Search Results

Search found 28793 results on 1152 pages for 'line endings'.

Page 319/1152 | < Previous Page | 315 316 317 318 319 320 321 322 323 324 325 326  | Next Page >

• How to read iptables -L output?

  - by skrebbel

  I'm rather new to iptables, and I'm trying to understand its output. I tried to RTFM, but to no avail when it comes to little details like these. When iptables -vnL gives me a line such as: Chain INPUT (policy DROP 2199 packets, 304K bytes) I understand the first part: on incoming data, if the list below this line does not provide any exceptions, then the default policy is to DROP incoming packets. But what does the 2199 packets, 304K bytes part mean? Is that all the packets that were dropped? Is there any way to find out which packets that were, and where they came from? Thanks!

  Read the article

• Is drupal going to improve these small features ?

  - by Patrick

  Is drupal going to improve the following features ? 1) multi-line description for CCK fields such as images (at the moment I can only write in a line but a text-area would be better 2) thumbnails upload for CCK Video fields (so I can upload a thumbnails for each video if I cannot install ffmpeg on the server) 3) merge CCK Images and Videos in a single group. So my customer can order them in the same list by dragging and dropping them, and in my front-end I have them ordered in the same list. This would be very useful for me. Do you know if I can get some of theme with some modules maybe ? thanks

  Read the article

• Disabled annotation tools in Skim

  - by Kit

  Here's a portion of the toolbar in Skim In the Add Note section, why are the following tools disabled (dimmed)? Add New Highlight (A in the yellow box) Add New Underline (red line under A) Add New Strike Out (A struck out by red line) However, in the Tool Mode section, there is a drop down button (shown as active in the screenshot). To illustrate, I can select and use the Add New Underline tool, as well as the other tools I mentioned above, using the drop down button. But those tools are dimmed out in the Add Note section. Why? I have observed that the drop down button is just a duplicate of the Add Note section. Why not just enable all the buttons in the Add Note section and save the user from making an extra click just to bring down a list of tools? Is this because of some property of the presently open PDF, or what?

  Read the article

• Pressing 'Enter' doesn't really work in Firefox

  - by inkedmn

  When I'm typing just about anywhere in Firefox on OSX and press enter, it simply doesn't do anything. This includes typing in a textarea element (which should take the cursor to the next line), in a search form (which should submit the form). I'm typing this very question in Firefox right now and I'm unable to advance the cursor to the beginning of the next line. I have no clue what I did to make this happen, but it's kinda driving me insane. This is Firefox 3.6.3 under Mac OS X 10.6. Thanks!

  Read the article

• Proccess of carrying out a BER Test

  - by data

  I am subscribed to an ISP supplying a 3meg ADSL line. Lately (for the last 4 weeks) speeds have dropped from the usual average downstream speed of ~250kbps to just 0.14Mbps (according to speedtest.net) and employees are complaining about lack of access to the server. I have been calling customer support and logging calls for the last 3 weeks, but they have been unable to determine the source of the problem other carrying out a few bitstream tests and checking the DHCP renewal times. I am going to call back and suggest carrying out a BER test. What type of equipment is needed to carry out this test? I have access to a wide range of Cisco networking equipment. Other: We dont need a leased line as there are less than ten employees.

  Read the article

• Know any file compare utility for chunks of text?

  - by Belun

  Is there any file-compare utility-software that can help me compare chunks of text from two text files ? As in, I want to know what chunks of text that are in one file can be found again in the second file. What I need to do is more like a 'compare and search' operation, not just a compare line by line. I need this for finding common errors in application logs. Eg., I have a Java application and logs from two different days. I want to find out which stack-traces (that are actually chunks of text inside a text file) are common to both days.

  Read the article

• How to install php cli with pnctl alongside Zend Server

  - by fazy

  I have Zend Server CE 5.6 with PHP 5.2 running on Ubuntu 11.10. Now the need has arisen to run a command line PHP script that uses PHP's pnctl functionality. First of all, I had no PHP command line in my path, so I made a symlink from the Zend one: sudo ln -s /usr/local/zend/bin/php /usr/bin However, when I run my script, I now get this error: PHP Fatal error: Call to undefined function pcntl_fork() The Zend web control panel doesn't offer pnctl in the list of modules, so how do I get this functionality? Is it safe to use apt-get to install PHP directly, to run alongside the Zend instance? If so, how do I make sure I get version 5.2? I guess the following would pull in PHP 5.3: apt-get php5-cli I could probably muddle through but any pointers to help me avoid making a mess would be much appreciated!

  Read the article

• How to failover to local account on a cisco switch/router if radius server fails?

  - by 3d1l

  I have the following configuration on a switch that I testing for RADIUS authentication: aaa new-model aaa authenticaton login default group radius local aaa authentication enable default group radius enable aaa authorization exec default group radius local enable secret 5 XXXXXXXXX ! username admin secret 5 XXXXXXXXX ! ip radius source-interface FastEthernet0/1 radius-server host XXX.XXX.XXX.XXX auth-port 1812 acct-port 1813 key XXXXXXXXX radius-server retransmit 3 ! line con 0 line vty 5 15 Radius authentication is working just fine but if the server is not available I can not log into the router with the ADMIN account. What's wrong there? Thanks!

  Read the article

• What's the advantage of using a bash script for cron jobs?

  - by AlxVallejo

  From my understanding you can write your crons by editing crontab -e I've found several sources that instead refer to a bash script in the cron job, rather than writing a job line for line. Is the only benefit that you can consolidate many tasks into one cron job using a bash script? Additional question for a newbie: Editing crontab -e refers to one file correct? I've noticed that if I open crontab -e and close without editing, when I open the file again there is a different numerical extension such as: "/tmp/crontab.XXXXk1DEaM" 0L, 0C I though the crontab is stored in /var/spool/cron or /etc/crontab ?? Why would it store the cron in the tmp folder?

  Read the article

• Custom prompt doesn't work on Mac Terminal

  - by mareks

  I like to use a custom prompt (current path in blue) on my unix machine: export PS1='\[\e[0;34m\]\w \$\[\e[m\] ' But when I try to use it on Mac's terminal it doesn't work: it fails to detect the end of the prompt and overwrites the prompt when I type commands. This also happens when I'm inputting a long command where it wraps over the same line instead of starting a new line. I don't understand why this is the case since I use bash on both machines. Any suggestions on how to remedy this?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• How do I get `set show-all-if-ambiguous on` in my .inputrc to play nice with the Python interpreter?

  - by ysim

  I noticed that after I added the set show-all-if-ambiguous on line to my ~/.inputrc, whenever I pressed tab to indent a block, it would show me the bash Display all ... possibilities? (y or n) prompt, and leave me unable to indent the actual code. Is there any way to keep that line in my .inputrc but still have the tab key work as expected in the Python interpreter? This is in my VirtualBox Ubuntu 12.04 VM, if it matters. EDIT: Curiously, I now have a different issue with the Python shell that comes with Django -- when I press tab, I get Python tab completion, but only with one Tab press. I've opened a separate question here for it.

  Read the article

• PHPMyAdmin running very slow over internet but fine locally

  - by columbo

  I connect to PHPMyAdmin remotely on a Centos server using my local PC via Firefox. Usually it's fine but today it's really slow (2 minutes to load a page), sometimes timing out. Other connections to the server are fine. The SSH command line is as fast as ever as is the GNOME dekstop over SSH. In fact on the GNOME desktop I can run PHPMyAdmin locally from its browser and it's as quick as ever (which is a solution to the problem of course). I've checked the various log files and seen nothing unusual, I've logged into the MySQL command line and the database is running fine without any slowing what so ever. So it just seems to be slow when I access PHPMyAdmin on the server from the browser on my remote PC (I've tried IE and Firefox, both are slow). Has anyone experienced this or have any ideas what the issue could be. Connecting via CLI through tunnel works OK - problem is in phpMyAdmin for sure. Cheers

  Read the article

• How do I allow a (local) user to start/stop services with a scheduled task?

  - by Mulmoth

  Hi, on a Windows 2008 R2 server I have two small .cmd-scripts to start/stop a certain service. They look like this net start MyService and net stop MyService I want to execute these script via scheduled task, and I thought it would be best to create a local user for this job. The user is not member of the Administrators group. But the scripts fail with exit code 2. When I logon with this local user and try to execute these script in command line, I see a message like (maybe not exactly translated from german to english): Error code 5: Access denied It doesn't matter whether I start the command line as Administrator or not. How can this local user gain rights to do the job?

  Read the article

• Transfer disk image to larger/smaller disk

  - by forthrin

  I need to switch the hard drive on a 2006 iMac to a new SSD. I don't have the original installation CDs. I know I can order CDs from Apple, but this costs money. Someone told me it's possible to rip the image of the old drive and transfer to the new drive. If so, does the size of the new drive have to be exactly the same as the old? If not, my questions are: Is it possible to "stretch" the image from 120 MB disk to a 256 MB disk (numbers are examples)? If so, what is the command line for this? Likewise, is it possible to "shrink" an image from a larger disk (eg. 256 MB) to a smaller disk (eg. 120 MB), provided that the actual space used on the disk does not exceed 120 MB? How do you do this on the command line?

  Read the article

• Mass modify all php files on my server

  - by anslume

  I would like to delete a php code on all my php files on my debian server. indeed I would like to get rid of a line: eval(base64_decode("DQplcnJvcl9yZXBvcnR")); It's present in many of my phpfiles. That's why I would like to find a script which is going to look it up in all my php files and replace itwith nothing? Do you have any idea how i could do that ? I know how to do it on windows with some software (notepad++ is very useful) but no idea how can I do that in a command line through ssh Thanks for your answer, Ans

  Read the article

• Why does Notepad "randomly" make pasted text a smaller font size?

  - by Coldblackice

  Sometimes when I copy and paste text into Notepad, it will paste the text in the default Notepad font and size, however, the latter half of the pasted line will be multiple font sizes smaller. I'm stumped as to why this is happening. I wondered if it was perhaps some type of hidden formatting that was being copied into Notepad, but I believe that Notepad strips the formatting. I've subsequently taken the same text and tried copy and pasting it into URL bars and CMD prompts to strip any potential formatting (even though it was plaintext copied from web), and then re-pasted into Notepad, but it still leaves this phenomenon. Additionally, when resizing the Notepad window, it will change what portion of the line is default sized and downsized, as seen in the screenshot posted below. The three windows are actually the same Notepad window, each with a different resizing and the resulting text resizing.

  Read the article

• Copying List of Files Through Powershell

  - by Driftpeasant

  So I'm trying to copy 44k files from one server to another. My Powershell script is: Import-CSV f:\script\Listoffiles.csv | foreach $line {Move-item $_.Source $_.Destination} With the Format for the CSV: Source, Destination E:\folder1\folder2\file with space.txt, \\1.2.3.4\folder1\folder2\file with space.txt I keep getting: A positional parameter cannot be found that accepts argument '\\1.2.3.4\folder1\folder2\file'. At line:1 char:10 + move-item <<<< E:\folder1\folder2\file with space.txt \\1.2.3.4\folder1\folder2\file with space.txt + CategoryInfo : InvalidArgument: (:) [Move-Item], ParameterBindingException + FullyQualifiedErrorId : PositionalParameterNotFound,Microsoft.PowerShell.Commands.MoveItemCommand So I've tried putting "s around both paths, and also 's, and I still get either Move-Item: Could not find a part of the path errors. Can anyone help me?

  Read the article

• iPhone Docked Playing Through PC, Buzzing.

  - by DrFloyd5

  Hi. I have an iPhone that I fit into an Apple dock. There is an audio cable from dock into the line in on my sound card. My headphones are plugged into the line out. I get this really quite buzz that is fairly constant, but changes as the iphone "does stuff". It's not so bad when the music is playing. But when it stops I get the buzz, so I can't really use my headphones as "noise cancellation." It doesn't help to change my volume sliders on the PC. Any ideas? Thanks in advance.

  Read the article

• Help with user login on Centos 5.6

  - by Owen

  I added a user for the sole purpose of using SU for root. I did not allow the creation of a home directory when creating the user. So now when I login as this user I get the following: Could not chdir to home directory /home/MYUSERNAME: No such file or directory Couldn't resolve homedir for current user at - line 0 BEGIN failed--compilation aborted. Couldn't resolve homedir for current user at - line 0 BEGIN failed--compilation aborted. Is this an error, and if so how do I fix it so it is not looking to "resolve" the homedir?

  Read the article

• Ubuntu - executable file - variable assignment throwing error on script run

  - by newcoder

  I am trying to run a small script - test - on ubuntu box. It is as follows: var1 = bash var2 = /home/test/directory ... ... <some more variable assignments and then program operations here> ... ... Now every time I run it, then it throws errors: root@localhost#/opt/test /opt/test: line 1: var1: command not found /opt/test: line 3: var2: command not found ... ... more similar errors ... Can someone help me understand what is wrong in this script? Many thanks.

  Read the article

• Whats wrong with my keyboard?

  - by Neifen

  I have a new kind of weird problem with my laptops keyboard. To be precise with the shift key. Lately the both Shift-Keys doesn't just make the letters big, they also took role of the 2 and the 7 on the numpad. So when i push the left shift key (with num lock) it also writes a 7. When I use the left shift key (without num lock), the cursor goes to the begin of the line. When i push the right shift key (with num lock) it writes a 2. When I use the right shift key (without num lock), the cursor goes to the end of the line. I really don't know what I changed on the computer... it's really weird and really annoying

  Read the article

• how do I view what version of samba i am running for my domain controler?

  - by Crash893

  Is there a command line way to see what version of Samba I am running?

  Read the article

• How to Transpose in Excel a column with more than 50,000 rows?

  - by ezlee69

  I am trying to Transpose all of column "B", but want to skip a line then grab the next 4 and paste them in the same column. How can I make this loop all of column "B" skipping every 5th line and change the range to the next open cell or "Range" automatically without manually typing each one individually? Range("B12:B16").Select Selection.Copy Sheets("Sheet2").Select Range("A2").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True Range("B18:B22").Select Selection.Copy Sheets("Sheet2").Select Range("A3").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True Range("B24:B28").Select Selection.Copy Sheets("Sheet2").Select Range("A4").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True

  Read the article

• Use puppet to make changes to ip route and sysctl

  - by Quintin Par

  I have two changes to ip route & sysctl that disable tcp slow start. Here’s how I do it ip route show Make a note of the line starting with default. Pick up the IP from the default line and run sudo ip route change default via $ip_address dev eth0 initcwnd 12 sudo sysctl -w net.ipv4.tcp_slow_start_after_idle=0 How can I create a puppet script out of this? One that can be deployed to many machines of the same type – CentOS 6 Edit: Added bounty to get a working example for sudo ip route change default via $ip_address dev eth0 initcwnd 12

  Read the article

< Previous Page | 315 316 317 318 319 320 321 322 323 324 325 326  | Next Page >