Search Results

Search found 29053 results on 1163 pages for 'line spacing'.

Page 327/1163 | < Previous Page | 323 324 325 326 327 328 329 330 331 332 333 334  | Next Page >

  • How to run nodejs on linux platform

    - by rotem
    How to run node.js on host with linux platform? To run node.js on localhost with windows operation system is simple I download package from nodejs.org/download/ and I execute Windows Installer (.msi) I go to console command line and I type node file.js and everything fine. but in my host with linux platform I have control panel with no option to run type file exe, msi and there is no window with command line, So how can I be able to run nodejs on my host? I call to support of my hosting bluehost.com and they don't know. my Details server and control panel Thanks for any help

    Read the article

  • Map keys in Vim

    - by efficiencyIsBliss
    I want to map e to mean end of line. I tried the following mapping in my vimrc: map $ e $ is the default end of line command. However, this doesn't work. I'm wondering what the problem is. Also, I want to map Alt+right/left arrow to navigate words. So, for example, Alt+right arrow would take me to end of word. This command is currently mapped to e. Any tips on how I would go about doing this? Thanks!

    Read the article

  • Automating the installation using SSH

    - by RAY
    I am running a bash script from a remote host to run a binary file which installs 64 bit JDK 6 update 29 on multiple VMs across the Environment. It is installing the file but, at the last line i have to hit a enter to complete the installation. I want to fully automate the script where i do not have to hit the enter at the last line. This is what i am using ssh ${V_TIERS}@${V_TIERS} 'cd JDK; sh jdk-6u29-solaris-sparcv9.sh' It updates as desired, but during install i have to hit enter to continue and complete the installation. Can anybody please help to fully automate the update process.

    Read the article

  • Enabling openssl With PHP/nginx

    - by reefine
    I'm getting the following error when trying to connect to SMTP + SSL through PHP using nginx + PHP 5, Could not connect to smtp host 'ssl://smtp.gmail.com' (5) (Unable to find the socket transport "ssl" - did you forget to enable it when you configured PHP?) In phpinfo I see: OpenSSL support disabled (install ext/openssl) This leads me to believe I've installed OpenSSL incorrectly. I've read a bunch of places where I should uncomment the following line: extension = php_openssl.dll This line does not exist so I added it to the end of my php.ini to no avail. The php_openssl.dll file does not exist anywhere on my server.

    Read the article

  • Configure PL2303-based USB-to-RS232 adapter to stay awake when no active device is present

    - by casualuser
    I am resurrecting some X10 devices with the aid of a USB-to-RS232 adapter. The problem is, that the adapter only works with the Firecracker device when there is another serial device on the line (the Firecracker is a pass-through device that monitors the RTS and DTR lines to do its magic). Is the PL2303 going to sleep without a real device on the line? Is there an option or command to keep it awake? Is there a cable configuration that would make it work without a real serial device present?

    Read the article

  • PHP session files have permissions of 000 - They're unusable

    - by vanced
    I kept having issues with a Document Management System I'm trying to install as, at the first step of the installation process, it would error with: Warning: Unknown: open(/tmp/sess_d39cac7f80834b2ee069d0c867ac169c, O_RDWR) failed: Permission denied (13) in Unknown on line 0 Warning: Unknown: Failed to write session data (files). Please verify that the current setting of session.save_path is correct (/tmp) in Unknown on line 0 I looked in /tmp and saw the sess_* files have the following permissions ---------- 1 vanced vanced 1240 Jan 20 08:48 sess_d39cac7f80834b2ee069d0c867ac169c All the session files look like this. So obviously, they're unusable by PHP and it's causing me lots of problems. How can I get PHP to set the correct permissions? I've tried changing the directory which php.ini uses to /tmp/phpsessions and the same thing occurs. The directories are a+rwx.

    Read the article

  • Tool to launch a script driven by modem activity

    - by Will M
    Can anyone suggest a software tool (preferably under Windows XP or later) that would launch an application or script in response to a phone call being received on a landline phone line connected to a data modem on the same PC? or, better, in response to a sequence of touch-tones being played over such a phone line. This would allow, for example, using the telephone to manipulate firewall settings so as to create another layer of security in connection with remote internet access to that computer. I seem to recall seeing tools to do this sort of thing in the days before broadband internet access, when there was more attention to various tips and tricks for the dial-up modem, but a few attempts at Google hasn't turned anything up.

    Read the article

  • how to install OpenSSL in windows 7 and also how to check, its enabled or not?

    - by Andy
    how to install OpenSSL in windows 7 and also how to check, its enabled or not? I currently run php through the command line locally not on a server. Thanks I recently installed php 5.2.17 I ran a program which connect with a https server and I got the following error Notice: file_get_contents(): Unable to find the wrapper "https" - did you forget to enable it when you configured PHP? in C:\java\newsweaver-api-v2\simple\list- tags.php on line 30 I added extension=php_openssl.dll to php.ini but I'm wondering is openssl native to php 5.2.17 or do I need to download an extntion. Thanks

    Read the article

  • Underlying Concept Behind Keyboard Mappings

    - by ajay
    I am frustrated with key mapping issues. On my Linux box, if I type Home/End in Vim, then the cursor actually moves to the beginning/end of the line. On my Mac when I am on TextEdit, if I do Fn + Left or Fn + Right, it takes me to beginning/end of the line. But if I am on Vim on my Mac terminal, then the same key combinations don't work. Why? I see online all the different cryptic settings that I have to paste in .vimrc to make this work, but I can't find any explanation for those cryptic map, imap settings. What is the underlying issue here, and how can I fix it? Thanks!

    Read the article

  • MSSQL, ASP.NET, IIS. SQL Server perfmon log question

    - by Datapimp23
    Hi, I'm testing a web application that runs on a hypervisor. The database server and the webserver are seperate vm's that run on the same hypervisor. We did some tests and the functions perform ok. I want you guys to look at a screenshot of a permon log of the sql 2005 server on the busiest moment. The webserver perfmon log looks fine and it's obvious that we have enough resources to present the page in a timely fashion. http://d.imagehost.org/view/0919/heavyload http://d.imagehost.org/0253/heavyloadz.jpg Zoomed out The striped blue line maxing out is the Processor que length (scale 100,0) The green line at around value 30 is Available MBytes (scale 0,01) The rest of the counters are visible on the screenshot. The sql server machine has no CPU limitations on the hypervisor resources and has 5 vcpu's and 5 GB RAM. Can someone help me to interpret this log. Thanks

    Read the article

  • Server 2008 SP1 VSS Writers Not Responding

    - by Jason
    I've got a Windows Server 08 box on SP1 that is having some problems. We've experienced backup problems and I've traced it down to VSS Writers not responding. From the command line, if I type vssadmin list providers, I get Provider name: 'Microsoft Software Shadow Copy provider 1.0' Provider type: System Provider Id: {b5946137-7b9f-4925-af80-51abd60b20d5} Version: 1.0.0.7 If I type vssadmin list writers, I get this vssadmin 1.1 - Volume Shadow Copy Service administrative command-line tool (C) Copyright 2001-2005 Microsoft Corp. Waiting for responses. These may be delayed if a shadow copy is being prepared. I could wait this out for hours and it won't move. I looked up how Server 2008 handles VSS writers, and you can't reregister them like you could in Server 2003 http://social.technet.microsoft.com/Forums/en/windowsserver2008r2general/thread/062cc52c-899b-45f3-8d0c-798b92363f41 Does anyone know how to fix something like this or where to turn next?

    Read the article

  • How to configure Notepad++ (Scintilla) to write below EOF after EOL [on hold]

    - by Piotr Piaseczny
    Is it possible to configure scintilla to "brake" EOL/EOF while writing ? Now, if I want to begin writing in a column after EOL, I use ALT+left mouse button and start typing after click. No idea how to begin writing below EOF. Pressing Enter key many times is the only method now. Other explanation: If You open a new document, doesnt matter what kind of (php/txt etc) all You have is just one line. If You want to write in line 5 - must press Enter 5 times. Every other editor I know (IDE in Builder C++/MultiEdit) "ignore" eof and you can write anywhere in document. Because of php/html I've found notepad++ as a best editor but I'd like to "brake" limitations of (probably) scintilla

    Read the article

  • How to read iptables -L output?

    - by skrebbel
    I'm rather new to iptables, and I'm trying to understand its output. I tried to RTFM, but to no avail when it comes to little details like these. When iptables -vnL gives me a line such as: Chain INPUT (policy DROP 2199 packets, 304K bytes) I understand the first part: on incoming data, if the list below this line does not provide any exceptions, then the default policy is to DROP incoming packets. But what does the 2199 packets, 304K bytes part mean? Is that all the packets that were dropped? Is there any way to find out which packets that were, and where they came from? Thanks!

    Read the article

  • Is drupal going to improve these small features ?

    - by Patrick
    Is drupal going to improve the following features ? 1) multi-line description for CCK fields such as images (at the moment I can only write in a line but a text-area would be better 2) thumbnails upload for CCK Video fields (so I can upload a thumbnails for each video if I cannot install ffmpeg on the server) 3) merge CCK Images and Videos in a single group. So my customer can order them in the same list by dragging and dropping them, and in my front-end I have them ordered in the same list. This would be very useful for me. Do you know if I can get some of theme with some modules maybe ? thanks

    Read the article

  • Pressing 'Enter' doesn't really work in Firefox

    - by inkedmn
    When I'm typing just about anywhere in Firefox on OSX and press enter, it simply doesn't do anything. This includes typing in a textarea element (which should take the cursor to the next line), in a search form (which should submit the form). I'm typing this very question in Firefox right now and I'm unable to advance the cursor to the beginning of the next line. I have no clue what I did to make this happen, but it's kinda driving me insane. This is Firefox 3.6.3 under Mac OS X 10.6. Thanks!

    Read the article

  • Disabled annotation tools in Skim

    - by Kit
    Here's a portion of the toolbar in Skim In the Add Note section, why are the following tools disabled (dimmed)? Add New Highlight (A in the yellow box) Add New Underline (red line under A) Add New Strike Out (A struck out by red line) However, in the Tool Mode section, there is a drop down button (shown as active in the screenshot). To illustrate, I can select and use the Add New Underline tool, as well as the other tools I mentioned above, using the drop down button. But those tools are dimmed out in the Add Note section. Why? I have observed that the drop down button is just a duplicate of the Add Note section. Why not just enable all the buttons in the Add Note section and save the user from making an extra click just to bring down a list of tools? Is this because of some property of the presently open PDF, or what?

    Read the article

  • Proccess of carrying out a BER Test

    - by data
    I am subscribed to an ISP supplying a 3meg ADSL line. Lately (for the last 4 weeks) speeds have dropped from the usual average downstream speed of ~250kbps to just 0.14Mbps (according to speedtest.net) and employees are complaining about lack of access to the server. I have been calling customer support and logging calls for the last 3 weeks, but they have been unable to determine the source of the problem other carrying out a few bitstream tests and checking the DHCP renewal times. I am going to call back and suggest carrying out a BER test. What type of equipment is needed to carry out this test? I have access to a wide range of Cisco networking equipment. Other: We dont need a leased line as there are less than ten employees.

    Read the article

  • Know any file compare utility for chunks of text?

    - by Belun
    Is there any file-compare utility-software that can help me compare chunks of text from two text files ? As in, I want to know what chunks of text that are in one file can be found again in the second file. What I need to do is more like a 'compare and search' operation, not just a compare line by line. I need this for finding common errors in application logs. Eg., I have a Java application and logs from two different days. I want to find out which stack-traces (that are actually chunks of text inside a text file) are common to both days.

    Read the article

  • How to install php cli with pnctl alongside Zend Server

    - by fazy
    I have Zend Server CE 5.6 with PHP 5.2 running on Ubuntu 11.10. Now the need has arisen to run a command line PHP script that uses PHP's pnctl functionality. First of all, I had no PHP command line in my path, so I made a symlink from the Zend one: sudo ln -s /usr/local/zend/bin/php /usr/bin However, when I run my script, I now get this error: PHP Fatal error: Call to undefined function pcntl_fork() The Zend web control panel doesn't offer pnctl in the list of modules, so how do I get this functionality? Is it safe to use apt-get to install PHP directly, to run alongside the Zend instance? If so, how do I make sure I get version 5.2? I guess the following would pull in PHP 5.3: apt-get php5-cli I could probably muddle through but any pointers to help me avoid making a mess would be much appreciated!

    Read the article

  • How to failover to local account on a cisco switch/router if radius server fails?

    - by 3d1l
    I have the following configuration on a switch that I testing for RADIUS authentication: aaa new-model aaa authenticaton login default group radius local aaa authentication enable default group radius enable aaa authorization exec default group radius local enable secret 5 XXXXXXXXX ! username admin secret 5 XXXXXXXXX ! ip radius source-interface FastEthernet0/1 radius-server host XXX.XXX.XXX.XXX auth-port 1812 acct-port 1813 key XXXXXXXXX radius-server retransmit 3 ! line con 0 line vty 5 15 Radius authentication is working just fine but if the server is not available I can not log into the router with the ADMIN account. What's wrong there? Thanks!

    Read the article

  • Custom prompt doesn't work on Mac Terminal

    - by mareks
    I like to use a custom prompt (current path in blue) on my unix machine: export PS1='\[\e[0;34m\]\w \$\[\e[m\] ' But when I try to use it on Mac's terminal it doesn't work: it fails to detect the end of the prompt and overwrites the prompt when I type commands. This also happens when I'm inputting a long command where it wraps over the same line instead of starting a new line. I don't understand why this is the case since I use bash on both machines. Any suggestions on how to remedy this?

    Read the article

  • What's the advantage of using a bash script for cron jobs?

    - by AlxVallejo
    From my understanding you can write your crons by editing crontab -e I've found several sources that instead refer to a bash script in the cron job, rather than writing a job line for line. Is the only benefit that you can consolidate many tasks into one cron job using a bash script? Additional question for a newbie: Editing crontab -e refers to one file correct? I've noticed that if I open crontab -e and close without editing, when I open the file again there is a different numerical extension such as: "/tmp/crontab.XXXXk1DEaM" 0L, 0C I though the crontab is stored in /var/spool/cron or /etc/crontab ?? Why would it store the cron in the tmp folder?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How do I get `set show-all-if-ambiguous on` in my .inputrc to play nice with the Python interpreter?

    - by ysim
    I noticed that after I added the set show-all-if-ambiguous on line to my ~/.inputrc, whenever I pressed tab to indent a block, it would show me the bash Display all ... possibilities? (y or n) prompt, and leave me unable to indent the actual code. Is there any way to keep that line in my .inputrc but still have the tab key work as expected in the Python interpreter? This is in my VirtualBox Ubuntu 12.04 VM, if it matters. EDIT: Curiously, I now have a different issue with the Python shell that comes with Django -- when I press tab, I get Python tab completion, but only with one Tab press. I've opened a separate question here for it.

    Read the article

  • PHPMyAdmin running very slow over internet but fine locally

    - by columbo
    I connect to PHPMyAdmin remotely on a Centos server using my local PC via Firefox. Usually it's fine but today it's really slow (2 minutes to load a page), sometimes timing out. Other connections to the server are fine. The SSH command line is as fast as ever as is the GNOME dekstop over SSH. In fact on the GNOME desktop I can run PHPMyAdmin locally from its browser and it's as quick as ever (which is a solution to the problem of course). I've checked the various log files and seen nothing unusual, I've logged into the MySQL command line and the database is running fine without any slowing what so ever. So it just seems to be slow when I access PHPMyAdmin on the server from the browser on my remote PC (I've tried IE and Firefox, both are slow). Has anyone experienced this or have any ideas what the issue could be. Connecting via CLI through tunnel works OK - problem is in phpMyAdmin for sure. Cheers

    Read the article

< Previous Page | 323 324 325 326 327 328 329 330 331 332 333 334  | Next Page >