storage; an mdf for the data and an ldf for the log file (you can also have ndf files for extra data storage but that’s off topic for now). It is wholly possible to have more than one log file but in most cases there is little point in creating more than one as the log file is written to in a ‘wrap-around’ method (more on that later). When a log file is created at the time that a database is created the file is actually sub divided into a number of virtual log files (VLFs). The number and size of these VLFs depends on the size chosen for the log file. VLFs are also created in the space added to a log file when a log file growth event takes place. Do you have your log files set to auto grow? Then you have potentially been introducing many VLFs into your log file. Let’s get to see how many VLFs we have in a brand new database. USE master GO CREATE DATABASE VLF_Test ON ( NAME = VLF_Test, FILENAME = 'C:\Program Files\Microsoft SQL Server\MSSQL10.ROCK_2008\MSSQL\DATA\VLF_Test.mdf', SIZE = 100, MAXSIZE = 500, FILEGROWTH = 50 ) LOG ON ( NAME = VLF_Test_Log, FILENAME = 'C:\Program Files\Microsoft SQL Server\MSSQL10.ROCK_2008\MSSQL\DATA\VLF_Test_log.ldf', SIZE = 5MB, MAXSIZE = 250MB, FILEGROWTH = 5MB ); go USE VLF_Test go DBCC LOGINFO; The results of this are firstly a new database is created with specified files sizes and the the DBCC LOGINFO results are returned to the script editor. The DBCC LOGINFO results have plenty of interesting information in them but lets first note there are 4 rows of information, this relates to the fact that 4 VLFs have been created in the log file. The values in the FileSize column are the sizes of each VLF in bytes, you will see that the last one to be created is slightly larger than the others. So, a 5MB log file has 4 VLFs of roughly 1.25 MB. Lets alter the CREATE DATABASE script to create a log file that’s a bit bigger and see what happens. Alter the code above so that the log file details are replaced by LOG ON ( NAME = VLF_Test_Log, FILENAME = 'C:\Program Files\Microsoft SQL Server\MSSQL10.ROCK_2008\MSSQL\DATA\VLF_Test_log.ldf', SIZE = 1GB, MAXSIZE = 25GB, FILEGROWTH = 1GB ); With a bigger log file specified we get more VLFs What if we make it bigger again? LOG ON ( NAME = VLF_Test_Log, FILENAME = 'C:\Program Files\Microsoft SQL Server\MSSQL10.ROCK_2008\MSSQL\DATA\VLF_Test_log.ldf', SIZE = 5GB, MAXSIZE = 250GB, FILEGROWTH = 5GB ); This time we see more VLFs are created within our log file. We now have our 5GB log file comprised of 16 files of 320MB each. In fact these sizes fall into all the ranges that control the VLF creation criteria – what a coincidence! The rules that are followed when a log file is created or has it’s size increased are pretty basic. If the file growth is lower than 64MB then 4 VLFs are created If the growth is between 64MB and 1GB then 8 VLFs are created If the growth is greater than 1GB then 16 VLFs are created. Now the potential for chaos comes if the default values and settings for log file growth are used. By default a database log file gets a 1MB log file with unlimited growth in steps of 10%. The database we just created is 6 MB, let’s add some data and see what happens. USE vlf_test go -- we need somewhere to put the data so, a table is in order IF OBJECT_ID('A_Table') IS NOT NULL DROP TABLE A_Table go CREATE TABLE A_Table ( Col_A int IDENTITY, Col_B CHAR(8000) ) GO -- Let's check the state of the log file -- 4 VLFs found EXECUTE ('DBCC LOGINFO'); go -- We can go ahead and insert some data and then check the state of the log file again INSERT A_Table (col_b) SELECT TOP 500 REPLICATE('a',2000) FROM sys.columns AS sc, sys.columns AS sc2 GO -- insert 500 rows and we get 22 VLFs EXECUTE ('DBCC LOGINFO'); go -- Let's insert more rows INSERT A_Table (col_b) SELECT TOP 2000 REPLICATE('a',2000) FROM sys.columns AS sc, sys.columns AS sc2 GO 10 -- insert 2000 rows, in 10 batches and we suddenly have 107 VLFs EXECUTE ('DBCC LOGINFO'); Well, that escalated quickly! Our log file is split, internally, into 107 fragments after a few thousand inserts. The same happens with any logged transactions, I just chose to illustrate this with INSERTs. Having too many VLFs can cause performance degradation at times of database start up, log backup and log restore operations so it’s well worth keeping a check on this property. How do we prevent excessive VLF creation? Creating the database with larger files and also with larger growth steps and actively choosing to grow your databases rather than leaving it to the Auto Grow event can make sure that the growths are made with a size that is optimal. How do we resolve a situation of a database with too many VLFs? This process needs to be done when the database is under little or no stress so that you don’t affect system users. The steps are: BACKUP LOG YourDBName TO YourBackupDestinationOfChoice Shrink the log file to its smallest possible size DBCC SHRINKFILE(FileNameOfTLogHere, TRUNCATEONLY) * Re-size the log file to the size you want it to, taking in to account your expected needs for the coming months or year. ALTER DATABASE YourDBName MODIFY FILE ( NAME = FileNameOfTLogHere, SIZE = TheSizeYouWantItToBeIn_MB) * – If you don’t know the file name of your log file then run sp_helpfile while you are connected to the database that you want to work on and you will get the details you need. The resize step can take quite a while This is already detailed far better than I can explain it by Kimberley Tripp in her blog 8-Steps-to-better-Transaction-Log-throughput.aspx. The result of this will be a log file with a VLF count according to the bullet list above. Knowing when VLFs are being created By complete coincidence while I have been writing this blog (it’s been quite some time from it’s inception to going live) Jonathan Kehayias from SQLSkills.com has written a great article on how to track database file growth using Event Notifications and Service Broker. I strongly recommend taking a look at it as this is going to catch any sneaky auto grows that take place and let you know about them right away. Hassle free monitoring of VLFs If you are lucky or wise enough to be using SQL Monitor or another monitoring tool that let’s you write your own custom metrics then you can keep an eye on this very easily. There is a custom metric for VLFs (written by Stuart Ainsworth) already on the site and there are some others there are very useful so take a moment or two to look around while you are there. Resources MSDN – http://msdn.microsoft.com/en-us/library/ms179355(v=sql.105).aspx Kimberly Tripp from SQLSkills.com – http://www.sqlskills.com/BLOGS/KIMBERLY/post/8-Steps-to-better-Transaction-Log-throughput.aspx Thomas LaRock at Simple-Talk.com – http://www.simple-talk.com/sql/database-administration/monitoring-sql-server-virtual-log-file-fragmentation/ Disclosure I am a Friend of Red Gate. This means that I am more than likely to say good things about Red Gate DBA and Developer tools. No matter how awesome I make them sound, take the time to compare them with other products before you contact the Red Gate sales team to make your order.

    Read the article

< Previous Page | 313 314 315 316 317 318 319 320 321 322 323 324  | Next Page >