Search Results

Search found 28919 results on 1157 pages for 'open with'.

Page 319/1157 | < Previous Page | 315 316 317 318 319 320 321 322 323 324 325 326  | Next Page >

  • Cocoa AppKit - Dismissing a modal window (i.e. popup or contextual menu) and pressing the button cu

    - by hishamk
    Basically I want to create the effect of that provided in the system's menu bar. A user presses on one of the menu headings, and as he moves across the different headings, the menus open up automatically. The snag is that if I open a pop-up menu for a button, the user has to click again to dismiss it. The entire runloop is on hold as I believe the pop-up menu is modal. How do I go about being able to send a [somePopUpMenu cancelTracking] when the user moves to the next button? Cheers

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • "Look" of page changes a bit after uploading it to IIS - looks good on computer same IE8

    - by J Smith
    No it's not a path issue...or else the site won't have a design. The website looks fine if I open it with IE8 in my computer. But after I upload it to IIS 6.0 two things change on positioning. I see a rendering problem. But if I open it with IE 8.0 on my machine it looks good, but opening it when uploaded to IIS , it changes a bit. Same exact files. Same browser, same computer. The only different thing is that it has been uploaded to IIS. IT has no programming in aspx whatsoever just .html .css and .js

    Read the article

  • Create an assembly in memory

    - by Jared I
    I'd like to create an assembly in memory, using an using the classes in Reflection.Emit Currently, I can create the assembly and get it's bytes using something like AssemblyBuilder builder = AppDomain.CurrentDomain.DefineDynamicAssembly(..., AssemblyBuilderAccess.Save); ... create the assembly ... builder.Save(targetFileName); using(FileStream fs = File.Open(targetFileName, FileMode.Open)) { ... read the bytes from the file stream ... } However, it does so by creating a file on the local filesystem. I don't actually need the file, just the bytes that would be in the file. Is it possible to create the assembly without writing any files?

    Read the article

  • Sharepoint checkin/checkout

    - by Prashanth
    We have a sharepoint based application that uses a custom database for storing metadata/files (which could also be on a file share) My question is how can the standard file checkin/check out option in document library be customized? The javascript file ows.js in the layouts folder contains the functions that provide checkin/check out/ open file functionality. Behind the scenes it relies on a combination of HTTP Post/GET methods + SOAP + an activeX control to achieve the desired functionality. Customizing these javascript function seems tedious/error prone. Note that we have a web service that exposes endpoints, for retrieving necessary file information/data from the backend. The difficulty is in integrating it with the sharepoint js functions, due to lack of proper documentation. (Also the js functions might change over different versions of sharepoint) Also is it possible to create files/open files etc from the cache area on the client machine from server side code?

    Read the article

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • Jqm is not a function

    - by kris
    Hi all, I'm having some trouble with Jquery and JqModal, and I hope you are able to help, since I've been struggling for hours.. Having a single button element with an onclick action running my method "test" (shown below): $('#picture_form').jqm({ajax: '/test.php'}); $('#picture_form').jqmShow(); This will load the ajax content of test.php into my div element picture_form, shown using JqModal as its supposed to! Though when I close this window, and re-clicks the button I'm getting the error: $("#picture_form").jqm is not a function. As a solution I've tried to use the JqModal trigger function, and this leaves me able to open and close the JqModal windows as many times as I want to. Sadly I can only call the 'trigger' using test environment, in my production code I have to open the JqModal window using a function.. Does anyone have a clue why this 'bug' appears when calling the opening when using a function? Thanks in advance

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • PHP want to buy / find a eMall, Shopping Mall system with multiple vendor management backend

    - by Shiro
    Basically I am looking for a Shopping Mall system in PHP. User included Member / User Administrator Vendor Affiliate I find a lot ecommerce that support multiple shop, but each vendor don't have their own login and management. And in the front I would like to share the cart. and can buy from different shop. If multiple subdomain supported that would be more better. Web 2.0 design would be much more preferable. Any suggestion? I google some of it, hopefully can get more references. Buy / Open source also please advice. I don't think this kind of system got open source :p

    Read the article

  • How to set source path of image within html pages to show in webbrowser control

    - by Royson
    Hi in my application there is web browser control to show some static html pages. The pages are displayed properly. but images are not displayed.. I tried with changing src-path but no success. my htmlpages folder is located at bin folder. And i am assigning it as. FileStream source = new FileStream(@"..\HtmlPages\supportHtml.html", FileMode.Open, FileAccess.Read); if i open html files in browser, the images are displayed properly.. So, What is the correct path for images..?? If i set full path to src attribute of <img> tag..it works. but i think its not a proper way. :( EDIT: If i assign d:\myapp\bin\HtmlPages\support.gif then image is displayed. And if i assign "..\HtmlPages\support.gif" or "support.gif" image is not shown.

    Read the article

  • IE 8 dialog windows not decompressing files

    - by Mike
    Hi, I've got a website where we have pre-compressed all of our HTML files. In general this works fine, but since IE 8 has come out some people are finding that they can not use some parts of the website. We've used the showModalDialog command to open a dialog window and pointing to one of our pre-compressed files but it displays it just show up as strange characters (ie not decompressed). Now it only happens in the dialog. I'm pretty sure our compression is all fine because the page they are viewing to open the dialog is also compressed. Has anyone else come across this or got any suggestions cuz i'm stumped??? Thanks, Mike

    Read the article

  • ADO.NET: Faster way to check if the database server is accessible?

    - by lotana
    At the moment I am using this code to check if the database is accessible: public bool IsDatabaseOnline(string con) { bool isConnected = false; SQLConnection connect = null; try { connect = new SQLConnection(con); connect.Open(); isConnected = true; } catch (Exception e) { isConnected = false; } finally { if (connect != null) connect.Close(); } return isConnected; } While this code works fine, there is a disadvantage. If the server is not online it spends about 4 full seconds trying to open the connection before deciding that it is not available. Is there a way to test the connection without trying to actually opening it and waiting for the timeout? Something like a database-equivalent of ping?

    Read the article

  • How do I determine which C/C++ compiler to use?

    - by Adam Siddhi
    Greetings, I am trying to figure out which C/C++ compiler to use. I found this list of C/C++ compilers at Wikipedia: http://en.wikipedia.org/wiki/List_of_compilers#C.2FC.2B.2B_compilers I am fairly certain that I want to go with an open source compiler. I feel that if it is open source then it will be a more complete compiler since many programmer perspectives are used to make it better. Please tell me if you disagree. I should mention that I plan on learning C/C++ mainly to program 2D/3D game applications that will be compatible with Windows, Linux, MAC and iPhone operating systems. I am currently using Windows Vista x64 OS. Thanks, Adam

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • Algorithmic trading software safety guards

    - by Adal
    I'm working on an automatic trading system. What sorts of safe-guards should I have in place? The main idea I have is to have multiple pieces checking each other. I will have a second independent little process which will also connect to the same trading account and monitor simple things, like ensuring the total net position does not go over a certain limit, or that there are no more than N orders in 10 minutes for example, or more than M positions open simultaneously. You can also check that the actual open positions correspond to what the strategy process thinks it actually holds. As a bonus I could run this checker process on a different machine/network provider. Besides the checks in the main strategy, this will ensure that whatever weird bug occurs, nothing really bad can happen. Any other things I should monitor and be aware of?

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • post data to a thickbox using ajax

    - by sqlchild
    I need to post data to a thickbox using ajax and open it immediately and display the posted data. The user would click on a link/button and the data i.e. value of the selected checkboxes would be posted to "my_thickbox.php" and the thickbox (url : my_thickbox.php) would open with checkbox values displayed. <div id="showthickbox" ><a href="my_thickbox.php" class="thickbox"></div> $('#showthickbox').click(function() { var data = $('input:checkbox:checked').map(function() { return this.value; }).get(); $.ajax({ type: 'POST', url: 'my_thickbox.php', data: data, success: success, dataType: dataType }); });

    Read the article

  • SharePoint 2010 is forcing me to safe PDF when opening from doc library

    - by Tobias Funke
    I have a document library with a PDF file. Whenever I click on the PDF file, I am prompted to save the file. I do not get the option of opening the file, I am forced to save it. What I want is for the PDF file to open, either in the browser or in a separate Adobe Reader window, depending on the Adobe Reader settings. I'm pretty sure SharePoint is responsible for this behavior, because if I put the PDF on my hard drive, then create a HTML file with a link to the file, it opens in the browser when I click on it. Please note: I looked at this question and did not help. I don't care if the PDF opens in the browser or in a separate Adobe Reader window, I just want it to open.

    Read the article

  • Web service reference location?

    - by Damien Dennehy
    I have a Visual Studio 2008 solution that's currently consisting of three projects: A DataFactory project for Business Logic/Data Access. A Web project consisting of the actual user interface, pages, controls, etc. A Web.Core project consisting of utility classes, etc. The application requires consuming a web service. Normally I'd add the service reference to the Web project, but I'm not sure if this is best practice or not. The following options are open to me: Add the reference to the Web project. Add the reference to the Web.Core project, and create a wrapper method that Web will call to consume the web service. Add a new project called Web.Services, and copy step 2. This project is expected to increase in size so I'm open to any suggestions.

    Read the article

  • Extract a C/C++ header file from a C# class exposed to COM

    - by isorfir
    I'm not sure I've setup everything I've needed to in my C# class to properly, but it does work in COM. I've been looking for an example of a C# class that was successfully used in a C/C++ project, but haven't come across anything. I've tried using the OLE/COM Object View app to open the .tlb file and save as .h, but it gives some errors: MIDL1009: unknown argument ignored; MIDL1001: cannot open input file Studio "Studio" isn't the name of the file, it's Syslog, so that raises a red flag to me. Any ideas?

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

< Previous Page | 315 316 317 318 319 320 321 322 323 324 325 326  | Next Page >