Search Results

Search found 28955 results on 1159 pages for 'xdg open'.

Page 320/1159 | < Previous Page | 316 317 318 319 320 321 322 323 324 325 326 327  | Next Page >

  • In Python, urllib2 giving error

    - by pythBegin
    I tried running this, >>> urllib2.urlopen('http://tycho.usno.navy.mil/cgi-bin/timer.pl') But it is giving error like this, can anyone tell me a solution ? Traceback (most recent call last): File "<pyshell#11>", line 1, in <module> urllib2.urlopen('http://tycho.usno.navy.mil/cgi-bin/timer.pl') File "C:\Python26\lib\urllib2.py", line 126, in urlopen return _opener.open(url, data, timeout) File "C:\Python26\lib\urllib2.py", line 391, in open response = self._open(req, data) File "C:\Python26\lib\urllib2.py", line 409, in _open '_open', req) File "C:\Python26\lib\urllib2.py", line 369, in _call_chain result = func(*args) File "C:\Python26\lib\urllib2.py", line 1161, in http_open return self.do_open(httplib.HTTPConnection, req) File "C:\Python26\lib\urllib2.py", line 1136, in do_open raise URLError(err) URLError: <urlopen error [Errno 11001] getaddrinfo failed>

    Read the article

  • Print ms access data in vb.net

    - by user225269
    How do I print the ms access data(.mdb) in vb.net? Here is the code that I'm using to view the data in the form. What I want to do is to be able to print what is currently being viewed. Perhaps automatically save the .pdf file and the pdf viewer installed on the system will open that newly generated pdf file Dim cn As New OleDbConnection("Provider=Microsoft.Jet.OLEDB.4.0;Data Source=C:\search.mdb") Dim cmd As OleDbCommand = New OleDbCommand("Select * from GH where NAME= '" & TextBox6.Text & "' ", cn) cn.Open() Dim rdr As OleDbDataReader rdr = cmd.ExecuteReader If rdr.HasRows Then rdr.Read() NoAcc = rdr("NAME") If (TextBox6.Text = NoAcc) Then TextBox1.Text = rdr("IDNUMBER") If (TextBox6.Text = NoAcc) Then TextBox7.Text = rdr("DEPARTMENT") If (TextBox6.Text = NoAcc) Then TextBox8.Text = rdr("COURSE") End If -some sites for beginners regarding this topic would help a lot:)

    Read the article

  • Importing Python module from the Bash

    - by Morlock
    I am launching a Python script from the command line (Bash) under Linux. I need to open Python, import a module, and then have lines of code interpreted. The console must then remain in Python (not quit it). How do I do that? I have tried an alias like this one: alias program="cd /home/myname/programs/; python; import module; line_of_code" But this only starts python and the commands are not executed (no module import, no line of code treated). What is the proper way of doing this, provided I need to keep Python open (not quit it) after the script is executed? Many thanks.

    Read the article

  • .attr("disabled", "disabled") problem

    - by meo
    i have this function where basically add and remove the disabled attribute form a input field: $(bla).click(function(){ if (something) { console.log($target.prev("input")) // gives out the right object $target.toggleClass("open").prev("input").attr("disabled", "disabled"); }else{ $target.toggleClass("open").prev("input").removeAttr("disabled"); //this works } }) the removeAttr works fine but when i need to add the disabled again it does just nothing. My console.log is triggering (and giving me back the right input field) so I'm sure my that my if statement works. But if i inspect the DOM with firebug the disabled attribute does not appear. can someone help me? PS: please don't focus on the function or the if statement itself, works fine its just that attr that dies not work for disabled...

    Read the article

  • Ctrl+Click / Command+Click not working with analytics

    - by user347998
    Hi All, I created my own analytics for my site to track outbound click events using jquery. Now the thing with preventDefault() is that it does not allow for the Ctrl+Click or COmmand+click operation in the browser to open the link in new tab/window. So my solution was to detect e.metaKey || e.ctrlKey and use window.open. This does not work very great with safari unless the user changes browser behavior. I am wondering if anyone here knows what other analytics users do - like how does google etc deal with this problem in tracking outbound links? From this link: http://www.google.com/support/googleanalytics/bin/answer.py?hl=en&answer=55527 - looks like google will also face the same problem. Thoughts?

    Read the article

  • Problem with image path of html files viewed by webbrowser control

    - by Royson
    I have an webbrowser control on my form. I am able display html files in that control. But my page contains some images if i give absolute path to it then images are displayed. But if i give relative path then images are not shown in the pages. I have HtmlPages folder located at bin folder. And i am assigning FileStream source = new FileStream(@"..\HtmlPages\supportHtml.html", FileMode.Open, FileAccess.Read); webBrowser.DocumentStream = source; If i assign D:\myapp\bin\HtmlPages\file.png then there is no problem. My images are stored in same folder. If i open html files with webbrowser then images are displayed. What is the correct path to set ??

    Read the article

  • Is there any explorer.exe problem in windows 7 ?

    - by sml
    s += "<p style=\"text-align: left;\"><a href=\"javascript:window.print()\">PRINT</a></p>"; System.IO.File.WriteAllText(@"CheckForm.html", s); System.Diagnostics.ProcessStartInfo startInfo = new System.Diagnostics.ProcessStartInfo(); startInfo.FileName = "explorer.exe"; startInfo.Arguments = "CheckForm.html"; System.Diagnostics.Process.Start(startInfo); I'm having a trouble when I tried to open my c# windows application in windows 7 otherwise there is no problem. I couldn't open explorer.exe in Windows 7 with above code. Any suggestions?

    Read the article

  • Python UTF-16 encoding hex representation

    - by Romeno
    I have a string in Python 2.7.2 say u"\u0638". When I write it to file: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.close() In hex it looks like: FF FE 38 06 When i print such a string to stdout i will see: '\xff\xfe8\x06'. The querstion: Where is \x38 in the string output to stdout? In other words why the string output to stdout is not '\xff\xfe\x38\x06'? If I write the string to file twice: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.write(u"\u0638".encode('utf-16')) f.close() The hex representation in file contains byte order mark (BOM) \xff\xfe twice: FF FE 38 06 FF FE 38 06 I wonder what is the techique to avoid writting BOM in UTF-16 encoded strings?

    Read the article

  • writing header in csv python with DictWriter

    - by user248237
    assume I have a csv.DictReader object and I want to write it out as a csv file. How can I do this? I thought of the following: dr = csv.DictReader(open(f), delimiter='\t') # process my dr object # ... # write out object output = csv.DictWriter(open(f2, 'w'), delimiter='\t') for item in dr: output.writerow(item) Is that the best way? More importantly, how can I make it so a header is written out too, in this case the object "dr"s .fieldnames property? thanks.

    Read the article

  • Excel 2010 Access to path is denied temp

    - by Chris Anderson
    I am using excel data reader to read data from an excel file. FileStream stream = File.Open(filePath, FileMode.Open, FileAccess.Read); //1. Reading from a binary Excel file ('97-2003 format; *.xls) IExcelDataReader excelReader = ExcelReaderFactory.CreateBinaryReader(stream); //2. Reading from a OpenXml Excel file (2007 format; *.xlsx) IExcelDataReader excelReader = ExcelReaderFactory.CreateOpenXmlReader(stream); http://exceldatareader.codeplex.com/ This reads excel 1997-2003 format and excel 2007 format on my local machine and when we move it to our test server. However, when moved to production, it works for excel 97-2003 files, but when I try to read 2007 files I receive the following error: Access to the path 'C:\Documents and Settings\PORTALS03\ASPNET\LOCALS~1\Temp\TMP_Z129388041687919815' is denied. How is it possible that the 97-2003 excel file can be read but the 2007 files throw access is denied?

    Read the article

  • importing a project into a svn repository question

    - by ajsie
    im using netbeans for svn. i open a project in netbeans and then i import it to a svn repo. it seems that although im only importing the project folder, svn creates .svn folders in all folders within this project folder. why is that? i thought that i was only creating .svn folders to checked out projects, not imported ones? now this folder acts very weird, when i open this folder as a project in netbeans, netbeans treats it like a svn folder some way. is this normal? cause i want this one to not be under SVN.

    Read the article

  • Jquery UI accordion question - how would you approach this?

    - by E.J. Brennan
    I am using jquery UI accordion control in one of my apps asp.net apps. The data for the accordion comes from a database, and each database record has an ID, a Title Field and a content field. The title is the heading, and the content is the data that shows up when the draw is opened... I'd like to be able to call my page like this: http://www.mywebsite.com/mypage.aspx?ID=123 and have it display all the data (as it does now), but then have the default 'drawer' of the accordion open to the section that corresponds to the ID number passed in on the url...there are about 50 sections on the page. Any suggestions on how to approach this? My questions is specific to the jquery accordion function, the rest I know. So where would be the best place to 'tag' the drawer with the unique ID's, and then what is the snippet of javascript code (I assume) that I would use 'open' that drawer based on the ID passed in?? Thanks!

    Read the article

  • Why can't I get Python's urlopen() method to work?

    - by froadie
    Why isn't this simple Python code working? import urllib file = urllib.urlopen('http://www.google.com') print file.read() This is the error that I get: Traceback (most recent call last): File "C:\workspace\GarchUpdate\src\Practice.py", line 26, in <module> file = urllib.urlopen('http://www.google.com') File "C:\Python26\lib\urllib.py", line 87, in urlopen return opener.open(url) File "C:\Python26\lib\urllib.py", line 206, in open return getattr(self, name)(url) File "C:\Python26\lib\urllib.py", line 345, in open_http h.endheaders() File "C:\Python26\lib\httplib.py", line 892, in endheaders self._send_output() File "C:\Python26\lib\httplib.py", line 764, in _send_output self.send(msg) File "C:\Python26\lib\httplib.py", line 723, in send self.connect() File "C:\Python26\lib\httplib.py", line 704, in connect self.timeout) File "C:\Python26\lib\socket.py", line 514, in create_connection raise error, msg IOError: [Errno socket error] [Errno 10060] A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond I've tried it with several different pages but I can never get the urlopen method to execute correctly.

    Read the article

  • Python character count

    - by user74283
    I have been going over python tutorials in this resource. Everything is pretty clear in the below code which counts number of characters. Only section that i dont understand is the section where count assigned to a list and multiplied by 120. Can anyone explain what is the purpose of this in plain english please. def display(i): if i == 10: return 'LF' if i == 13: return 'CR' if i == 32: return 'SPACE' return chr(i) infile = open('alice_in_wonderland.txt', 'r') text = infile.read() infile.close() counts = 128 * [0] for letter in text: counts[ord(letter)] += 1 outfile = open('alice_counts.dat', 'w') outfile.write("%-12s%s\n" % ("Character", "Count")) outfile.write("=================\n") for i in range(len(counts)): if counts[i]: outfile.write("%-12s%d\n" % (display(i), counts[i])) outfile.close()

    Read the article

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Cocoa AppKit - Dismissing a modal window (i.e. popup or contextual menu) and pressing the button cu

    - by hishamk
    Basically I want to create the effect of that provided in the system's menu bar. A user presses on one of the menu headings, and as he moves across the different headings, the menus open up automatically. The snag is that if I open a pop-up menu for a button, the user has to click again to dismiss it. The entire runloop is on hold as I believe the pop-up menu is modal. How do I go about being able to send a [somePopUpMenu cancelTracking] when the user moves to the next button? Cheers

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Create an assembly in memory

    - by Jared I
    I'd like to create an assembly in memory, using an using the classes in Reflection.Emit Currently, I can create the assembly and get it's bytes using something like AssemblyBuilder builder = AppDomain.CurrentDomain.DefineDynamicAssembly(..., AssemblyBuilderAccess.Save); ... create the assembly ... builder.Save(targetFileName); using(FileStream fs = File.Open(targetFileName, FileMode.Open)) { ... read the bytes from the file stream ... } However, it does so by creating a file on the local filesystem. I don't actually need the file, just the bytes that would be in the file. Is it possible to create the assembly without writing any files?

    Read the article

  • "Look" of page changes a bit after uploading it to IIS - looks good on computer same IE8

    - by J Smith
    No it's not a path issue...or else the site won't have a design. The website looks fine if I open it with IE8 in my computer. But after I upload it to IIS 6.0 two things change on positioning. I see a rendering problem. But if I open it with IE 8.0 on my machine it looks good, but opening it when uploaded to IIS , it changes a bit. Same exact files. Same browser, same computer. The only different thing is that it has been uploaded to IIS. IT has no programming in aspx whatsoever just .html .css and .js

    Read the article

  • Sharepoint checkin/checkout

    - by Prashanth
    We have a sharepoint based application that uses a custom database for storing metadata/files (which could also be on a file share) My question is how can the standard file checkin/check out option in document library be customized? The javascript file ows.js in the layouts folder contains the functions that provide checkin/check out/ open file functionality. Behind the scenes it relies on a combination of HTTP Post/GET methods + SOAP + an activeX control to achieve the desired functionality. Customizing these javascript function seems tedious/error prone. Note that we have a web service that exposes endpoints, for retrieving necessary file information/data from the backend. The difficulty is in integrating it with the sharepoint js functions, due to lack of proper documentation. (Also the js functions might change over different versions of sharepoint) Also is it possible to create files/open files etc from the cache area on the client machine from server side code?

    Read the article

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

< Previous Page | 316 317 318 319 320 321 322 323 324 325 326 327  | Next Page >