Search Results

Search found 78189 results on 3128 pages for 'file management'.

Page 33/3128 | < Previous Page | 29 30 31 32 33 34 35 36 37 38 39 40  | Next Page >

  • Proper Memory Management for Objective-C Method

    - by Justin
    Hi, I'm programming an iPhone app and I had a question about memory management in one of my methods. I'm still a little new to managing memory manually, so I'm sorry if this question seems elementary. Below is a method designed to allow a number pad to place buttons in a label based on their tag, this way I don't need to make a method for each button. The method works fine, I'm just wondering if I'm responsible for releasing any of the variables I make in the function. The application crashes if I try to release any of the variables, so I'm a little confused about my responsibility regarding memory. Here's the method: FYI the variable firstValue is my label, it's the only variable not declared in the method. -(IBAction)inputNumbersFromButtons:(id)sender { UIButton *placeHolderButton = [[UIButton alloc] init]; placeHolderButton = sender; NSString *placeHolderString = [[NSString alloc] init]; placeHolderString = [placeHolderString stringByAppendingString:firstValue.text]; NSString *addThisNumber = [[NSString alloc] init]; int i = placeHolderButton.tag; addThisNumber = [NSString stringWithFormat:@"%i", i]; NSString *newLabelText = [[NSString alloc] init]; newLabelText = [placeHolderString stringByAppendingString:addThisNumber]; [firstValue setText:newLabelText]; //[placeHolderButton release]; //[placeHolderString release]; //[addThisNumber release]; //[newLabelText release]; } The application works fine with those last four lines commented out, but it seems to me like I should be releasing these variables here. If I'm wrong about that I'd welcome a quick explanation about when it's necessary to release variables declared in functions and when it's not. Thanks.

    Read the article

  • IPhone - Memory Management problems.

    - by user321721
    i am going over my code and trying to get a handle on proper memory management. This code: imageView = [[[UIImageView alloc] initWithImage:myImage] autorelease]; causes my application to crash. I am using multiple view controllers within a nav bar controller. The app works fine, i cant select a person from the first view controller (tableview) and it puts me to a list of that persons photos, i can then select a photo from that view controller (tableview) and move to a final view with a scrollview for viewing the photo. Once i hit back on the navbar the previous view loads (list of photos in a tableview) however the app crashes right before the row is deselected using this code: (void)viewDidAppear:(BOOL)animated { [super viewDidAppear:animated]; if(RowSelected != nil) { [MainTableView deselectRowAtIndexPath:RowSelected animated:YES]; } } Row selected is stored when a the user clicks a row. If i leave the code as : imageView = [[UIImageView alloc] initWithImage:myImage]; The app runs fine. Am i doing something wrong? do i not need to autorelease this? Thanks!

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Objective-C: alloc of object within init of another object (memory management)

    - by Stefan Klumpp
    In my .h file I have: NSMutableArray *myArray; @property (nonatomic, retain) NSMutableArray *myArray; My .m file looks basically like this: @synthesize myArray; - (id) init { self = [super init]; if (self != nil) { self.myArray = .... ? // here I want to create an empty array } return self; } - (void) dealloc { [self.myArray release]; [super dealloc]; } What I'm not sure about is what do to in the init. 1) self.myArray = [[NSMutableArray alloc] init]; 2) NSMutableArray *tmp = [[NSMutableArray alloc] init]; self.myArray = tmp; [tmp release]; Solution 1 doesn't seem right to me, because of my @property (retain) setting I automatically increase the retain counter when setting self.myArray, but additionally I have already a "+1 retain" due to the [NSMutableArray alloc]. Thus the second solution seems more correct to me, even though it is cumbersome. Also am I wondering if self.myArray = ... is actually the same as [self setMyArray:...] and thus does increase the retain count.

    Read the article

  • Cocoa memory management - object going nil on me

    - by SirRatty
    Hi all, Mac OS X 10.6, Cocoa project, with retain/release gc I've got a function which: iterates over a specific directory, scans it for subfolders (included nested ones), builds an NSMutableArray of strings (one string per found subfolder path), and returns that array. e.g. (error handling removed for brevity). NSMutableArray * ListAllSubFoldersForFolderPath(NSString *folderPath) { NSMutableArray *a = [NSMutableArray arrayWithCapacity:100]; NSString *itemName = nil; NSFileManager *fm = [NSFileManager defaultManager]; NSDirectoryEnumerator *e = [fm enumeratorAtPath:folderPath]; while (itemName = [e nextObject]) { NSString *fullPath = [folderPath stringByAppendingPathComponent:itemName]; BOOL isDirectory; if ([fm fileExistsAtPath:fullPath isDirectory:&isDirectory]) { if (isDirectory is_eq YES) { [a addObject: fullPath]; } } } return a; } The calling function takes the array just once per session, keeps it around for later processing: static NSMutableArray *gFolderPaths = nil; ... gFolderPaths = ListAllSubFoldersForFolderPath(myPath); [gFolderPaths retain]; All appears good at this stage. [gFolderPaths count] returns the correct number of paths found, and [gFolderPaths description] prints out all the correct path names. The problem: When I go to use gFolderPaths later (say, the next run through my event loop) my assertion code (and gdb in Xcode) tells me that it is nil. I am not modifying gFolderPaths in any way after that initial grab, so I am presuming that my memory management is screwed and that gFolderPaths is being released by the runtime. My assumptions/presumptions I do not have to retain each string as I add it to the mutable array because that is done automatically, but I do have to retain the the array once it is handed over to me from the function, because I won't be using it immediately. Is this correct? Any help is appreciated.

    Read the article

  • Alfresco Community Edition Consultants

    - by Talkincat
    I am in the process of putting together an document management system based on Alfresco Community 3.2r2. Because Alfresco will not allow its partners to work with the Community edition, I have found it devilishly tricky to find consultants that specialize in Alfresco to help me with this project. Can anyone point me in the direction of someone that can help me get this system up an running? I will mostly need help with integrating Alfresco with Active Directory (LDAP passthrough, user/group sync and SSO) and performance tuning the system. Any help is greatly appreciated.

    Read the article

  • Alfresco Community Edition Consultants

    - by Talkincat
    I am in the process of putting together an document management system based on Alfresco Community 3.2r2. Because Alfresco will not allow its partners to work with the Community edition, I have found it devilishly tricky to find consultants that specialize in Alfresco to help me with this project. Can anyone point me in the direction of someone that can help me get this system up an running? I will mostly need help with integrating Alfresco with Active Directory (LDAP passthrough, user/group sync and SSO) and performance tuning the system. Any help is greatly appreciated.

    Read the article

  • Web-based (intranet / non-hosted) timesheet / project tracking tools

    - by warren
    I realize some similar questions have been asked along these lines before, but from reading-through them today, it appears they don't match my use case. I am looking for a web-based, non-hosted time and project tracking tool. I've downloaded Collabtive so far, but am looking for other suggestions, too. My list of requirements: runs on standard LAMP stack non-hosted (ie, there is an option to download and run it on a local server) not a desktop/single-user application easy-to-use - my audience is a mix of technical and non-technical folks easy to maintain - when time for upgrading comes, I'd really like to not have to rebuild the app (a la ./configure ; make ; make install) needs to support multiple users free-form project additions: we don't have a central project management authority (users should be able to add whatever they're working on, not merely from a drop-down) Does anyone here have experience with such tools? It doesn't have to be free.. but free is always nice :)

    Read the article

  • Web-based (intranet / non-hosted) timesheet / project tracking tools

    - by warren
    I realize some similar questions have been asked along these lines before, but from reading-through them today, it appears they don't match my use case. I am looking for a web-based, non-hosted time and project tracking tool. I've downloaded Collabtive and Achievo so far, but am looking for other suggestions, too. My list of requirements: runs on standard LAMP stack non-hosted (ie, there is an option to download and run it on a local server) not a desktop/single-user application easy-to-use - my audience is a mix of technical and non-technical folks easy to maintain - when time for upgrading comes, I'd really like to not have to rebuild the app (a la ./configure ; make ; make install) needs to support multiple users free-form project additions: we don't have a central project management authority (users should be able to add whatever they're working on, not merely from a drop-down) Does anyone here have experience with such tools? It doesn't have to be free.. but free is always nice :)

    Read the article

  • iTunes limitations( with respect to filetypes )?

    - by Sathya
    What filetypes does iTunes not recognize ? I have a bunch of flac files, some avi videos, and none of them seem to be in my iTunes library. Nothing happens when I import them ( via Drag & Drop, importing them via File - Add files). Is there any way for iTunes to manage them ? I really want to use a single app for all my media management, and it was WMP prior to purchasing my iPhone, and now with the iPhone, but with these limitations, it seems I will have to mix and match both, which I want to avoid. Any options ?

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Migrating Identity Providers - specifying a new users password hash.

    - by Stephen Denne
    We'd like to switch Identity Provider (and Web Access Manager), and also the user directory we use, but would like to do so without users needing to change their password. We currently have the SSHA of the passwords. I'm expecting to write code to perform the migration. I don't mind how complex the code has to be, rather my concern is whether such a migration is possible at all. MS Active Directory would be our preferred user store, but I believe that it can not have new users set up in it with a particular password hash. Is that correct? What user directory stores can be populated with users already set up with a SSHA password? What Identity Provider and Access Management products work with those stores?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Identity R2 Event Orlando

    - by Naresh Persaud
    Take the Next Big Step in Identity Management Evolution We call the latest release of Oracle Identity Management 11gthe evolved platform. And for good reason. It simplifies the user experience, enhances security, and allows businesses to expand the reach of identity management to the cloud and mobile environments like never before. Join this important event to discuss the recent launch of Oracle Identity Management 11g. You'll learn more about the evolution of this exceptional business solution and get the unique opportunity to network with existing Oracle customers and speak directly with Oracle product experts. The agenda includes: Overview of capabilities Product demonstrations Customer and partner presentations Discussion with early adopters Register now for the event or call 1.800.820.5592 ext. 11087. Register Now Join us for this event. Thursday, December 6, 2012The Capital GrillePointe Orlando, 9101International DriveOrlando, FL 32819Get Directions Agenda 9:00 a.m. Registration & Continental Breakfast 9:30 a.m. Welcome RemarksDave Profozich, Group Vice President, Oracle 9:45 a.m. Keynote:Oracle Identity Management 11g R2Scott Bonnell, Sr. Director Product Management, Oracle 10:30 a.m. Coffee Break 10:45 a.m. Oracle 11gR2 Overview/Demo/Technical walkthroughMark Wilcox, Sr. Manager Product Management, Oracle 11:45 a.m. Closing RemarksDave Profozich, Group Vice President, Oracle 12:00 noon Networking Lunch Register now for this exclusive event or call 1.800.820.5592 ext. 11087.If you are an employee or official of a government organization, please click here for important ethics information regarding this event. Copyright © 2012, Oracle and/or its affiliates. All rights reserved. Contact Us | Legal Notices and Terms of Use | Privacy Statement SEV100122190

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • iPhone memory management

    - by Prazi
    I am newbie to iPhone programming. I am not using Interface Builder in my programming. I have some doubt about memory management, @property topics in iPhone. Consider the following code @interface LoadFlag : UIViewController { UIImage *flag; UIImageView *preview; } @property (nonatomic, retain) UIImageView *preview; @property (nonatomic, retain) UIImage *flag; @implementation @synthesize preview; @synthesize flag; - (void)viewDidLoad { flag = [UIImage imageNamed:@"myImage.png"]]; NSLog(@"Preview: %d\n",[preview retainCount]); //Count: 0 but shouldn't it be 1 as I am retaining it in @property in interface file preview=[[UIImageView alloc]init]; NSLog(@"Count: %d\n",[preview retainCount]); //Count: 1 preview.frame=CGRectMake(0.0f, 0.0f, 100.0f, 100.0f); preview.image = flag; [self.view addSubview:preview]; NSLog(@"Count: %d\n",[preview retainCount]); //Count: 2 [preview release]; NSLog(@"Count: %d\n",[preview retainCount]); //Count: 1 } When & Why(what is the need) do I have to set @property with retain (in above case for UIImage & UIImageView) ? I saw this statement in many sample programs but didn't understood the need of it. When I declare @property (nonatomic, retain) UIImageView *preview; statement the retain Count is 0. Why doesn't it increase by 1 inspite of retaining it in @property. Also when I declare [self.view addSubview:preview]; then retain Count increments by 1 again. In this case does the "Autorelease pool" releases for us later or we have to take care of releasing it. I am not sure but I think that the Autorelease should handle it as we didn't explicitly retained it so why should we worry of releasing it. Now, after the [preview release]; statement my count is 1. Now I don't need UIImageView anymore in my program so when and where should I release it so that the count becomes 0 and the memory gets deallocated. Again, I am not sure but I think that the Autorelease should handle it as we didn't explicitly retained it so why should we worry of releasing it. What will happen if I release it in -(void) dealloc method In the statement - flag = [UIImage imageNamed:@"myImage.png"]]; I haven't allocated any memory to flag but how can I still use it in my program. In this case if I do not allocate memory then who allocates & deallocates memory to it or is the "flag" just a reference pointing to - [UIImage imageNamed:@"myImage.png"]];. If it is a reference only then do i need to release it. Thanks in advance.

    Read the article

  • Best language for scripting large scale file management

    - by Dan
    The National Park Service's Natural Sounds Program collects multiple terabytes of data each year measuring soundscapes. In your opinion, what is best available scripting language to manage massive amounts of files and file types? We would like to easily design and run efficient user-friendly scripts to search for and retrieve/create copies of files that may be located in different directories according a single static hierarchy. The OS will most likely be windows. Thanks!

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Objective-C memory management issue

    - by Toby Wilson
    I've created a graphing application that calls a web service. The user can zoom & move around the graph, and the program occasionally makes a decision to call the web service for more data accordingly. This is achieved by the following process: The graph has a render loop which constantly renders the graph, and some decision logic which adds web service call information to a stack. A seperate thread takes the most recent web service call information from the stack, and uses it to make the web service call. The other objects on the stack get binned. The idea of this is to reduce the number of web service calls to only those appropriate, and only one at a time. Right, with the long story out of the way (for which I apologise), here is my memory management problem: The graph has persistant (and suitably locked) NSDate* objects for the currently displayed start & end times of the graph. These are passed into the initialisers for my web service request objects. The web service call objects then retain the dates. After the web service calls have been made (or binned if they were out of date), they release the NSDate*. The graph itself releases and reallocates new NSDates* on the 'touches ended' event. If there is only one web service call object on the stack when removeAllObjects is called, EXC_BAD_ACCESS occurs in the web service call object's deallocation method when it attempts to release the date objects (even though they appear to exist and are in scope in the debugger). If, however, I comment out the release messages from the destructor, no memory leak occurs for one object on the stack being released, but memory leaks occur if there are more than one object on the stack. I have absolutely no idea what is going wrong. It doesn't make a difference what storage symantics I use for the web service call objects dates as they are assigned in the initialiser and then only read (so for correctness' sake are set to readonly). It also doesn't seem to make a difference if I retain or copy the dates in the initialiser (though anything else obviously falls out of scope or is unwantedly released elsewhere and causes a crash). I'm sorry this explanation is long winded, I hope it's sufficiently clear but I'm not gambling on that either I'm afraid. Major big thanks to anyone that can help, even suggest anything I may have missed?

    Read the article

< Previous Page | 29 30 31 32 33 34 35 36 37 38 39 40  | Next Page >