Search Results

Search found 8340 results on 334 pages for 'merge join'.

Page 331/334 | < Previous Page | 327 328 329 330 331 332 333 334  | Next Page >

  • Spring @Transactional not creating required transaction

    - by Steve
    Ok, so I've finally bowed to peer pressure and started using Spring in my web app :-)... So I'm trying to get the transaction handling stuff to work, and I just can't seem to get it. My Spring configuration looks like this: <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xmlns:tx="http://www.springframework.org/schema/tx" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx.xsd"> <bean id="groupDao" class="mil.navy.ndms.conops.common.dao.impl.jpa.GroupDao" lazy-init="true"> <property name="entityManagerFactory" ><ref bean="entityManagerFactory"/></property> </bean> <!-- enables interpretation of the @Required annotation to ensure that dependency injection actually occures --> <bean class="org.springframework.beans.factory.annotation.RequiredAnnotationBeanPostProcessor"/> <!-- enables interpretation of the @PersistenceUnit/@PersistenceContext annotations providing convenient access to EntityManagerFactory/EntityManager --> <bean class="org.springframework.orm.jpa.support.PersistenceAnnotationBeanPostProcessor"/> <!-- uses the persistence unit defined in the META-INF/persistence.xml JPA configuration file --> <bean id="entityManagerFactory" class="org.springframework.orm.jpa.LocalEntityManagerFactoryBean"> <property name="persistenceUnitName" value="CONOPS_PU" /> </bean> <!-- transaction manager for use with a single JPA EntityManagerFactory for transactional data access to a single datasource --> <bean id="jpaTransactionManager" class="org.springframework.orm.jpa.JpaTransactionManager"> <property name="entityManagerFactory" ref="entityManagerFactory"/> </bean> <!-- enables interpretation of the @Transactional annotation for declerative transaction managment using the specified JpaTransactionManager --> <tx:annotation-driven transaction-manager="jpaTransactionManager" proxy-target-class="true"/> </beans> persistence.xml: <?xml version="1.0" encoding="UTF-8"?> <persistence version="1.0" xmlns="http://java.sun.com/xml/ns/persistence" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/persistence http://java.sun.com/xml/ns/persistence/persistence_1_0.xsd"> <persistence-unit name="CONOPS_PU" transaction-type="RESOURCE_LOCAL"> <provider>org.hibernate.ejb.HibernatePersistence</provider> ... Class mappings removed for brevity... <properties> <property name="hibernate.dialect" value="org.hibernate.dialect.Oracle10gDialect"/> <property name="hibernate.connection.autocommit" value="false"/> <property name="hibernate.connection.username" value="****"/> <property name="hibernate.connection.password" value="*****"/> <property name="hibernate.connection.driver_class" value="oracle.jdbc.OracleDriver"/> <property name="hibernate.connection.url" value="jdbc:oracle:thin:@*****:1521:*****"/> <property name="hibernate.cache.provider_class" value="org.hibernate.cache.NoCacheProvider"/> <property name="hibernate.hbm2ddl.auto" value="create"/> <property name="hibernate.show_sql" value="true"/> <property name="hibernate.format_sql" value="true"/> </properties> </persistence-unit> </persistence> The DAO method to save my domain object looks like this: @Transactional(propagation=Propagation.REQUIRES_NEW) protected final T saveOrUpdate (T model) { EntityManager em = emf.createEntityManager ( ); EntityTransaction trans = em.getTransaction ( ); System.err.println ("Transaction isActive () == " + trans.isActive ( )); if (em != null) { try { if (model.getId ( ) != null) { em.persist (model); em.flush (); } else { em.merge (model); em.flush (); } } finally { em.close (); } } return (model); } So I try to save a copy of my Group object using the following code in my test case: context = new ClassPathXmlApplicationContext(configs); dao = (GroupDao)context.getBean("groupDao"); dao.saveOrUpdate (new Group ()); This bombs with the following exception: javax.persistence.TransactionRequiredException: no transaction is in progress at org.hibernate.ejb.AbstractEntityManagerImpl.flush(AbstractEntityManagerImpl.java:301) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:48) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:37) at java.lang.reflect.Method.invoke(Method.java:600) at org.springframework.orm.jpa.ExtendedEntityManagerCreator$ExtendedEntityManagerInvocationHandler.invoke(ExtendedEntityManagerCreator.java:341) at $Proxy26.flush(Unknown Source) at mil.navy.ndms.conops.common.dao.impl.jpa.GenericJPADao.saveOrUpdate(GenericJPADao.java:646) at mil.navy.ndms.conops.common.dao.impl.jpa.GroupDao.save(GroupDao.java:641) at mil.navy.ndms.conops.common.dao.impl.jpa.GroupDao$$FastClassByCGLIB$$50343b9b.invoke() at net.sf.cglib.proxy.MethodProxy.invoke(MethodProxy.java:149) at org.springframework.aop.framework.Cglib2AopProxy$DynamicAdvisedInterceptor.intercept(Cglib2AopProxy.java:622) at mil.navy.ndms.conops.common.dao.impl.jpa.GroupDao$$EnhancerByCGLIB$$7359ba58.save() at mil.navy.ndms.conops.common.dao.impl.jpa.GroupDaoTest.testGroupDaoSave(GroupDaoTest.java:91) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:48) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:37) at java.lang.reflect.Method.invoke(Method.java:600) at junit.framework.TestCase.runTest(TestCase.java:164) at junit.framework.TestCase.runBare(TestCase.java:130) at junit.framework.TestResult$1.protect(TestResult.java:106) at junit.framework.TestResult.runProtected(TestResult.java:124) at junit.framework.TestResult.run(TestResult.java:109) at junit.framework.TestCase.run(TestCase.java:120) at junit.framework.TestSuite.runTest(TestSuite.java:230) at junit.framework.TestSuite.run(TestSuite.java:225) at org.eclipse.jdt.internal.junit.runner.junit3.JUnit3TestReference.run(JUnit3TestReference.java:130) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:460) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:673) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:386) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:196) In addition, I get the following warnings when Spring first starts. Since these reference the entityManagerFactory and the transactionManager, they probably have some bearing on the problem, but I've no been able to decipher them enough to know what: Mar 11, 2010 12:19:27 PM org.springframework.context.support.AbstractApplicationContext$BeanPostProcessorChecker postProcessAfterInitialization INFO: Bean 'entityManagerFactory' is not eligible for getting processed by all BeanPostProcessors (for example: not eligible for auto-proxying) Mar 11, 2010 12:19:27 PM org.springframework.context.support.AbstractApplicationContext$BeanPostProcessorChecker postProcessAfterInitialization INFO: Bean 'entityManagerFactory' is not eligible for getting processed by all BeanPostProcessors (for example: not eligible for auto-proxying) Mar 11, 2010 12:19:27 PM org.springframework.context.support.AbstractApplicationContext$BeanPostProcessorChecker postProcessAfterInitialization INFO: Bean 'jpaTransactionManager' is not eligible for getting processed by all BeanPostProcessors (for example: not eligible for auto-proxying) Mar 11, 2010 12:19:27 PM org.springframework.context.support.AbstractApplicationContext$BeanPostProcessorChecker postProcessAfterInitialization INFO: Bean '(inner bean)' is not eligible for getting processed by all BeanPostProcessors (for example: not eligible for auto-proxying) Mar 11, 2010 12:19:27 PM org.springframework.context.support.AbstractApplicationContext$BeanPostProcessorChecker postProcessAfterInitialization INFO: Bean '(inner bean)' is not eligible for getting processed by all BeanPostProcessors (for example: not eligible for auto-proxying) Mar 11, 2010 12:19:27 PM org.springframework.context.support.AbstractApplicationContext$BeanPostProcessorChecker postProcessAfterInitialization INFO: Bean 'org.springframework.transaction.interceptor.TransactionAttributeSourceAdvisor' is not eligible for getting processed by all BeanPostProcessors (for example: not eligible for auto-proxying) Mar 11, 2010 12:19:27 PM org.springframework.context.support.AbstractApplicationContext$BeanPostProcessorChecker postProcessAfterInitialization INFO: Bean 'org.springframework.orm.jpa.support.PersistenceAnnotationBeanPostProcessor' is not eligible for getting processed by all BeanPostProcessors (for example: not eligible for auto-proxying) Mar 11, 2010 12:19:27 PM org.springframework.beans.factory.support.DefaultListableBeanFactory preInstantiateSingletons INFO: Pre-instantiating singletons in org.springframework.beans.factory.support.DefaultListableBeanFactory@37003700: defining beans [groupDao,org.springframework.beans.factory.annotation.RequiredAnnotationBeanPostProcessor,org.springframework.orm.jpa.support.PersistenceAnnotationBeanPostProcessor,entityManagerFactory,jpaTransactionManager,org.springframework.aop.config.internalAutoProxyCreator,org.springframework.transaction.interceptor.TransactionAttributeSourceAdvisor]; root of factory hierarchy Does anyone have any idea what I'm missing? I'm totally stumped... Thanks

    Read the article

  • Python hashable dicts

    - by TokenMacGuy
    As an exercise, and mostly for my own amusement, I'm implementing a backtracking packrat parser. The inspiration for this is i'd like to have a better idea about how hygenic macros would work in an algol-like language (as apposed to the syntax free lisp dialects you normally find them in). Because of this, different passes through the input might see different grammars, so cached parse results are invalid, unless I also store the current version of the grammar along with the cached parse results. (EDIT: a consequence of this use of key-value collections is that they should be immutable, but I don't intend to expose the interface to allow them to be changed, so either mutable or immutable collections are fine) The problem is that python dicts cannot appear as keys to other dicts. Even using a tuple (as I'd be doing anyways) doesn't help. >>> cache = {} >>> rule = {"foo":"bar"} >>> cache[(rule, "baz")] = "quux" Traceback (most recent call last): File "<stdin>", line 1, in <module> TypeError: unhashable type: 'dict' >>> I guess it has to be tuples all the way down. Now the python standard library provides approximately what i'd need, collections.namedtuple has a very different syntax, but can be used as a key. continuing from above session: >>> from collections import namedtuple >>> Rule = namedtuple("Rule",rule.keys()) >>> cache[(Rule(**rule), "baz")] = "quux" >>> cache {(Rule(foo='bar'), 'baz'): 'quux'} Ok. But I have to make a class for each possible combination of keys in the rule I would want to use, which isn't so bad, because each parse rule knows exactly what parameters it uses, so that class can be defined at the same time as the function that parses the rule. But combining the rules together is much more dynamic. In particular, I'd like a simple way to have rules override other rules, but collections.namedtuple has no analogue to dict.update(). Edit: An additional problem with namedtuples is that they are strictly positional. Two tuples that look like they should be different can in fact be the same: >>> you = namedtuple("foo",["bar","baz"]) >>> me = namedtuple("foo",["bar","quux"]) >>> you(bar=1,baz=2) == me(bar=1,quux=2) True >>> bob = namedtuple("foo",["baz","bar"]) >>> you(bar=1,baz=2) == bob(bar=1,baz=2) False tl'dr: How do I get dicts that can be used as keys to other dicts? Having hacked a bit on the answers, here's the more complete solution I'm using. Note that this does a bit extra work to make the resulting dicts vaguely immutable for practical purposes. Of course it's still quite easy to hack around it by calling dict.__setitem__(instance, key, value) but we're all adults here. class hashdict(dict): """ hashable dict implementation, suitable for use as a key into other dicts. >>> h1 = hashdict({"apples": 1, "bananas":2}) >>> h2 = hashdict({"bananas": 3, "mangoes": 5}) >>> h1+h2 hashdict(apples=1, bananas=3, mangoes=5) >>> d1 = {} >>> d1[h1] = "salad" >>> d1[h1] 'salad' >>> d1[h2] Traceback (most recent call last): ... KeyError: hashdict(bananas=3, mangoes=5) based on answers from http://stackoverflow.com/questions/1151658/python-hashable-dicts """ def __key(self): return tuple(sorted(self.items())) def __repr__(self): return "{0}({1})".format(self.__class__.__name__, ", ".join("{0}={1}".format( str(i[0]),repr(i[1])) for i in self.__key())) def __hash__(self): return hash(self.__key()) def __setitem__(self, key, value): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def __delitem__(self, key): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def clear(self): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def pop(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def popitem(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def setdefault(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def update(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def __add__(self, right): result = hashdict(self) dict.update(result, right) return result if __name__ == "__main__": import doctest doctest.testmod()

    Read the article

  • jQuery Toggle with Cookie

    - by Cameron
    I have the following toggle system, but I want it to remember what was open/closed using the jQuery cookie plugin. So for example if I open a toggle and then navigate away from the page, when I come back it should be still open. This is code I have so far, but it's becoming rather confusing, some help would be much appreciated thanks. jQuery.cookie = function (name, value, options) { if (typeof value != 'undefined') { options = options || {}; if (value === null) { value = ''; options = $.extend({}, options); options.expires = -1; } var expires = ''; if (options.expires && (typeof options.expires == 'number' || options.expires.toUTCString)) { var date; if (typeof options.expires == 'number') { date = new Date(); date.setTime(date.getTime() + (options.expires * 24 * 60 * 60 * 1000)); } else { date = options.expires; } expires = '; expires=' + date.toUTCString(); } var path = options.path ? '; path=' + (options.path) : ''; var domain = options.domain ? '; domain=' + (options.domain) : ''; var secure = options.secure ? '; secure' : ''; document.cookie = [name, '=', encodeURIComponent(value), expires, path, domain, secure].join(''); } else { var cookieValue = null; if (document.cookie && document.cookie != '') { var cookies = document.cookie.split(';'); for (var i = 0; i < cookies.length; i++) { var cookie = jQuery.trim(cookies[i]); if (cookie.substring(0, name.length + 1) == (name + '=')) { cookieValue = decodeURIComponent(cookie.substring(name.length + 1)); break; } } } return cookieValue; } }; // var showTop = $.cookie('showTop'); if ($.cookie('showTop') == 'collapsed') { $(".toggle_container").hide(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); } else { $(".toggle_container").show(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); }; $(".trigger").click(function () { if ($(".toggle_container").is(":hidden")) { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'expanded'); } else { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'collapsed'); } return false; }); and this is a snippet of the HTML it works with: <li> <label for="small"><input type="checkbox" id="small" /> Small</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="funding"><strong>Funding</strong></p> <ul class="childs"> <li class="child"> <label for="fully-funded1"><input type="checkbox" id="fully-funded1" /> Fully Funded</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="days"><strong>Days</strong></p> <ul class="days clearfix"> <li><label for="1pre16">Pre 16</label> <input type="text" id="1pre16" /></li> <li><label for="2post16">Post 16</label> <input type="text" id="2post16" /></li> <li><label for="3teacher">Teacher</label> <input type="text" id="3teacher" /></li> </ul> </div> </li>

    Read the article

  • Arduino - AdHoc Network Setup

    - by methodMan
    I`m currently working with an arduino trying to build an adhoc network to which a device can connect to and send web request to. The problem I am currently having is that I can only set up one connection and then when that connection is terminated (client.stop()) all subsequent connections are not picked up by the server, even a curl command just sits there spinning. The first connection I start when I reset the server works fine and I am able to talk to the server; but after that, the arduino can no longer find new clients (even though it's trying with the library given). I`m using the sparkfun library for the wifly shield cloned from github, along with an Arduino Uno. My current code is based off their default example 'WiFly_AdHoc_Example' but I had to remove a few things to get the network to start up which might be the cause of this problem. Here is the .ino file that I am running. #include <SPI.h> #include <WiFly.h> //#include <SoftwareSerial.h> //SoftwareSerial mySerial( 5, 4); //Part from example not used(see below) WiFlyServer server(80); void setup() { Serial.begin(9600); //The code below is from the example but when I run it the WiFly will hang // on Wifly.begin(). Without it the WiFly starts up fine but only works for // one request. //mySerial.begin(9600); //WiFly.setUart(&mySerial); // Tell the WiFly library that we are not //using the SPIUart Serial.println("**************Starting WiFly**************"); // Enable Adhoc mod WiFly.begin(true); Serial.println("WiFly started, creating network."); if (!WiFly.createAdHocNetwork("wifly")) { Serial.print("Failed to create ad hoc network."); while (1) { // Hang on failure. } } Serial.println("Network created"); Serial.print("IP: "); Serial.println(WiFly.ip()); Serial.println("Starting Server..."); server.begin(); Serial.print("Server started, waiting for client."); } void loop() { delay(200); WiFlyClient client = server.available(); if (client) { Serial.println("Client Found."); // a string to store received commands String current_command = ""; while (client.connected()) { if (client.available()) { //Gets a character from the sent request. char c = client.read(); if (c=='#' || c=='\n') //End of extraneous output { current_command = ""; } else if(c!= '\n') { current_command+=c; } if (current_command== "get") { // output the value of each analog input pin for (int i = 0; i < 6; i++) { client.print("analog input "); client.print(i); client.print(" is "); client.print(analogRead(i)); client.println("<br />"); } } else if(current_command== "hello") { client.println("Hello there, I'm still here."); } else if (current_command== "quit") { client.println("Goodbye..."); client.stop(); current_command == ""; break; } else if (current_command == "*OPEN*") { current_command == ""; } } } // give the web browser time to receive the data delay(200); // close the connection client.stop(); } } If anyone understands this better then I (I`m new to arduino) please leave some helpful comments. Or just help me out on getting this little web server up and running so that I can hit it with more then one request. If there is any other helpful information I can provide please let me know. Thanks for reading and hope you can help. EDIT: Using telnet I can successfully connect (the first time) and send commands to the arduino including one to terminate the connection (calls the client.stop() method). But when I try to reconnect though telnet, it says the connection was successful but on the arduino it's still looping thinking the client is still false. WHAT??? I know right, I'm getting mixed messages from telnet vs arduino. None of the commands work obviously since the ardunio is still looping waiting for a client that evaluates to true. I'm gonna take a look at WiFlyServer from the library I imported and see if I can dig up the problem because somehow that server.available() method isn't finding new clients. Noticing a lot of TODO's in the library code.... EDIT: So I found the reason for the problem, it was in WiFlyServer.cpp file from the sparkfun library. The code that was causing the reconnect issue was infact in the server.availible() method. Right at the top of the method, there is a check: // TODO: Ensure no active non-server client connection. if (!WiFly.serverConnectionActive) { activeClient._port = 0; } For some reason when I comment this out, I can reconnect fine and everything works as it should. I will now dive into the library and see if I can fix this, I'm not exactly sure what this is doing but it gets called when the server connection is not active and is somehow blocking subsequent connections. Does anyone have any ideas how I might get to the root of this problem without using this commenting hack? Please help, no-one has commented or answered yet! Don't you want to join in on the fun???

    Read the article

  • Rails multiple select box issue for search

    - by Reido
    First off here is my model, controller, view: My model, this is where I have my search code:--------------------------- def self.find_by_lcc(params) where = [] where << "category = 'Land'" unless params[:mls].blank? where << "mls = :mls" end unless params[:county].blank? where << "county = :county" end unless params[:acreage_range].blank? where << "acreage_range = :acreage_range" end unless params[:landtype].blank? where << "landtype = :landtype" end unless params[:price_range].blank? where << "price_range = :price_range" end if where.empty? [] else find(:all, :conditions => [where.join(" AND "), params], :order => "county, price desc") end end My controller:---------------- def land @counties = ['Adams', 'Alcorn', 'Amite', 'Attala'] @title = "Browse" return if params[:commit].nil? @properties = Property.find_by_lcc(params) else 'No properties were found' render :action = 'land_table' end My View: ---------------------- <table width="900"> <tr> <td> <% form_tag({ :action => "land" }, :method => "get") do %> <fieldset> <legend>Search our Land Properties</legend> <div class="form_row"><p>&nbsp;</p></div> <div class="form_row"> <label for="mls">MLS Number:</label>&nbsp; <%= text_field_tag 'mls', params[:mls] %> </div> <div class="form_row"> <label for "county"><font color="#ff0000">*County:</font></label>&nbsp; <%= select_tag "county", options_for_select(@counties), :multiple => true, :size => 6 %> </div> <div class="form_row"> <label for "acreage_range">Acreage:</label>&nbsp; <%= select_tag "acreage_range", options_for_select([['All',''],['1-10','1-10'],['11-25','11-25'],['26-50','26-50'],['51-100','51-100']]) %> </div> <div class="form_row"> <label for "landtype">Type:</label>&nbsp; <%= select_tag "landtype", options_for_select([['All',''],['Waterfront','Waterfront'],['Wooded','Wooded'],['Pasture','Pasture'],['Woods/Pasture','Woods/Pasture'],['Lot','Lot']]) %> </div> <div class="form_row"> <label for="price_range"><font color="#ff0000">*Price:</font></label>&nbsp; <%= select_tag "price_range", options_for_select([['All',''],['0-1,000','0-1,000'],['1,001-10,000','1,001-10,000'],['10,001-50,000','10,001-50,000'],['50,001-100,000','50,001-100,000'],['100,001-150,000']])%> </div> <input type="text" style="display: none;" disabled="disabled" size="1" /> <%= submit_tag "Search", :class => "submit" %> </fieldset> <% end%> </td> </tr> </table> The search works fine until I add ", :multiple = true, :size = 6" to make the county field multiple select. Then I get the error: Processing PublicController#land (for 65.0.81.83 at 2010-04-01 13:11:30) [GET] Parameters: {"acreage_range"=>"", "commit"=>"Search", "county"=>["Adams", "Amite"], "landtype"=>"", "price_range"=>"", "mls"=>""} ActiveRecord::StatementInvalid (Mysql::Error: Operand should contain 1 column(s): SELECT * FROM `properties` WHERE (category = 'Land' AND county = 'Adams','Amite') ORDER BY county, price desc): app/models/property.rb:93:in `find_by_lcc' app/controllers/public_controller.rb:84:in `land' /usr/lib/ruby/1.8/thread.rb:135:in `synchronize' fcgi (0.8.7) lib/fcgi.rb:117:in `session' fcgi (0.8.7) lib/fcgi.rb:104:in `each_request' fcgi (0.8.7) lib/fcgi.rb:36:in `each' dispatch.fcgi:24 I've tried to make the county, acreage_range, and price_range fields into multiple select boxes numerous ways, but can not get any method to work correctly. Any help would be greatly appreciated. Thanks,

    Read the article

  • NServiceBus pipeline with Distributors

    - by David
    I'm building a processing pipeline with NServiceBus but I'm having trouble with the configuration of the distributors in order to make each step in the process scalable. Here's some info: The pipeline will have a master process that says "OK, time to start" for a WorkItem, which will then start a process like a flowchart. Each step in the flowchart may be computationally expensive, so I want the ability to scale out each step. This tells me that each step needs a Distributor. I want to be able to hook additional activities onto events later. This tells me I need to Publish() messages when it is done, not Send() them. A process may need to branch based on a condition. This tells me that a process must be able to publish more than one type of message. A process may need to join forks. I imagine I should use Sagas for this. Hopefully these assumptions are good otherwise I'm in more trouble than I thought. For the sake of simplicity, let's forget about forking or joining and consider a simple pipeline, with Step A followed by Step B, and ending with Step C. Each step gets its own distributor and can have many nodes processing messages. NodeA workers contain a IHandleMessages processor, and publish EventA NodeB workers contain a IHandleMessages processor, and publish Event B NodeC workers contain a IHandleMessages processor, and then the pipeline is complete. Here are the relevant parts of the config files, where # denotes the number of the worker, (i.e. there are input queues NodeA.1 and NodeA.2): NodeA: <MsmqTransportConfig InputQueue="NodeA.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeA.Distrib.Control" DistributorDataAddress="NodeA.Distrib.Data" > <MessageEndpointMappings> </MessageEndpointMappings> </UnicastBusConfig> NodeB: <MsmqTransportConfig InputQueue="NodeB.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeB.Distrib.Control" DistributorDataAddress="NodeB.Distrib.Data" > <MessageEndpointMappings> <add Messages="Messages.EventA, Messages" Endpoint="NodeA.Distrib.Data" /> </MessageEndpointMappings> </UnicastBusConfig> NodeC: <MsmqTransportConfig InputQueue="NodeC.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeC.Distrib.Control" DistributorDataAddress="NodeC.Distrib.Data" > <MessageEndpointMappings> <add Messages="Messages.EventB, Messages" Endpoint="NodeB.Distrib.Data" /> </MessageEndpointMappings> </UnicastBusConfig> And here are the relevant parts of the distributor configs: Distributor A: <add key="DataInputQueue" value="NodeA.Distrib.Data"/> <add key="ControlInputQueue" value="NodeA.Distrib.Control"/> <add key="StorageQueue" value="NodeA.Distrib.Storage"/> Distributor B: <add key="DataInputQueue" value="NodeB.Distrib.Data"/> <add key="ControlInputQueue" value="NodeB.Distrib.Control"/> <add key="StorageQueue" value="NodeB.Distrib.Storage"/> Distributor C: <add key="DataInputQueue" value="NodeC.Distrib.Data"/> <add key="ControlInputQueue" value="NodeC.Distrib.Control"/> <add key="StorageQueue" value="NodeC.Distrib.Storage"/> I'm testing using 2 instances of each node, and the problem seems to come up in the middle at Node B. There are basically 2 things that might happen: Both instances of Node B report that it is subscribing to EventA, and also that NodeC.Distrib.Data@MYCOMPUTER is subscribing to the EventB that Node B publishes. In this case, everything works great. Both instances of Node B report that it is subscribing to EventA, however, one worker says NodeC.Distrib.Data@MYCOMPUTER is subscribing TWICE, while the other worker does not mention it. In the second case, which seem to be controlled only by the way the distributor routes the subscription messages, if the "overachiever" node processes an EventA, all is well. If the "underachiever" processes EventA, then the publish of EventB has no subscribers and the workflow dies. So, my questions: Is this kind of setup possible? Is the configuration correct? It's hard to find any examples of configuration with distributors beyond a simple one-level publisher/2-worker setup. Would it make more sense to have one central broker process that does all the non-computationally-intensive traffic cop operations, and only sends messages to processes behind distributors when the task is long-running and must be load balanced? Then the load-balanced nodes could simply reply back to the central broker, which seems easier. On the other hand, that seems at odds with the decentralization that is NServiceBus's strength. And if this is the answer, and the long running process's done event is a reply, how do you keep the Publish that enables later extensibility on published events?

    Read the article

  • Dojo - How to position tooltip close to text?

    - by user244394
    Like the title says i want to be able to display the tooltip close to the text, currently it is displayed far away in the cell. Tobe noted the tooltip positions correctly for large text, only fails for small text. In DOJO How can i position the tooltip close to the text? I have this bit of code snippet that display the tooltip in the grid cells. Screenshot attached, html <div class="some_app claro"></div> ... com.c.widget.EnhancedGrid = function ( aParent, options ) { var grid, options; this.theParentApp = aParent; dojo.require("dojox.grid.EnhancedGrid"); dojo.require("dojox.grid.enhanced.plugins.Menu"); dojo.require("dojox.grid.enhanced.plugins.Selector"); dojo.require("dojox.grid.enhanced.plugins.Pagination"); dojo.require("dojo.store.Memory"); dojo.require("dojo.data.ObjectStore"); dojo.require("dojo._base.xhr"); dojo.require("dojo.domReady!"); dojo.require("dojo.date.locale"); dojo.require("dojo._base.connect"); dojo.require("dojox.data.JsonRestStore"); dojo.require("dojo.data.ItemFileReadStore"); dojo.require("dijit.Menu"); dojo.require("dijit.MenuItem"); dojo.require('dijit.MenuSeparator'); dojo.require('dijit.CheckedMenuItem'); dojo.require('dijit.Tooltip'); dojo.require('dojo/query'); dojo.require("dojox.data.QueryReadStore"); // main initialization function this.init = function( options ) { var me = this; // default options var defaultOptions = { widgetName: ' Enhancedgrid', render: true, // immediately render the grid draggable: true, // disables column dragging containerNode: false, // the Node to hold the Grid (optional) mashupUrl: false, // the URL of the mashup (required) rowsPerPage: 20, //Default number of items per page columns: false, // columns (required) width: "100%", // width of grid height: "100%", // height of grid rowClass: function (rowData) {}, onClick: function () {}, headerMenu: false, // adding a menu pop-up for the header. selectedRegionMenu: false, // adding a menu pop-up for the rows. menusObject: false, //object to start-up the menus using the plug-in. sortInfo: false, // The column default sort infiniteScrolling: false //If true, the enhanced grid will have an infinite scrolling. }; // merge user provided options me.options = jQuery.extend( {}, defaultOptions, options ); // check we have minimum required options if ( ! me.options.mashupUrl ){ throw ("You must supply a mashupUrl"); } if ( ! me.options.columns ){ throw ("You must supply columns"); } // make the column for formatting based on its data type. me.preProcessColumns(); // create the Contextual Menu me.createMenu(); // create the grid object and return me.createGrid(); }; // Loading the data to the grid. this.loadData = function () { var me = this; if (!me.options.infiniteScrolling) { var xhrArgs = { url: me.options.mashupUrl, handleAs: "json", load: function( data ){ var store = new dojo.data.ItemFileReadStore({ data : {items : eval( "data."+me.options.dataRoot)}}); store.fetch({ onComplete : function(items, request) { if (me.grid.selection !== null) { me.grid.selection.clear(); } me.grid.setStore(store); }, onError : function(error) { me.onError(error); } }); }, error: function (error) { me.onError(error); } }; dojo.xhrGet(xhrArgs); } else { dojo.declare('NotificationQueryReadStore', dojox.data.QueryReadStore, { // // hacked -- override to map to proper data structure // from mashup // _xhrFetchHandler : function(data, request, fetchHandler, errorHandler) { // // TODO: need to have error handling here when // data has "error" data structure // // // remap data object before process by super method // var dataRoot = eval ("data."+me.options.dataRoot); var dataTotal = eval ("data."+me.options.dataTotal); data = { numRows : dataTotal, items : dataRoot }; // call to super method to process mapped data and // set rowcount // for proper display this.inherited(arguments); } }); var queryStore = new NotificationQueryReadStore({ url : me.options.mashupUrl, urlPreventCache: true, requestMethod : "get", onError: function (error) { me.onError(error); } }); me.grid.setStore(queryStore); } }; this.preProcessColumns = function () { var me = this; var options = me.options; for (i=0;i<this.options.columns.length;i++) { if (this.options.columns[i].formatter==null) { switch (this.options.columns[i].datatype) { case "string": this.options.columns[i].formatter = me.formatString; break; case "date": this.options.columns[i].formatter = me.formatDate; var todayDate = new Date(); var gmtTime = c.util.Date.parseDate(todayDate.toString()).toString(); var gmtval = gmtTime.substring(gmtTime.indexOf('GMT'),(gmtTime.indexOf('(')-1)); this.options.columns[i].name = this.options.columns[i].name + " ("+gmtval+")"; } } if (this.options.columns[i].sortDefault) { me.options.sortInfo = i+1; } } }; // create GRID object using supplied options this.createGrid = function () { var me = this; var options = me.options; // create a new grid this.grid = new dojox.grid.EnhancedGrid ({ width: options.width, height: options.height, query: { id: "*" }, keepSelection: true, formatterScope: this, structure: options.columns, columnReordering: options.draggable, rowsPerPage: options.rowsPerPage, //sortInfo: options.sortInfo, plugins : { menus: options.menusObject, selector: {"row":"multi", "cell": "disabled" }, }, //Allow the user to decide if a column is sortable by setting sortable = true / false canSort: function(col) { if (options.columns[Math.abs(col)-1].sortable) return true; else return false; }, //Change the row colors depending on severity column. onStyleRow: function (row) { var grid = me.grid; var item = grid.getItem(row.index); if (item && options.rowClass(item)) { row.customClasses += " " +options.rowClass(item); if (grid.selection.selectedIndex == row.index) { row.customClasses += " dojoxGridRowSelected"; } grid.focus.styleRow(row); grid.edit.styleRow(row); } }, onCellMouseOver: function (e){ // var pos = dojo.position(this, true); // alert(pos); console.log( e.rowIndex +" cell node :"+ e.cellNode.innerHTML); // var pos = dojo.position(this, true); console.log( " pos :"+ e.pos); if (e.cellNode.innerHTML!="") { dijit.showTooltip(e.cellNode.innerHTML, e.cellNode); } }, onCellMouseOut: function (e){ dijit.hideTooltip(e.cellNode); }, onHeaderCellMouseOver: function (e){ if (e.cellNode.innerHTML!="") { dijit.showTooltip(e.cellNode.innerHTML, e.cellNode); } }, onHeaderCellMouseOut: function (e){ dijit.hideTooltip(e.cellNode); }, }); // ADDED CODE FOR TOOLTIP var gridTooltip = new Tooltip({ connectId: "grid1", selector: "td", position: ["above"], getContent: function(matchedNode){ var childNode = matchedNode.childNodes[0]; if(childNode.nodeType == 1 && childNode.className == "user") { this.position = ["after"]; this.open(childNode); return false; } if(matchedNode.className && matchedNode.className == "user") { this.position = ["after"]; } else { this.position = ["above"]; } return matchedNode.textContent; } }); ... //Construct the grid this.buildGrid = function(){ var datagrid = new com.emc.widget.EnhancedGrid(this,{ Url: "/dge/api/-resultFormat=json&id="+encodeURIComponent(idUrl), dataRoot: "Root.ATrail", height: '100%', columns: [ { name: 'Time', field: 'Time', width: '20%', datatype: 'date', sortable: true, searchable: true, hidden: false}, { name: 'Type', field: 'Type', width: '20%', datatype: 'string', sortable: true, searchable: true, hidden: false}, { name: 'User ID', field: 'UserID', width: '20%', datatype: 'string', sortable: true, searchable: true, hidden: false } ] }); this.grid = datagrid; };

    Read the article

  • Am I crazy? (How) should I create a jQuery content editor?

    - by Brendon Muir
    Ok, so I created a CMS mainly aimed at Primary Schools. It's getting fairly popular in New Zealand but the one thing I hate with a passion is the largely bad quality of in browser WYSIWYG editors. I've been using KTML (made by InterAKT which was purchased by Adobe a few years ago). In my opinion this editor does a lot of great things (image editing/management, thumbnailing and pretty good content editing). Unfortunately time has had its nasty way with this product and new browsers are beginning to break features and generally degrade the performance of this tool. It's also quite scary basing my livelihood on a defunct product! I've been hunting, in fact I regularly hunt around to see if anything has changed in the WYSIWYG arena. The closest thing I've seen that excites me is the WYSIHAT framework, but they've decided to ignore a pretty relevant editing paradigm which I'm going to outline below. This is the idea for my proposed editor, and I don't know of any existing products that can do this properly: Right, so the traditional model for editing let's say a Page in a CMS is to log into a 'back end' and click edit on the page. This will then load another screen with the editor in it and perhaps a few other fields. More advanced CMS's will maybe have several editing boxes that are for different portions of the page. Anyway, the big problem with this way of doing things is that the user is editing a document outside of the final context it will appear in. In the simplest terms, this means the page template. Many things can be wrong, e.g. the with of the editing area might be different to the width of the actual template area. The height is nearly always fixed because existing editors always seem to use IFRAMES for backward compatibility. And there are plenty of other beefs which I'm sure you're quite aware of if you're in this development area. Here's my editor utopia: You click 'Edit Page': The actual page (with its actual template) displays. Portions of the page have been marked as editable via a class name. You click on one of these areas (in my case it'd just be the big 'body' area in the middle of the template) and a editing bar drops down from the top of the screen with all your standard controls (bold, italic, insert image etc...). Iframes are never used, instead we rely on setting contentEditable to true on the DIV's in question. Firefox 2 and IE6 can go away, let's move on. You can edit the page knowing exactly how it will look when you save it. Because all the styles for this template are loaded, your headings will look correct, everything will be just dandy. Is this such a radical concept? Why are we still content with TinyMCE and that other editor that is too embarrassing to use because it sounds like a swear word!? Let's face the facts: I'm a JavaScript novice. I did once play around in this area using the Javascript Anthology from SitePoint as a guide. It was quite a cool learning experience, but they of course used the IFRAME to make their lives easier. I tried to go a different route and just use contentEditable and even tried to sidestep the native content editing routines (execCommand) and instead wrote my own. They kind of worked but there were always issues. Now we have jQuery, and a few libraries that abstract things like IE's lack of Range support. I'm wondering, am I crazy, or is it actually a good idea to try and build an editor around this editing paradigm using jQuery and relevant plugins to make the job easier? My actual questions: Where would you start? What plugins do you know of that would help the most? Is it worth it, or is there a magical project that already exists that I should join in on? What are the biggest hurdles to overcome in a project like this? Am I crazy? I hope this question has been posted on the right board. I figured it is a technical question as I'm wanting to know specific hurdles and pitfalls to watch out for and also if it is technically feasible with todays technology. Looking forward to hearing peoples thoughts and opinions.

    Read the article

  • Trouble updating my datagrid in WPF

    - by wrigley06
    As the title indicates, I'm having trouble updating a datagrid in WPF. Basically what I'm trying to accomplish is a datagrid, that is connected to a SQL Server database, that updates automatically once a user enters information into a few textboxes and clicks a submit button. You'll notice that I have a command that joins two tables. The data from the Quote_Data table will be inserted by a different user at a later time. For now my only concern is getting the information from the textboxes and into the General_Info table, and from there into my datagrid. The code, which I'll include below compiles fine, but when I hit the submit button, nothing happens. This is the first application I've ever built working with a SQL Database so many of these concepts are new to me, which is why you'll probably look at my code and wonder what is he thinking. public partial class MainWindow : Window { public MainWindow() { InitializeComponent(); } public DataSet mds; // main data set (mds) private void Window_Loaded_1(object sender, RoutedEventArgs e) { try { string connectionString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection connection = new SqlConnection(connectionString)) { connection.Open(); //Merging tables General_Info and Quote_Data SqlCommand cmd = new SqlCommand("SELECT General_Info.Quote_ID, General_Info.Open_Quote, General_Info.Customer_Name," + "General_Info.OEM_Name, General_Info.Qty, General_Info.Quote_Num, General_Info.Fab_Drawing_Num, " + "General_Info.Rfq_Num, General_Info.Rev_Num, Quote_Data.MOA, Quote_Data.MOQ, " + "Quote_Data.Markup, Quote_Data.FOB, Quote_Data.Shipping_Method, Quote_Data.Freight, " + "Quote_Data.Vendor_Price, Unit_Price, Quote_Data.Difference, Quote_Data.Vendor_NRE_ET, " + "Quote_Data.NRE, Quote_Data.ET, Quote_Data.STI_NET, Quote_Data.Mfg_Time, Quote_Data.Delivery_Time, " + "Quote_Data.Mfg_Name, Quote_Data.Mfg_Location " + "FROM General_Info INNER JOIN dbo.Quote_Data ON General_Info.Quote_ID = Quote_Data.Quote_ID", connection); SqlDataAdapter da = new SqlDataAdapter(cmd); DataTable dt = new DataTable(); da.Fill(dt); MainGrid.ItemsSource = dt.DefaultView; mds = new DataSet(); da.Fill(mds, "General_Info"); MainGrid.DataContext = mds.Tables["General_Info"]; } } catch (Exception ex) { MessageBox.Show(ex.Message); } // renaming column names from the database so they are easier to read in the datagrid MainGrid.Columns[0].Header = "#"; MainGrid.Columns[1].Header = "Date"; MainGrid.Columns[2].Header = "Customer"; MainGrid.Columns[3].Header = "OEM"; MainGrid.Columns[4].Header = "Qty"; MainGrid.Columns[5].Header = "Quote Number"; MainGrid.Columns[6].Header = "Fab Drawing Num"; MainGrid.Columns[7].Header = "RFQ Number"; MainGrid.Columns[8].Header = "Rev Number"; MainGrid.Columns[9].Header = "MOA"; MainGrid.Columns[10].Header = "MOQ"; MainGrid.Columns[11].Header = "Markup"; MainGrid.Columns[12].Header = "FOB"; MainGrid.Columns[13].Header = "Shipping"; MainGrid.Columns[14].Header = "Freight"; MainGrid.Columns[15].Header = "Vendor Price"; MainGrid.Columns[16].Header = "Unit Price"; MainGrid.Columns[17].Header = "Difference"; MainGrid.Columns[18].Header = "Vendor NRE/ET"; MainGrid.Columns[19].Header = "NRE"; MainGrid.Columns[20].Header = "ET"; MainGrid.Columns[21].Header = "STINET"; MainGrid.Columns[22].Header = "Mfg. Time"; MainGrid.Columns[23].Header = "Delivery Time"; MainGrid.Columns[24].Header = "Manufacturer"; MainGrid.Columns[25].Header = "Mfg. Location"; } private void submitQuotebtn_Click(object sender, RoutedEventArgs e) { CustomerData newQuote = new CustomerData(); int quantity; quantity = Convert.ToInt32(quantityTxt.Text); string theDate = System.DateTime.Today.Date.ToString("d"); newQuote.OpenQuote = theDate; newQuote.CustomerName = customerNameTxt.Text; newQuote.OEMName = oemNameTxt.Text; newQuote.Qty = quantity; newQuote.QuoteNumber = quoteNumberTxt.Text; newQuote.FdNumber = fabDrawingNumberTxt.Text; newQuote.RfqNumber = rfqNumberTxt.Text; newQuote.RevNumber = revNumberTxt.Text; try { string insertConString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection insertConnection = new SqlConnection(insertConString)) { insertConnection.Open(); SqlDataAdapter adapter = new SqlDataAdapter(Sqtm.Properties.Settings.Default.SqtmDbConnectionString, insertConnection); SqlCommand updateCmd = new SqlCommand("UPDATE General_Info " + "Quote_ID = @Quote_ID, " + "Open_Quote = @Open_Quote, " + "OEM_Name = @OEM_Name, " + "Qty = @Qty, " + "Quote_Num = @Quote_Num, " + "Fab_Drawing_Num = @Fab_Drawing_Num, " + "Rfq_Num = @Rfq_Num, " + "Rev_Num = @Rev_Num " + "WHERE Quote_ID = @Quote_ID"); updateCmd.Connection = insertConnection; System.Data.SqlClient.SqlParameterCollection param = updateCmd.Parameters; // // Add new SqlParameters to the command. // param.AddWithValue("Open_Quote", newQuote.OpenQuote); param.AddWithValue("Customer_Name", newQuote.CustomerName); param.AddWithValue("OEM_Name", newQuote.OEMName); param.AddWithValue("Qty", newQuote.Qty); param.AddWithValue("Quote_Num", newQuote.QuoteNumber); param.AddWithValue("Fab_Drawing_Num", newQuote.FdNumber); param.AddWithValue("Rfq_Num", newQuote.RfqNumber); param.AddWithValue("Rev_Num", newQuote.RevNumber); adapter.UpdateCommand = updateCmd; adapter.Update(mds.Tables[0]); mds.AcceptChanges(); } } catch (Exception ex) { MessageBox.Show(ex.Message); } } Thanks in advance to anyone who can help, I really appreciate it, Andrew

    Read the article

  • retriving hearders in all pages of word

    - by udaya
    Hi I am exporting data from php page to word,, there i get 'n' number of datas in each page .... How to set the maximum number of data that a word page can contain ,,,, I want only 20 datas in a single page This is the coding i use to export the data to word i got the data in word format but the headers are not available for all the pages ex: Page:1 slno name country state Town 1 vivek india tamilnadu trichy 2 uday india kerala coimbatore like this i am getting many details but in my page:2 i dont get the headers like name country state and town....But i can get the details like kumar america xxxx yyyy i want the result to be like slno name country state town n chris newzealand ghgg jkgj Can i get the headers If it is not possible Is there anyway to limit the number of details being displayed in each page //EDIT YOUR MySQL Connection Info: $DB_Server = "localhost"; //your MySQL Server $DB_Username = "root"; //your MySQL User Name $DB_Password = ""; //your MySQL Password $DB_DBName = "cms"; //your MySQL Database Name $DB_TBLName = ""; //your MySQL Table Name $sql = "SELECT (SELECT COUNT(*) FROM tblentercountry t2 WHERE t2.dbName <= t1.dbName and t1.dbIsDelete='0') AS SLNO ,dbName as Namee,t3.dbCountry as Country,t4.dbState as State,t5.dbTown as Town FROM tblentercountry t1 join tablecountry as t3, tablestate as t4, tabletown as t5 where t1.dbIsDelete='0' and t1.dbCountryId=t3.dbCountryId and t1.dbStateId=t4.dbStateId and t1.dbTownId=t5.dbTownId order by dbName limit 0,50"; //Optional: print out title to top of Excel or Word file with Timestamp //for when file was generated: //set $Use_Titel = 1 to generate title, 0 not to use title $Use_Title = 1; //define date for title: EDIT this to create the time-format you need //$now_date = DATE('m-d-Y H:i'); //define title for .doc or .xls file: EDIT this if you want $title = "Country"; /* Leave the connection info below as it is: just edit the above. (Editing of code past this point recommended only for advanced users.) */ //create MySQL connection $Connect = @MYSQL_CONNECT($DB_Server, $DB_Username, $DB_Password) or DIE("Couldn't connect to MySQL:" . MYSQL_ERROR() . "" . MYSQL_ERRNO()); //select database $Db = @MYSQL_SELECT_DB($DB_DBName, $Connect) or DIE("Couldn't select database:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //execute query $result = @MYSQL_QUERY($sql,$Connect) or DIE("Couldn't execute query:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //if this parameter is included ($w=1), file returned will be in word format ('.doc') //if parameter is not included, file returned will be in excel format ('.xls') IF (ISSET($w) && ($w==1)) { $file_type = "vnd.ms-excel"; $file_ending = "xls"; }ELSE { $file_type = "msword"; $file_ending = "doc"; } //header info for browser: determines file type ('.doc' or '.xls') HEADER("Content-Type: application/$file_type"); HEADER("Content-Disposition: attachment; filename=database_dump.$file_ending"); HEADER("Pragma: no-cache"); HEADER("Expires: 0"); /* Start of Formatting for Word or Excel */ IF (ISSET($w) && ($w==1)) //check for $w again { /* FORMATTING FOR WORD DOCUMENTS ('.doc') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\n"; //new line character WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { //define field names $field_name = MYSQL_FIELD_NAME($result,$j); //will show name of fields $schema_insert .= "$field_name:\t"; IF(!ISSET($row[$j])) { $schema_insert .= "NULL".$sep; } ELSEIF ($row[$j] != "") { $schema_insert .= "$row[$j]".$sep; } ELSE { $schema_insert .= "".$sep; } } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); //end of each mysql row //creates line to separate data from each MySQL table row PRINT "\n----------------------------------------------------\n"; } }ELSE{ /* FORMATTING FOR EXCEL DOCUMENTS ('.xls') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\t"; //tabbed character //start of printing column names as names of MySQL fields FOR ($i = 0; $i < MYSQL_NUM_FIELDS($result); $i++) { ECHO MYSQL_FIELD_NAME($result,$i) . "\t"; } PRINT("\n"); //end of printing column names //start while loop to get data WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { IF(!ISSET($row[$j])) $schema_insert .= "NULL".$sep; ELSEIF ($row[$j] != "") $schema_insert .= "$row[$j]".$sep; ELSE $schema_insert .= "".$sep; } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); //following fix suggested by Josue (thanks, Josue!) //this corrects output in excel when table fields contain \n or \r //these two characters are now replaced with a space $schema_insert = PREG_REPLACE("/\r\n|\n\r|\n|\r/", " ", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); PRINT "\n"; } } ?

    Read the article

  • Android draw using SurfaceView and Thread

    - by Morten Høgseth
    I am trying to draw a ball to my screen using 3 classes. I have read a little about this and I found a code snippet that works using the 3 classes on one page, Playing with graphics in Android I altered the code so that I have a ball that is moving and shifts direction when hitting the wall like the picture below (this is using the code in the link). Now I like to separate the classes into 3 different pages for not making everything so crowded, everything is set up the same way. Here are the 3 classes I have. BallActivity.java Ball.java BallThread.java package com.brick.breaker; import android.app.Activity; import android.os.Bundle; import android.view.Window; import android.view.WindowManager; public class BallActivity extends Activity { private Ball ball; @Override protected void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); requestWindowFeature(Window.FEATURE_NO_TITLE); getWindow().setFlags(WindowManager.LayoutParams.FLAG_FULLSCREEN,WindowManager.LayoutParams.FLAG_FULLSCREEN); ball = new Ball(this); setContentView(ball); } @Override protected void onPause() { // TODO Auto-generated method stub super.onPause(); setContentView(null); ball = null; finish(); } } package com.brick.breaker; import android.content.Context; import android.graphics.Bitmap; import android.graphics.BitmapFactory; import android.graphics.Canvas; import android.view.SurfaceHolder; import android.view.SurfaceView; public class Ball extends SurfaceView implements SurfaceHolder.Callback { private BallThread ballThread = null; private Bitmap bitmap; private float x, y; private float vx, vy; public Ball(Context context) { super(context); // TODO Auto-generated constructor stub bitmap = BitmapFactory.decodeResource(getResources(), R.drawable.ball); x = 50.0f; y = 50.0f; vx = 10.0f; vy = 10.0f; getHolder().addCallback(this); ballThread = new BallThread(getHolder(), this); } protected void onDraw(Canvas canvas) { update(canvas); canvas.drawBitmap(bitmap, x, y, null); } public void update(Canvas canvas) { checkCollisions(canvas); x += vx; y += vy; } public void checkCollisions(Canvas canvas) { if(x - vx < 0) { vx = Math.abs(vx); } else if(x + vx > canvas.getWidth() - getBitmapWidth()) { vx = -Math.abs(vx); } if(y - vy < 0) { vy = Math.abs(vy); } else if(y + vy > canvas.getHeight() - getBitmapHeight()) { vy = -Math.abs(vy); } } public int getBitmapWidth() { if(bitmap != null) { return bitmap.getWidth(); } else { return 0; } } public int getBitmapHeight() { if(bitmap != null) { return bitmap.getHeight(); } else { return 0; } } public void surfaceChanged(SurfaceHolder holder, int format, int width, int height) { // TODO Auto-generated method stub } public void surfaceCreated(SurfaceHolder holder) { // TODO Auto-generated method stub ballThread.setRunnable(true); ballThread.start(); } public void surfaceDestroyed(SurfaceHolder holder) { // TODO Auto-generated method stub boolean retry = true; ballThread.setRunnable(false); while(retry) { try { ballThread.join(); retry = false; } catch(InterruptedException ie) { //Try again and again and again } break; } ballThread = null; } } package com.brick.breaker; import android.graphics.Canvas; import android.view.SurfaceHolder; public class BallThread extends Thread { private SurfaceHolder sh; private Ball ball; private Canvas canvas; private boolean run = false; public BallThread(SurfaceHolder _holder,Ball _ball) { sh = _holder; ball = _ball; } public void setRunnable(boolean _run) { run = _run; } public void run() { while(run) { canvas = null; try { canvas = sh.lockCanvas(null); synchronized(sh) { ball.onDraw(canvas); } } finally { if(canvas != null) { sh.unlockCanvasAndPost(canvas); } } } } public Canvas getCanvas() { if(canvas != null) { return canvas; } else { return null; } } } Here is a picture that shows the outcome of these classes. I've tried to figure this out but since I am pretty new to Android development I thought I could ask for help. Does any one know what is causing the ball to be draw like that? The code is pretty much the same as the one in the link and I have tried to experiment to find a solution but no luck. Thx in advance for any help=)

    Read the article

  • NOOB Memory Problem - EXC_BAD_ACCESS

    - by Michael Bordelon
    I have been banging my head against the wall for a couple days and need some help. I have a feeling that I am doing something really silly here, but I cannot find the issue. This is the controller for a table view. I put the SQL in line to simplify it as part of the troubleshooting of this error. Normally, it would be in an accessor method in a model class. It gets through the SQL read just fine. Finds the two objects, loads them into the todaysWorkout array and then builds the cells for the table view. The table view actually comes up on the scree and then it throws the EXC_BAD_ACCESS. I ran instruments and it shows the following: 0 CFString Malloc 1 00:03.765 0x3946470 176 Foundation -[NSPlaceholderString initWithFormat:locale:arguments:] 1 CFString Autorelease 00:03.765 0x3946470 0 Foundation NSRecordAllocationEvent 2 CFString CFRelease 0 00:03.767 0x3946470 0 Bring It -[WorkoutViewController viewDidLoad] 3 CFString Zombie -1 00:03.917 0x3946470 0 Foundation NSPopAutoreleasePool Here is the source code for the controller. I left it all in there just in case there is something extraneous causing the problem. I sincerely appreciate any help I can get: #import "WorkoutViewController.h" #import "MoveListViewController.h" #import "Profile.h" static sqlite3 *database = nil; @implementation WorkoutViewController @synthesize todaysWorkouts; @synthesize woNoteCell; @synthesize bi; //@synthesize woSwitchCell; - (void)viewDidLoad { [super viewDidLoad]; bi = [[BIUtility alloc] init]; todaysWorkouts = [[NSMutableArray alloc] init]; NSString *query; sqlite3_stmt *statement; //open the database if (sqlite3_open([[BIUtility getDBPath] UTF8String], &database) != SQLITE_OK) { sqlite3_close(database); NSAssert(0, @"Failed to opendatabase"); } query = [NSString stringWithFormat:@"SELECT IWORKOUT.WOINSTANCEID, IWORKOUT.WORKOUTID, CWORKOUTS.WORKOUTNAME FROM CWORKOUTS JOIN IWORKOUT ON IWORKOUT.WORKOUTID = CWORKOUTS.WORKOUTID AND DATE = '%@'", [BIUtility todayDateString]]; if (sqlite3_prepare_v2(database, [query UTF8String], -1, &statement, nil) == SQLITE_OK) { while (sqlite3_step(statement) == SQLITE_ROW) { Workout *wo = [[Workout alloc] init]; wo.woInstanceID = sqlite3_column_int(statement, 0); wo.workoutID = sqlite3_column_int(statement, 1); wo.workoutName = [NSString stringWithUTF8String:(char *)sqlite3_column_text(statement, 2)]; [todaysWorkouts addObject:wo]; [wo release]; } sqlite3_finalize(statement); } if(database) sqlite3_close(database); [query release]; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { //todaysWorkouts = [BIUtility todaysScheduledWorkouts]; static NSString *noteCellIdentifier = @"NoteCellIdentifier"; UITableViewCell *cell; if (indexPath.section < ([todaysWorkouts count])) { cell = [tableView dequeueReusableCellWithIdentifier:@"OtherCell"]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithFrame:CGRectZero reuseIdentifier: @"OtherCell"] autorelease]; cell.accessoryType = UITableViewCellAccessoryNone; } if (indexPath.row == 0) { Workout *wo = [todaysWorkouts objectAtIndex:indexPath.section]; [cell.textLabel setText:wo.workoutName]; } else { [cell.textLabel setText:@"Completed?"]; [cell.textLabel setFont:[UIFont fontWithName:@"Arial" size:15]]; [cell.textLabel setTextColor:[UIColor blueColor]]; } } else { cell = (NoteCell *)[tableView dequeueReusableCellWithIdentifier:noteCellIdentifier]; if (cell == nil) { NSArray *nib = [[NSBundle mainBundle] loadNibNamed:@"NoteCell" owner:self options:nil]; cell = [nib objectAtIndex:0]; } } return cell; //[cell release]; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSUInteger row = [indexPath row]; if (indexPath.section < ([todaysWorkouts count]) && (row == 0)) { MoveListViewController *moveListController = [[MoveListViewController alloc] initWithStyle:UITableViewStylePlain]; moveListController.workoutID = [[todaysWorkouts objectAtIndex:indexPath.section] workoutID]; moveListController.workoutName = [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]; moveListController.woInstanceID = [[todaysWorkouts objectAtIndex:indexPath.section] woInstanceID]; NSLog(@"Workout Selected: %@", [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]); Bring_ItAppDelegate *delegate = [[UIApplication sharedApplication] delegate]; [delegate.workoutNavController pushViewController:moveListController animated:YES]; } else { UITableViewCell *cell = [tableView cellForRowAtIndexPath:indexPath]; if (indexPath.section < ([todaysWorkouts count]) && (row == 1)) { if (cell.accessoryType == UITableViewCellAccessoryNone) { cell.accessoryType = UITableViewCellAccessoryCheckmark; } else { cell.accessoryType = UITableViewCellAccessoryNone; } } } [tableView deselectRowAtIndexPath:indexPath animated:YES]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { NSInteger h = 35; return h; } - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return ([todaysWorkouts count] + 1); //return ([todaysWorkouts count]); } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return 2; } else { return 1; } } - (NSString *)tableView:(UITableView *)tableView titleForHeaderInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return @"Workout"; } else { return @"How Was Your Workout?"; } } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { [super viewDidUnload]; // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [todaysWorkouts release]; [bi release]; [super dealloc]; } @end

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Non recursive way to position a genogram in 2D points for x axis. Descendant are below

    - by Nassign
    I currently was tasked to make a genogram for a family consisting of siblings, parents with aunts and uncles with grandparents and greatgrandparents for only blood relatives. My current algorithm is using recursion. but I am wondering how to do it in non recursive way to make it more efficient. it is programmed in c# using graphics to draw on a bitmap. Current algorithm for calculating x position, the y position is by getting the generation number. public void StartCalculatePosition() { // Search the start node (The only node with targetFlg set to true) Person start = null; foreach (Person p in PersonDic.Values) { if (start == null) start = p; if (p.Targetflg) { start = p; break; } } CalcPositionRecurse(start); // Normalize the position (shift all values to positive value) // Get the minimum value (must be negative) // Then offset the position of all marriage and person with that to make it start from zero float minPosition = float.MaxValue; foreach (Person p in PersonDic.Values) { if (minPosition > p.Position) { minPosition = p.Position; } } if (minPosition < 0) { foreach (Person p in PersonDic.Values) { p.Position -= minPosition; } foreach (Marriage m in MarriageList) { m.ParentsPosition -= minPosition; m.ChildrenPosition -= minPosition; } } } /// <summary> /// Calculate position of genogram using recursion /// </summary> /// <param name="psn"></param> private void CalcPositionRecurse(Person psn) { // End the recursion if (psn.BirthMarriage == null || psn.BirthMarriage.Parents.Count == 0) { psn.Position = 0.0f; if (psn.BirthMarriage != null) { psn.BirthMarriage.ParentsPosition = 0.0f; psn.BirthMarriage.ChildrenPosition = 0.0f; } CalculateSiblingPosition(psn); return; } // Left recurse if (psn.Father != null) { CalcPositionRecurse(psn.Father); } // Right recurse if (psn.Mother != null) { CalcPositionRecurse(psn.Mother); } // Merge Position if (psn.Father != null && psn.Mother != null) { AdjustConflict(psn.Father, psn.Mother); // Position person in center of parent psn.Position = (psn.Father.Position + psn.Mother.Position) / 2; psn.BirthMarriage.ParentsPosition = psn.Position; psn.BirthMarriage.ChildrenPosition = psn.Position; } else { // Single mom or single dad if (psn.Father != null) { psn.Position = psn.Father.Position; psn.BirthMarriage.ParentsPosition = psn.Position; psn.BirthMarriage.ChildrenPosition = psn.Position; } else if (psn.Mother != null) { psn.Position = psn.Mother.Position; psn.BirthMarriage.ParentsPosition = psn.Position; psn.BirthMarriage.ChildrenPosition = psn.Position; } else { // Should not happen, checking in start of function } } // Arrange the siblings base on my position (left younger, right older) CalculateSiblingPosition(psn); } private float GetRightBoundaryAncestor(Person psn) { float rPos = psn.Position; // Get the rightmost position among siblings foreach (Person sibling in psn.Siblings) { if (sibling.Position > rPos) { rPos = sibling.Position; } } if (psn.Father != null) { float rFatherPos = GetRightBoundaryAncestor(psn.Father); if (rFatherPos > rPos) { rPos = rFatherPos; } } if (psn.Mother != null) { float rMotherPos = GetRightBoundaryAncestor(psn.Mother); if (rMotherPos > rPos) { rPos = rMotherPos; } } return rPos; } private float GetLeftBoundaryAncestor(Person psn) { float rPos = psn.Position; // Get the rightmost position among siblings foreach (Person sibling in psn.Siblings) { if (sibling.Position < rPos) { rPos = sibling.Position; } } if (psn.Father != null) { float rFatherPos = GetLeftBoundaryAncestor(psn.Father); if (rFatherPos < rPos) { rPos = rFatherPos; } } if (psn.Mother != null) { float rMotherPos = GetLeftBoundaryAncestor(psn.Mother); if (rMotherPos < rPos) { rPos = rMotherPos; } } return rPos; } /// <summary> /// Check if two parent group has conflict and compensate on the conflict /// </summary> /// <param name="leftGroup"></param> /// <param name="rightGroup"></param> public void AdjustConflict(Person leftGroup, Person rightGroup) { float leftMax = GetRightBoundaryAncestor(leftGroup); leftMax += 0.5f; float rightMin = GetLeftBoundaryAncestor(rightGroup); rightMin -= 0.5f; float diff = leftMax - rightMin; if (diff > 0.0f) { float moveHalf = Math.Abs(diff) / 2; RecurseMoveAncestor(leftGroup, 0 - moveHalf); RecurseMoveAncestor(rightGroup, moveHalf); } } /// <summary> /// Recursively move a person and all his/her ancestor /// </summary> /// <param name="psn"></param> /// <param name="moveUnit"></param> public void RecurseMoveAncestor(Person psn, float moveUnit) { psn.Position += moveUnit; foreach (Person siblings in psn.Siblings) { if (siblings.Id != psn.Id) { siblings.Position += moveUnit; } } if (psn.BirthMarriage != null) { psn.BirthMarriage.ChildrenPosition += moveUnit; psn.BirthMarriage.ParentsPosition += moveUnit; } if (psn.Father != null) { RecurseMoveAncestor(psn.Father, moveUnit); } if (psn.Mother != null) { RecurseMoveAncestor(psn.Mother, moveUnit); } } /// <summary> /// Calculate the position of the siblings /// </summary> /// <param name="psn"></param> /// <param name="anchor"></param> public void CalculateSiblingPosition(Person psn) { if (psn.Siblings.Count == 0) { return; } List<Person> sibling = psn.Siblings; int argidx; for (argidx = 0; argidx < sibling.Count; argidx++) { if (sibling[argidx].Id == psn.Id) { break; } } // Compute position for each brother that is younger that person int idx; for (idx = argidx - 1; idx >= 0; idx--) { sibling[idx].Position = sibling[idx + 1].Position - 1; } for (idx = argidx + 1; idx < sibling.Count; idx++) { sibling[idx].Position = sibling[idx - 1].Position + 1; } }

    Read the article

  • Perl LWP::UserAgent mishandling UTF-8 response

    - by RedGrittyBrick
    When I use LWP::UserAgent to retrieve content encoded in UTF-8 it seems LWP::UserAgent doesn't handle the encoding correctly. Here's the output after setting the Command Prompt window to Unicode by the command chcp 65001 Note that this initially gives the appearance that all is well, but I think it's just the shell reassembling bytes and decoding UTF-8, From the other output you can see that perl itself is not handling wide characters correctly. C:\perl getutf8.pl ====================================================================== HTTP/1.1 200 OK Connection: close Date: Fri, 31 Dec 2010 19:24:04 GMT Accept-Ranges: bytes Server: Apache/2.2.8 (Win32) PHP/5.2.6 Content-Length: 75 Content-Type: application/xml; charset=utf-8 Last-Modified: Fri, 31 Dec 2010 19:20:18 GMT Client-Date: Fri, 31 Dec 2010 19:24:04 GMT Client-Peer: 127.0.0.1:80 Client-Response-Num: 1 <?xml version="1.0" encoding="UTF-8"? <nameBudejovický Budvar</name ====================================================================== response content length is 33 ....v....1....v....2....v....3....v....4 <nameBudejovický Budvar</name . . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . 3c6e616d653e427564c49b6a6f7669636bc3bd204275647661723c2f6e616d653e < n a m e B u d ? ? j o v i c k ? ? B u d v a r < / n a m e Above you can see the payload length is 31 characters but Perl thinks it is 33. For confirmation, in the hex, we can see that the UTF-8 sequences c49b and c3bd are being interpreted as four separate characters and not as two Unicode characters. Here's the code #!perl use strict; use warnings; use LWP::UserAgent; my $ua = LWP::UserAgent-new(); my $response = $ua-get('http://localhost/Bud.xml'); if (! $response-is_success) { die $response-status_line; } print '='x70,"\n",$response-as_string(), '='x70,"\n"; my $r = $response-decoded_content((charset = 'UTF-8')); $/ = "\x0d\x0a"; # seems to be \x0a otherwise! chomp($r); # Remove any xml prologue $r =~ s/^<\?.*\?\x0d\x0a//; print "Response content length is ", length($r), "\n\n"; print "....v....1....v....2....v....3....v....4\n"; print $r,"\n"; print ". . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . \n"; print unpack("H*", $r), "\n"; print join(" ", split("", $r)), "\n"; Note that Bud.xml is UTF-8 encoded without a BOM. How can I persuade LWP::UserAgent to do the right thing? P.S. Ultimately I want to translate the Unicode data into an ASCII encoding, even if it means replacing each non-ASCII character with one question mark or other marker. I have accepted Ysth's "upgrade" answer - because I know it is the right thing to do when possible. However I am going to use a work-around (which may depress Tom further): $r = encode("cp437", decode("utf8", $r));

    Read the article

  • Transaction issue in java with hibernate - latest entries not pulled from database

    - by Gearóid
    Hi, I'm having what seems to be a transactional issue in my application. I'm using Java 1.6 and Hibernate 3.2.5. My application runs a monthly process where it creates billing entries for a every user in the database based on their monthly activity. These billing entries are then used to create Monthly Bill object. The process is: Get users who have activity in the past month Create the relevant billing entries for each user Get the set of billing entries that we've just created Create a Monthly Bill based on these entries Everything works fine until Step 3 above. The Billing Entries are correctly created (I can see them in the database if I add a breakpoint after the Billing Entry creation method), but they are not pulled out of the database. As a result, an incorrect Monthly Bill is generated. If I run the code again (without clearing out the database), new Billing Entries are created and Step 3 pulls out the entries created in the first run (but not the second run). This, to me, is very confusing. My code looks like the following: for (User user : usersWithActivities) { createBillingEntriesForUser(user.getId()); userBillingEntries = getLastMonthsBillingEntriesForUser(user.getId()); createXMLBillForUser(user.getId(), userBillingEntries); } The methods called look like the following: @Transactional public void createBillingEntriesForUser(Long id) { UserManager userManager = ManagerFactory.getUserManager(); User user = userManager.getUser(id); List<AccountEvent> events = getLastMonthsAccountEventsForUser(id); BillingEntry entry = new BillingEntry(); if (null != events) { for (AccountEvent event : events) { if (event.getEventType().equals(EventType.ENABLE)) { Calendar cal = Calendar.getInstance(); Date eventDate = event.getTimestamp(); cal.setTime(eventDate); double startDate = cal.get(Calendar.DATE); double numOfDaysInMonth = cal.getActualMaximum(Calendar.DAY_OF_MONTH); double numberOfDaysInUse = numOfDaysInMonth - startDate; double fractionToCharge = numberOfDaysInUse/numOfDaysInMonth; BigDecimal amount = BigDecimal.valueOf(fractionToCharge * Prices.MONTHLY_COST); amount.scale(); entry.setAmount(amount); entry.setUser(user); entry.setTimestamp(eventDate); userManager.saveOrUpdate(entry); } } } } @Transactional public Collection<BillingEntry> getLastMonthsBillingEntriesForUser(Long id) { if (log.isDebugEnabled()) log.debug("Getting all the billing entries for last month for user with ID " + id); //String queryString = "select billingEntry from BillingEntry as billingEntry where billingEntry>=:firstOfLastMonth and billingEntry.timestamp<:firstOfCurrentMonth and billingEntry.user=:user"; String queryString = "select be from BillingEntry as be join be.user as user where user.id=:id and be.timestamp>=:firstOfLastMonth and be.timestamp<:firstOfCurrentMonth"; //This parameter will be the start of the last month ie. start of billing cycle SearchParameter firstOfLastMonth = new SearchParameter(); firstOfLastMonth.setTemporalType(TemporalType.DATE); //this parameter holds the start of the CURRENT month - ie. end of billing cycle SearchParameter firstOfCurrentMonth = new SearchParameter(); firstOfCurrentMonth.setTemporalType(TemporalType.DATE); Query query = super.entityManager.createQuery(queryString); query.setParameter("firstOfCurrentMonth", getFirstOfCurrentMonth()); query.setParameter("firstOfLastMonth", getFirstOfLastMonth()); query.setParameter("id", id); List<BillingEntry> entries = query.getResultList(); return entries; } public MonthlyBill createXMLBillForUser(Long id, Collection<BillingEntry> billingEntries) { BillingHistoryManager manager = ManagerFactory.getBillingHistoryManager(); UserManager userManager = ManagerFactory.getUserManager(); MonthlyBill mb = new MonthlyBill(); User user = userManager.getUser(id); mb.setUser(user); mb.setTimestamp(new Date()); Set<BillingEntry> entries = new HashSet<BillingEntry>(); entries.addAll(billingEntries); String xml = createXmlForMonthlyBill(user, entries); mb.setXmlBill(xml); mb.setBillingEntries(entries); MonthlyBill bill = (MonthlyBill) manager.saveOrUpdate(mb); return bill; } Help with this issue would be greatly appreciated as its been wracking my brain for weeks now! Thanks in advance, Gearoid.

    Read the article

  • if isset PHP not working?

    - by Ellie
    Okay, Im trying to set a captcha up, However with this code in, it breaks. if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) When i do it with out it, the page works, but the captcha is letting incorrect submits through. Parse error: syntax error, unexpected '"', expecting T_STRING or T_VARIABLE or T_NUM_STRING in /hermes/waloraweb085/b2027/moo.lutarinet/jointest.php on line 71 <?php $pagetitle = "Home"; $checkrank = 0; include ($_SERVER['DOCUMENT_ROOT'].'/header.inc.php'); ECHO <<<END <br><br> <b><center><i><u>DO NOT</u> USE YOUR NEOPETS PASSWORD OR PIN NUMBER!!!</b></i></center> <p> ?> <?php session_start() ?> <center><P><FORM ACTION="join.pro.php" enctype="multipart/form-data" METHOD=POST> <table width="393" height="188" border="0" cellpadding="0" cellspacing="0"> <td width="150">Username</td> <td width="243"><input type=text name="name" value="" size=32 maxlength=15></td> </tr> <tr> <td>Password</td> <td><input type=password name="pass1" VALUE="" maxlength=15></td> </tr> <tr> <td>Confirm Password</td> <td><input type=password name="pass2" VALUE="" size=32 maxlength=15></td> </tr> <tr> <td>Security Code (4 Diget Number)</td> <td><input type=password name="security" VALUE="" size=32 maxlength=4></td> </tr> <tr> <td>Email Address</td> <td><INPUT TYPE=text NAME="email" VALUE="" SIZE=32 maxlength=100></td> </tr> <tr> <td height="41" colspan="2" valign="middle"><p><p><center> By registering an account here you agree to all of our <A HREF="$baseurl/tos.php">Terms and Conditions</A>. You can also view our <A HREF="$baseurl/privacy.php">Privacy Policy</A>. </center></p></td> </tr> <tr><td align="center">CAPTCHA:<br> (antispam code, 3 black symbols)<br> <table><tr><td><img src="captcha.php" alt="captcha image"></td><td><input type="text" name="captcha" size="3" maxlength="3"></td></tr></table> </td></tr> <td height="27" colspan="2" valign="middle"> <center><input type=submit name=Submit value="Register"></center> </td> </table> </form> <?php if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) { //CAPTHCA is valid; proceed the message: save to database, send by e-mail ... echo 'CAPTHCA is valid; proceed the message'; } else { echo 'CAPTHCA is not valid; ignore submission'; } ?> <?php END; include ($_SERVER['DOCUMENT_ROOT'].'/footer.inc.php'); ?> captcha.php <?php session_start(); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: " . gmdate("D, d M Y H:i:s") . " GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); function _generateRandom($length=6) { $_rand_src = array( array(48,57) //digits , array(97,122) //lowercase chars // , array(65,90) //uppercase chars ); srand ((double) microtime() * 1000000); $random_string = ""; for($i=0;$i<$length;$i++){ $i1=rand(0,sizeof($_rand_src)-1); $random_string .= chr(rand($_rand_src[$i1][0],$_rand_src[$i1][1])); } return $random_string; } $im = @imagecreatefromjpeg("http://sketchedneo.com/images/sitedesigns/captcha.jpg"); $rand = _generateRandom(3); $_SESSION['captcha'] = $rand; ImageString($im, 5, 2, 2, $rand[0]." ".$rand[1]." ".$rand[2]." ", ImageColorAllocate ($im, 0, 0, 0)); $rand = _generateRandom(3); ImageString($im, 5, 2, 2, " ".$rand[0]." ".$rand[1]." ".$rand[2], ImageColorAllocate ($im, 255, 0, 0)); Header ('Content-type: image/jpeg'); imagejpeg($im,NULL,100); ImageDestroy($im); ?> Help please anyone? Line 71: if(isset($_POST["captcha"])) Line 72: if($_SESSION["captcha"]==$_POST["captcha"])

    Read the article

  • Using C# to detect whether a filename character is considered international

    - by Morten Mertner
    I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

    Read the article

  • Hibernate without primary keys generated by db?

    - by Michael Jones
    I'm building a data warehouse and want to use InfiniDB as the storage engine. However, it doesn't allow primary keys or foreign key constraints (or any constraints for that matter). Hibernate complains "The database returned no natively generated identity value" when I perform an insert. Each table is relational, and contains a unique integer column that was previously used as the primary key - I want to keep that, but just not have the constraint in the db that the column is the primary key. I'm assuming the problem is that Hibernate expects the db to return a generated key. Is it possible to override this behaviour so I can set the primary key field's value myself and keep Hibernate happy? -- edit -- Two of the mappings are as follows: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visitor" table="visitor" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <property name="firstSeen" type="timestamp"> <column name="first_seen" length="19" /> </property> <property name="lastSeen" type="timestamp"> <column name="last_seen" length="19" /> </property> <property name="sessionId" type="string"> <column name="session_id" length="26" unique="true" /> </property> <property name="userId" type="java.lang.Long"> <column name="user_id" /> </property> <set name="visits" inverse="true"> <key> <column name="visitor_id" /> </key> <one-to-many class="com.example.project.Visit" /> </set> </class> </hibernate-mapping> and: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visit" table="visit" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <many-to-one name="visitor" class="com.example.project.Visitor" fetch="join" cascade="all"> <column name="visitor_id" /> </many-to-one> <property name="visitId" type="string"> <column name="visit_id" length="20" unique="true" /> </property> <property name="startTime" type="timestamp"> <column name="start_time" length="19" /> </property> <property name="endTime" type="timestamp"> <column name="end_time" length="19" /> </property> <property name="userAgent" type="string"> <column name="user_agent" length="65535" /> </property> <set name="pageViews" inverse="true"> <key> <column name="visit_id" /> </key> <one-to-many class="com.example.project.PageView" /> </set> </class> </hibernate-mapping>

    Read the article

  • incrementing in php

    - by Michael Stevens
    I have a function that works on other pages but on this particular page its not working 100% the piece of code that is failing to work is: $query = "SELECT * FROM rank_punting JOIN rank_player ON rank_player.full_name=rank_punting.name WHERE active='1' AND class='$class' ORDER BY ABS(`rank_punting`.`rank_final`) ASC"; $rank = 0; $lastpct = 0; $db->setQuery($query); $result = $db->query(); if(mysql_num_rows($result) > 0) { while($row = mysql_fetch_array($result, MYSQL_ASSOC)) { if ($row['rank_final'] > $lastpct) { $rank++; $lastpct = $row['rank_final']; } $name = $row['name']; $s1= $row['s1']; $s2= $row['s2']; $s3= $row['s3']; $s4= $row['s4']; $s5= $row['s5']; $s6= $row['s6']; $s7= $row['s7']; $s8= $row['s8']; $s9= $row['s9']; $c1= $row['c1']; $c2= $row['c2']; $c3= $row['c3']; $c4= $row['c4']; $c5= $row['c5']; $c6= $row['c6']; $v1= $row['v1']; $v2= $row['v2']; $comp= $row['comp_rank_final']; $season= $row['season_rank_final']; $final=$row['rank_final']; $link = "website_url"; $link2 = "<a href=\"http://{$link}\" target='_blank'>{$name}<br>Profile Page</a>"; if ($link = ''){$link2 = "<a href='index.php?option=com_ranking&view=playerprofile&player={$name}' >{$name}<br>Profile Page</a>";} echo '<tr>'; echo " <th scope'row'>{$link2} {$lastpct} </th>"; echo "<td>"; echo 'DEBUG: '; echo $row['rank_final']; echo $lastpct;echo "{$rank}</td>"; echo "<td> Competition</td>"; echo "<td> {$comp}</td>"; echo "<td> {$c1}</td>"; echo "<td> {$c2}</td>"; echo "<td> {$c3}</td>"; echo "<td> {$c4}</td>"; echo "<td> {$c5}</td>"; echo "<td> {$c6}</td>"; echo "<td> {$c7}</td>"; echo "<td> {$c8}</td>"; echo "<td> {$v2}</td>"; echo "</tr>"; echo '<tr>'; echo "<th scope'row'> </th>"; echo "<td> </td>"; echo "<td> Game Film</td>"; echo "<td> {$season}</td>"; echo "<td> {$s1}</td>"; echo "<td> {$s2}</td>"; echo "<td> {$s3}</td>"; echo "<td> {$s4}</td>"; echo "<td> {$s5}</td>"; echo "<td> {$s7}</td>"; echo "<td> {$s8}</td>"; echo "<td> {$s6}</td>"; echo "<td> {$v1}</td>"; echo "</tr>"; } } //---------------- echo '</tbody> </table>'; }

    Read the article

  • How do you overide a class that is called by another class with parent::method

    - by dan.codes
    I am trying to extend Mage_Catalog_Block_Product_View I have it setup in my local directory as its own module and everything works fine, I wasn't getting the results that I wanted. I then saw that another class extended that class as well. The method I am trying to override is the protected function _prepareLayout() This is the function class Mage_Review_Block_Product_View extends Mage_Catalog_Block_Product_View protected function _prepareLayout() { $this-&gt;getLayout()-&gt;createBlock('catalog/breadcrumbs'); $headBlock = $this-&gt;getLayout()-&gt;getBlock('head'); if ($headBlock) { $title = $this-&gt;getProduct()-&gt;getMetaTitle(); if ($title) { $headBlock-&gt;setTitle($title); } $keyword = $this-&gt;getProduct()-&gt;getMetaKeyword(); $currentCategory = Mage::registry('current_category'); if ($keyword) { $headBlock-&gt;setKeywords($keyword); } elseif($currentCategory) { $headBlock-&gt;setKeywords($this-&gt;getProduct()-&gt;getName()); } $description = $this-&gt;getProduct()-&gt;getMetaDescription(); if ($description) { $headBlock-&gt;setDescription( ($description) ); } else { $headBlock-&gt;setDescription( $this-&gt;getProduct()-&gt;getDescription() ); } } return parent::_prepareLayout(); } I am trying to modify it just a bit with the following, keep in mind I know there is a title prefix and suffix but I needed it only for the product page and also I needed to add text to the description. class MyCompany_Catalog_Block_Product_View extends Mage_Catalog_Block_Product_View protected function _prepareLayout() { $storeId = Mage::app()-&gt;getStore()-&gt;getId(); $this-&gt;getLayout()-&gt;createBlock('catalog/breadcrumbs'); $headBlock = $this-&gt;getLayout()-&gt;getBlock('head'); if ($headBlock) { $title = $this-&gt;getProduct()-&gt;getMetaTitle(); if ($title) { if($storeId == 2){ $title = "Pool Supplies Fast - " .$title; $headBlock-&gt;setTitle($title); } $headBlock-&gt;setTitle($title); }else{ $path = Mage::helper('catalog')-&gt;getBreadcrumbPath(); foreach ($path as $name =&gt; $breadcrumb) { $title[] = $breadcrumb['label']; } $newTitle = "Pool Supplies Fast - " . join($this-&gt;getTitleSeparator(), array_reverse($title)); $headBlock-&gt;setTitle($newTitle); } $keyword = $this-&gt;getProduct()-&gt;getMetaKeyword(); $currentCategory = Mage::registry('current_category'); if ($keyword) { $headBlock-&gt;setKeywords($keyword); } elseif($currentCategory) { $headBlock-&gt;setKeywords($this-&gt;getProduct()-&gt;getName()); } $description = $this-&gt;getProduct()-&gt;getMetaDescription(); if ($description) { if($storeId == 2){ $description = "Pool Supplies Fast - ". $this-&gt;getProduct()-&gt;getName() . " - " . $description; $headBlock-&gt;setDescription( ($description) ); }else{ $headBlock-&gt;setDescription( ($description) ); } } else { if($storeId == 2){ $description = "Pool Supplies Fast: ". $this-&gt;getProduct()-&gt;getName() . " - " . $this-&gt;getProduct()-&gt;getDescription(); $headBlock-&gt;setDescription( ($description) ); }else{ $headBlock-&gt;setDescription( $this-&gt;getProduct()-&gt;getDescription() ); } } } return Mage_Catalog_Block_Product_Abstract::_prepareLayout(); } This executs fine but then I notice that the following class Mage_Review_Block_Product_View_List extends which extends Mage_Review_Block_Product_View and that extends Mage_Catalog_Block_Product_View as well. Inside this class they call the _prepareLayout as well and call the parent with parent::_prepareLayout() class Mage_Review_Block_Product_View_List extends Mage_Review_Block_Product_View protected function _prepareLayout() { parent::_prepareLayout(); if ($toolbar = $this-&gt;getLayout()-&gt;getBlock('product_review_list.toolbar')) { $toolbar-&gt;setCollection($this-&gt;getReviewsCollection()); $this-&gt;setChild('toolbar', $toolbar); } return $this; } So obviously this just calls the same class I am extending and runs the function I am overiding but it doesn't get to my class because it is not in my class hierarchy and since it gets called after my class all the stuff in the parent class override what I have set. I'm not sure about the best way to extend this type of class and method, there has to be a good way to do this, I keep finding I am running into issues when trying to overide these prepare methods that are derived from the abstract classes, there seems to be so many classes overriding them and calling parent::method. What is the best way to override these functions?

    Read the article

  • files get uploaded just before they get cancelled

    - by user1763986
    Got a little situation here where I am trying to cancel a file's upload. What I have done is stated that if the user clicks on the "Cancel" button, then it will simply remove the iframe so that it does not go to the page where it uploads the files into the server and inserts data into the database. Now this works fine if the user clicks on the "Cancel" button in quickish time the problem I have realised though is that if the user clicks on the "Cancel" button very late, it sometimes doesn't remove the iframe in time meaning that the file has just been uploaded just before the user has clicked on the "Cancel" button. So my question is that is there a way that if the file does somehow get uploaded before the user clicks on the "Cancel" button, that it deletes the data in the database and removes the file from the server? Below is the image upload form: <form action="imageupload.php" method="post" enctype="multipart/form-data" target="upload_target_image" onsubmit="return imageClickHandler(this);" class="imageuploadform" > <p class="imagef1_upload_process" align="center"> Loading...<br/> <img src="Images/loader.gif" /> </p> <p class="imagef1_upload_form" align="center"> <br/> <span class="imagemsg"></span> <label>Image File: <input name="fileImage" type="file" class="fileImage" /></label><br/> <br/> <label class="imagelbl"><input type="submit" name="submitImageBtn" class="sbtnimage" value="Upload" /></label> </p> <p class="imagef1_cancel" align="center"> <input type="reset" name="imageCancel" class="imageCancel" value="Cancel" /> </p> <iframe class="upload_target_image" name="upload_target_image" src="#" style="width:0px;height:0px;border:0px;solid;#fff;"></iframe> </form> Below is the jquery function which controls the "Cancel" button: $(imageuploadform).find(".imageCancel").on("click", function(event) { $('.upload_target_image').get(0).contentwindow $("iframe[name='upload_target_image']").attr("src", "javascript:'<html></html>'"); return stopImageUpload(2); }); Below is the php code where it uploads the files and inserts the data into the database. The form above posts to this php page "imageupload.php": <body> <?php include('connect.php'); session_start(); $result = 0; //uploads file move_uploaded_file($_FILES["fileImage"]["tmp_name"], "ImageFiles/" . $_FILES["fileImage"]["name"]); $result = 1; //set up the INSERT SQL query command to insert the name of the image file into the "Image" Table $imagesql = "INSERT INTO Image (ImageFile) VALUES (?)"; //prepare the above SQL statement if (!$insert = $mysqli->prepare($imagesql)) { // Handle errors with prepare operation here } //bind the parameters (these are the values that will be inserted) $insert->bind_param("s",$img); //Assign the variable of the name of the file uploaded $img = 'ImageFiles/'.$_FILES['fileImage']['name']; //execute INSERT query $insert->execute(); if ($insert->errno) { // Handle query error here } //close INSERT query $insert->close(); //Retrieve the ImageId of the last uploded file $lastID = $mysqli->insert_id; //Insert into Image_Question Table (be using last retrieved Image id in order to do this) $imagequestionsql = "INSERT INTO Image_Question (ImageId, SessionId, QuestionId) VALUES (?, ?, ?)"; //prepare the above SQL statement if (!$insertimagequestion = $mysqli->prepare($imagequestionsql)) { // Handle errors with prepare operation here echo "Prepare statement err imagequestion"; } //Retrieve the question number $qnum = (int)$_POST['numimage']; //bind the parameters (these are the values that will be inserted) $insertimagequestion->bind_param("isi",$lastID, 'Exam', $qnum); //execute INSERT query $insertimagequestion->execute(); if ($insertimagequestion->errno) { // Handle query error here } //close INSERT query $insertimagequestion->close(); ?> <!--Javascript which will output the message depending on the status of the upload (successful, failed or cancelled)--> <script> window.top.stopImageUpload(<?php echo $result; ?>, '<?php echo $_FILES['fileImage']['name'] ?>'); </script> </body> UPDATE: Below is the php code "cancelimage.php" where I want to delete the cancelled file from the server and delete the record from the database. It is set up but not finished, can somebody finish it off so I can retrieve the name of the file and it's id using $_SESSION? <?php // connect to the database include('connect.php'); /* check connection */ if (mysqli_connect_errno()) { printf("Connect failed: %s\n", mysqli_connect_error()); die(); } //remove file from server unlink("ImageFiles/...."); //need to retrieve file name here where the ... line is //DELETE query statement where it will delete cancelled file from both Image and Image Question Table $imagedeletesql = " DELETE img, img_q FROM Image AS img LEFT JOIN Image_Question AS img_q ON img_q.ImageId = img.ImageId WHERE img.ImageFile = ?"; //prepare delete query if (!$delete = $mysqli->prepare($imagedeletesql)) { // Handle errors with prepare operation here } //Dont pass data directly to bind_param store it in a variable $delete->bind_param("s",$img); //execute DELETE query $delete->execute(); if ($delete->errno) { // Handle query error here } //close query $delete->close(); ?> Can you please provide an sample code in your answer to make it easier for me. Thank you

    Read the article

  • Need help in setting lighttpd on Ubuntu 9.10

    - by hap497
    Hi, I am trying to run lighttpd on Ubuntu 9.10. I get the conf file from the doc directory of lighttpd source. $ sudo ./lighttpd -f lighttpd.conf $ ps -ef | grep lighttpd root 2094 1 0 19:40 ? 00:00:00 ./lighttpd -f lighttpd.conf This is my lighttpd.conf: $ more lighttpd.conf # lighttpd configuration file # # use it as a base for lighttpd 1.0.0 and above # # $Id: lighttpd.conf,v 1.7 2004/11/03 22:26:05 weigon Exp $ ############ Options you really have to take care of #################### ## modules to load # at least mod_access and mod_accesslog should be loaded # all other module should only be loaded if really neccesary # - saves some time # - saves memory server.modules = ( # "mod_rewrite", # "mod_redirect", # "mod_alias", "mod_access", # "mod_trigger_b4_dl", # "mod_auth", # "mod_status", # "mod_setenv", # "mod_fastcgi", # "mod_proxy", # "mod_simple_vhost", # "mod_evhost", # "mod_userdir", # "mod_cgi", # "mod_compress", # "mod_ssi", # "mod_usertrack", # "mod_expire", # "mod_secdownload", # "mod_rrdtool", "mod_accesslog" ) ## A static document-root. For virtual hosting take a look at the ## mod_simple_vhost module. server.document-root = "/srv/www/htdocs/" ## where to send error-messages to server.errorlog = "/var/log/lighttpd/error.log" # files to check for if .../ is requested index-file.names = ( "index.php", "index.html", "index.htm", "default.htm" ) ## set the event-handler (read the performance section in the manual) # server.event-handler = "freebsd-kqueue" # needed on OS X # mimetype mapping mimetype.assign = ( ".pdf" => "application/pdf", ".sig" => "application/pgp-signature", ".spl" => "application/futuresplash", ".class" => "application/octet-stream", ".ps" => "application/postscript", ".torrent" => "application/x-bittorrent", ".dvi" => "application/x-dvi", ".gz" => "application/x-gzip", ".pac" => "application/x-ns-proxy-autoconfig", ".swf" => "application/x-shockwave-flash", ".tar.gz" => "application/x-tgz", ".tgz" => "application/x-tgz", ".tar" => "application/x-tar", ".zip" => "application/zip", ".mp3" => "audio/mpeg", ".m3u" => "audio/x-mpegurl", ".wma" => "audio/x-ms-wma", ".wax" => "audio/x-ms-wax", ".ogg" => "application/ogg", ".wav" => "audio/x-wav", ".gif" => "image/gif", ".jar" => "application/x-java-archive", ".jpg" => "image/jpeg", ".jpeg" => "image/jpeg", ".png" => "image/png", ".xbm" => "image/x-xbitmap", ".xpm" => "image/x-xpixmap", ".xwd" => "image/x-xwindowdump", ".css" => "text/css", ".html" => "text/html", ".htm" => "text/html", ".js" => "text/javascript", ".asc" => "text/plain", ".c" => "text/plain", ".cpp" => "text/plain", ".log" => "text/plain", ".conf" => "text/plain", ".text" => "text/plain", ".txt" => "text/plain", ".dtd" => "text/xml", ".xml" => "text/xml", ".mpeg" => "video/mpeg", ".mpg" => "video/mpeg", ".mov" => "video/quicktime", ".qt" => "video/quicktime", ".avi" => "video/x-msvideo", ".asf" => "video/x-ms-asf", ".asx" => "video/x-ms-asf", ".wmv" => "video/x-ms-wmv", ".bz2" => "application/x-bzip", ".tbz" => "application/x-bzip-compressed-tar", ".tar.bz2" => "application/x-bzip-compressed-tar", # default mime type "" => "application/octet-stream", ) # Use the "Content-Type" extended attribute to obtain mime type if possible #mimetype.use-xattr = "enable" ## send a different Server: header ## be nice and keep it at lighttpd # server.tag = "lighttpd" #### accesslog module accesslog.filename = "/var/log/lighttpd/access.log" ## deny access the file-extensions # # ~ is for backupfiles from vi, emacs, joe, ... # .inc is often used for code includes which should in general not be part # of the document-root url.access-deny = ( "~", ".inc" ) $HTTP["url"] =~ "\.pdf$" { server.range-requests = "disable" } ## # which extensions should not be handle via static-file transfer # # .php, .pl, .fcgi are most often handled by mod_fastcgi or mod_cgi static-file.exclude-extensions = ( ".php", ".pl", ".fcgi" ) ######### Options that are good to be but not neccesary to be changed ####### ## bind to port (default: 80) #server.port = 81 ## bind to localhost (default: all interfaces) #server.bind = "127.0.0.1" ## error-handler for status 404 #server.error-handler-404 = "/error-handler.html" #server.error-handler-404 = "/error-handler.php" ## to help the rc.scripts #server.pid-file = "/var/run/lighttpd.pid" ###### virtual hosts ## ## If you want name-based virtual hosting add the next three settings and load ## mod_simple_vhost ## ## document-root = ## virtual-server-root + virtual-server-default-host + virtual-server-docroot ## or ## virtual-server-root + http-host + virtual-server-docroot ## #simple-vhost.server-root = "/srv/www/vhosts/" #simple-vhost.default-host = "www.example.org" #simple-vhost.document-root = "/htdocs/" ## ## Format: <errorfile-prefix><status-code>.html ## -> ..../status-404.html for 'File not found' #server.errorfile-prefix = "/usr/share/lighttpd/errors/status-" #server.errorfile-prefix = "/srv/www/errors/status-" ## virtual directory listings #dir-listing.activate = "enable" ## select encoding for directory listings #dir-listing.encoding = "utf-8" ## enable debugging #debug.log-request-header = "enable" #debug.log-response-header = "enable" #debug.log-request-handling = "enable" #debug.log-file-not-found = "enable" ### only root can use these options # # chroot() to directory (default: no chroot() ) #server.chroot = "/" ## change uid to <uid> (default: don't care) #server.username = "wwwrun" ## change uid to <uid> (default: don't care) #server.groupname = "wwwrun" #### compress module #compress.cache-dir = "/var/cache/lighttpd/compress/" #compress.filetype = ("text/plain", "text/html") #### proxy module ## read proxy.txt for more info #proxy.server = ( ".php" => # ( "localhost" => # ( # "host" => "192.168.0.101", # "port" => 80 # ) # ) # ) #### fastcgi module ## read fastcgi.txt for more info ## for PHP don't forget to set cgi.fix_pathinfo = 1 in the php.ini #fastcgi.server = ( ".php" => # ( "localhost" => # ( # "socket" => "/var/run/lighttpd/php-fastcgi.s ocket", # "bin-path" => "/usr/local/bin/php-cgi" # ) # ) # ) #### CGI module #cgi.assign = ( ".pl" => "/usr/bin/perl", # ".cgi" => "/usr/bin/perl" ) # #### SSL engine #ssl.engine = "enable" #ssl.pemfile = "/etc/ssl/private/lighttpd.pem" #### status module #status.status-url = "/server-status" #status.config-url = "/server-config" #### auth module ## read authentication.txt for more info #auth.backend = "plain" #auth.backend.plain.userfile = "lighttpd.user" #auth.backend.plain.groupfile = "lighttpd.group" #auth.backend.ldap.hostname = "localhost" #auth.backend.ldap.base-dn = "dc=my-domain,dc=com" #auth.backend.ldap.filter = "(uid=$)" #auth.require = ( "/server-status" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "user=jan" # ), # "/server-config" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "valid-user" # ) # ) #### url handling modules (rewrite, redirect, access) #url.rewrite = ( "^/$" => "/server-status" ) #url.redirect = ( "^/wishlist/(.+)" => "http://www.123.org/$1" ) #### both rewrite/redirect support back reference to regex conditional using %n #$HTTP["host"] =~ "^www\.(.*)" { # url.redirect = ( "^/(.*)" => "http://%1/$1" ) #} # # define a pattern for the host url finding # %% => % sign # %0 => domain name + tld # %1 => tld # %2 => domain name without tld # %3 => subdomain 1 name # %4 => subdomain 2 name # #evhost.path-pattern = "/srv/www/vhosts/%3/htdocs/" #### expire module #expire.url = ( "/buggy/" => "access 2 hours", "/asdhas/" => "ac cess plus 1 seconds 2 minutes") #### ssi #ssi.extension = ( ".shtml" ) #### rrdtool #rrdtool.binary = "/usr/bin/rrdtool" #rrdtool.db-name = "/var/lib/lighttpd/lighttpd.rrd" #### setenv #setenv.add-request-header = ( "TRAV_ENV" => "mysql://user@host/db" ) #setenv.add-response-header = ( "X-Secret-Message" => "42" ) ## for mod_trigger_b4_dl # trigger-before-download.gdbm-filename = "/var/lib/lighttpd/trigger.db" # trigger-before-download.memcache-hosts = ( "127.0.0.1:11211" ) # trigger-before-download.trigger-url = "^/trigger/" # trigger-before-download.download-url = "^/download/" # trigger-before-download.deny-url = "http://127.0.0.1/index.html" # trigger-before-download.trigger-timeout = 10 #### variable usage: ## variable name without "." is auto prefixed by "var." and becomes "var.bar" #bar = 1 #var.mystring = "foo" ## integer add #bar += 1 ## string concat, with integer cast as string, result: "www.foo1.com" #server.name = "www." + mystring + var.bar + ".com" ## array merge #index-file.names = (foo + ".php") + index-file.names #index-file.names += (foo + ".php") #### include #include /etc/lighttpd/lighttpd-inc.conf ## same as above if you run: "lighttpd -f /etc/lighttpd/lighttpd.conf" #include "lighttpd-inc.conf" #### include_shell #include_shell "echo var.a=1" ## the above is same as: #var.a=1 When I go to browser and hit 'http://127.0.0.1', I get link not found. Any idea?

    Read the article

  • How to configure fastcgi to work with ligttpd in ubuntu

    - by michael
    I am able to run lighttpd on ubuntu 9.10. But when i tried to setup fastcgi with lighttpd by putting this in the ligttpd.conf file: #### fastcgi module fastcgi.server = ( "/fastcgi_scripts/" => (( "host" => "127.0.0.1", "port" => "9098", "check-local" => "disable", "bin-path" => "/usr/local/bin/cgi-fcgi", "docroot" => "/" # remote server may use # it's own docroot )) ) This is what I get in the error.log in ligttpd: 2010-03-07 21:00:11: (log.c.166) server started 2010-03-07 21:00:11: (mod_fastcgi.c.1104) the fastcgi-backend /usr/local/bin/cgi-fcgi failed to start: 2010-03-07 21:00:11: (mod_fastcgi.c.1108) child exited with status 1 /usr/local/bin/cgi-fcgi 2010-03-07 21:00:11: (mod_fastcgi.c.1111) If you're trying to run your app as a FastCGI backend, make sure you're using the FastCGI-enabled version. If this is PHP on Gentoo, add 'fastcgi' to the USE flags. 2010-03-07 21:00:11: (mod_fastcgi.c.1399) [ERROR]: spawning fcgi failed. 2010-03-07 21:00:11: (server.c.931) Configuration of plugins failed. Going down. I do have cgi-fcgi in /usr/local/bin: $ which cgi-fcgi /usr/local/bin/cgi-fcgi '/usr/local/bin/cgi-fcgi' is the executable after I download and compile fast-cgi. Here is my lighttpd conf file: $ more lighttpd.conf # lighttpd configuration file # # use it as a base for lighttpd 1.0.0 and above # # $Id: lighttpd.conf,v 1.7 2004/11/03 22:26:05 weigon Exp $ ############ Options you really have to take care of #################### ## modules to load # at least mod_access and mod_accesslog should be loaded # all other module should only be loaded if really neccesary # - saves some time # - saves memory server.modules = ( # "mod_rewrite", # "mod_redirect", # "mod_alias", "mod_access", # "mod_trigger_b4_dl", # "mod_auth", # "mod_status", # "mod_setenv", "mod_fastcgi", # "mod_proxy", # "mod_simple_vhost", # "mod_evhost", # "mod_userdir", # "mod_cgi", # "mod_compress", # "mod_ssi", # "mod_usertrack", # "mod_expire", # "mod_secdownload", # "mod_rrdtool", "mod_accesslog" ) ## A static document-root. For virtual hosting take a look at the ## mod_simple_vhost module. server.document-root = "/srv/www/htdocs/" ## where to send error-messages to server.errorlog = "/var/log/lighttpd/error.log" # files to check for if .../ is requested index-file.names = ( "index.php", "index.html", "index.htm", "default.htm" ) ## set the event-handler (read the performance section in the manual) # server.event-handler = "freebsd-kqueue" # needed on OS X # mimetype mapping mimetype.assign = ( ".pdf" => "application/pdf", ".sig" => "application/pgp-signature", ".spl" => "application/futuresplash", ".class" => "application/octet-stream", ".ps" => "application/postscript", ".torrent" => "application/x-bittorrent", ".dvi" => "application/x-dvi", ".gz" => "application/x-gzip", ".pac" => "application/x-ns-proxy-autoconfig", ".swf" => "application/x-shockwave-flash", ".tar.gz" => "application/x-tgz", ".tgz" => "application/x-tgz", ".tar" => "application/x-tar", ".zip" => "application/zip", ".mp3" => "audio/mpeg", ".m3u" => "audio/x-mpegurl", ".wma" => "audio/x-ms-wma", ".wax" => "audio/x-ms-wax", ".ogg" => "application/ogg", ".wav" => "audio/x-wav", ".gif" => "image/gif", ".jar" => "application/x-java-archive", ".jpg" => "image/jpeg", ".jpeg" => "image/jpeg", ".png" => "image/png", ".xbm" => "image/x-xbitmap", ".xpm" => "image/x-xpixmap", ".xwd" => "image/x-xwindowdump", ".css" => "text/css", ".html" => "text/html", ".htm" => "text/html", ".js" => "text/javascript", ".asc" => "text/plain", ".c" => "text/plain", ".cpp" => "text/plain", ".log" => "text/plain", ".conf" => "text/plain", ".text" => "text/plain", ".txt" => "text/plain", ".dtd" => "text/xml", ".xml" => "text/xml", ".mpeg" => "video/mpeg", ".mpg" => "video/mpeg", ".mov" => "video/quicktime", ".qt" => "video/quicktime", ".avi" => "video/x-msvideo", ".asf" => "video/x-ms-asf", ".asx" => "video/x-ms-asf", ".wmv" => "video/x-ms-wmv", ".bz2" => "application/x-bzip", ".tbz" => "application/x-bzip-compressed-tar", ".tar.bz2" => "application/x-bzip-compressed-tar", # default mime type "" => "application/octet-stream", ) # Use the "Content-Type" extended attribute to obtain mime type if possible #mimetype.use-xattr = "enable" ## send a different Server: header ## be nice and keep it at lighttpd # server.tag = "lighttpd" #### accesslog module accesslog.filename = "/var/log/lighttpd/access.log" ## deny access the file-extensions # # ~ is for backupfiles from vi, emacs, joe, ... # .inc is often used for code includes which should in general not be part # of the document-root url.access-deny = ( "~", ".inc" ) $HTTP["url"] =~ "\.pdf$" { server.range-requests = "disable" } ## # which extensions should not be handle via static-file transfer # # .php, .pl, .fcgi are most often handled by mod_fastcgi or mod_cgi static-file.exclude-extensions = ( ".php", ".pl", ".fcgi" ) ######### Options that are good to be but not neccesary to be changed ####### ## bind to port (default: 80) server.port = 9090 ## bind to localhost (default: all interfaces) server.bind = "127.0.0.1" ## error-handler for status 404 #server.error-handler-404 = "/error-handler.html" #server.error-handler-404 = "/error-handler.php" ## to help the rc.scripts #server.pid-file = "/var/run/lighttpd.pid" ###### virtual hosts ## ## If you want name-based virtual hosting add the next three settings and load ## mod_simple_vhost ## ## document-root = ## virtual-server-root + virtual-server-default-host + virtual-server-docroot ## or ## virtual-server-root + http-host + virtual-server-docroot ## #simple-vhost.server-root = "/srv/www/vhosts/" #simple-vhost.default-host = "www.example.org" #simple-vhost.document-root = "/htdocs/" ## ## Format: <errorfile-prefix><status-code>.html ## -> ..../status-404.html for 'File not found' #server.errorfile-prefix = "/usr/share/lighttpd/errors/status-" #server.errorfile-prefix = "/srv/www/errors/status-" ## virtual directory listings #dir-listing.activate = "enable" ## select encoding for directory listings #dir-listing.encoding = "utf-8" ## enable debugging #debug.log-request-header = "enable" #debug.log-response-header = "enable" #debug.log-request-handling = "enable" #debug.log-file-not-found = "enable" ### only root can use these options # # chroot() to directory (default: no chroot() ) #server.chroot = "/" ## change uid to <uid> (default: don't care) #server.username = "wwwrun" ## change uid to <uid> (default: don't care) #server.groupname = "wwwrun" #### compress module #compress.cache-dir = "/var/cache/lighttpd/compress/" #compress.filetype = ("text/plain", "text/html") #### proxy module ## read proxy.txt for more info #proxy.server = ( ".php" => # ( "localhost" => # ( # "host" => "192.168.0.101", # "port" => 80 # ) # ) # ) #### fastcgi module fastcgi.server = ( "/fastcgi_scripts/" => (( "host" => "127.0.0.1", "port" => 1026, "check-local" => "disable", "bin-path" => "/usr/local/bin/cgi-fcgi", #"docroot" => "/" # remote server may use # it's own docroot )) ) ## read fastcgi.txt for more info ## for PHP don't forget to set cgi.fix_pathinfo = 1 in the php.ini #fastcgi.server = ( ".php" => # ( "localhost" => # ( # "socket" => "/var/run/lighttpd/php-fastcgi.s ocket", # "bin-path" => "/usr/local/bin/php-cgi" # ) # ) # ) #### CGI module #cgi.assign = ( ".pl" => "/usr/bin/perl", # ".cgi" => "/usr/bin/perl" ) # #### SSL engine #ssl.engine = "enable" #ssl.pemfile = "/etc/ssl/private/lighttpd.pem" #### status module #status.status-url = "/server-status" #status.config-url = "/server-config" #### auth module ## read authentication.txt for more info #auth.backend = "plain" #auth.backend.plain.userfile = "lighttpd.user" #auth.backend.plain.groupfile = "lighttpd.group" #auth.backend.ldap.hostname = "localhost" #auth.backend.ldap.base-dn = "dc=my-domain,dc=com" #auth.backend.ldap.filter = "(uid=$)" #auth.require = ( "/server-status" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "user=jan" # ), # "/server-config" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "valid-user" # ) # ) #### url handling modules (rewrite, redirect, access) #url.rewrite = ( "^/$" => "/server-status" ) #url.redirect = ( "^/wishlist/(.+)" => "http://www.123.org/$1" ) #### both rewrite/redirect support back reference to regex conditional using %n #$HTTP["host"] =~ "^www\.(.*)" { # url.redirect = ( "^/(.*)" => "http://%1/$1" ) #} # # define a pattern for the host url finding # %% => % sign # %0 => domain name + tld # %1 => tld # %2 => domain name without tld # %3 => subdomain 1 name # %4 => subdomain 2 name # #evhost.path-pattern = "/srv/www/vhosts/%3/htdocs/" #### expire module #expire.url = ( "/buggy/" => "access 2 hours", "/asdhas/" => "ac cess plus 1 seconds 2 minutes") #### ssi #ssi.extension = ( ".shtml" ) #### rrdtool #rrdtool.binary = "/usr/bin/rrdtool" #rrdtool.db-name = "/var/lib/lighttpd/lighttpd.rrd" #### setenv #setenv.add-request-header = ( "TRAV_ENV" => "mysql://user@host/db" ) #setenv.add-response-header = ( "X-Secret-Message" => "42" ) ## for mod_trigger_b4_dl # trigger-before-download.gdbm-filename = "/var/lib/lighttpd/trigger.db" # trigger-before-download.memcache-hosts = ( "127.0.0.1:11211" ) # trigger-before-download.trigger-url = "^/trigger/" # trigger-before-download.download-url = "^/download/" # trigger-before-download.deny-url = "http://127.0.0.1/index.html" # trigger-before-download.trigger-timeout = 10 #### variable usage: ## variable name without "." is auto prefixed by "var." and becomes "var.bar" #bar = 1 #var.mystring = "foo" ## integer add #bar += 1 ## string concat, with integer cast as string, result: "www.foo1.com" #server.name = "www." + mystring + var.bar + ".com" ## array merge #index-file.names = (foo + ".php") + index-file.names #index-file.names += (foo + ".php") #### include #include /etc/lighttpd/lighttpd-inc.conf ## same as above if you run: "lighttpd -f /etc/lighttpd/lighttpd.conf" #include "lighttpd-inc.conf" #### include_shell #include_shell "echo var.a=1" ## the above is same as: #var.a=1 Thank you for your help.

    Read the article

  • ServerRoot in my lighttpd.conf

    - by michael
    Hi, I have use the following example lighttpd.conf to launch my lighttpd. Can you please tell me where is my 'ServerRoot'? # lighttpd configuration file # # use it as a base for lighttpd 1.0.0 and above # # $Id: lighttpd.conf,v 1.7 2004/11/03 22:26:05 weigon Exp $ ############ Options you really have to take care of #################### ## modules to load # at least mod_access and mod_accesslog should be loaded # all other module should only be loaded if really neccesary # - saves some time # - saves memory server.modules = ( # "mod_rewrite", # "mod_redirect", # "mod_alias", "mod_access", # "mod_trigger_b4_dl", # "mod_auth", # "mod_status", # "mod_setenv", "mod_fastcgi", # "mod_proxy", # "mod_simple_vhost", # "mod_evhost", # "mod_userdir", # "mod_cgi", # "mod_compress", # "mod_ssi", # "mod_usertrack", # "mod_expire", # "mod_secdownload", # "mod_rrdtool", "mod_accesslog" ) ## A static document-root. For virtual hosting take a look at the ## mod_simple_vhost module. server.document-root = "/srv/www/htdocs/" ## where to send error-messages to server.errorlog = "/var/log/lighttpd/error.log" # files to check for if .../ is requested index-file.names = ( "index.php", "index.html", "index.htm", "default.htm" ) ## set the event-handler (read the performance section in the manual) # server.event-handler = "freebsd-kqueue" # needed on OS X # mimetype mapping mimetype.assign = ( ".pdf" => "application/pdf", ".sig" => "application/pgp-signature", ".spl" => "application/futuresplash", ".class" => "application/octet-stream", ".ps" => "application/postscript", ".torrent" => "application/x-bittorrent", ".dvi" => "application/x-dvi", ".gz" => "application/x-gzip", ".pac" => "application/x-ns-proxy-autoconfig", ".swf" => "application/x-shockwave-flash", ".tar.gz" => "application/x-tgz", ".tgz" => "application/x-tgz", ".tar" => "application/x-tar", ".zip" => "application/zip", ".mp3" => "audio/mpeg", ".m3u" => "audio/x-mpegurl", ".wma" => "audio/x-ms-wma", ".wax" => "audio/x-ms-wax", ".ogg" => "application/ogg", ".wav" => "audio/x-wav", ".gif" => "image/gif", ".jar" => "application/x-java-archive", ".jpg" => "image/jpeg", ".jpeg" => "image/jpeg", ".png" => "image/png", ".xbm" => "image/x-xbitmap", ".xpm" => "image/x-xpixmap", ".xwd" => "image/x-xwindowdump", ".css" => "text/css", ".html" => "text/html", ".htm" => "text/html", ".js" => "text/javascript", ".asc" => "text/plain", ".c" => "text/plain", ".cpp" => "text/plain", ".log" => "text/plain", ".conf" => "text/plain", ".text" => "text/plain", ".txt" => "text/plain", ".dtd" => "text/xml", ".xml" => "text/xml", ".mpeg" => "video/mpeg", ".mpg" => "video/mpeg", ".mov" => "video/quicktime", ".qt" => "video/quicktime", ".avi" => "video/x-msvideo", ".asf" => "video/x-ms-asf", ".asx" => "video/x-ms-asf", ".wmv" => "video/x-ms-wmv", ".bz2" => "application/x-bzip", ".tbz" => "application/x-bzip-compressed-tar", ".tar.bz2" => "application/x-bzip-compressed-tar", # default mime type "" => "application/octet-stream", ) # Use the "Content-Type" extended attribute to obtain mime type if possible #mimetype.use-xattr = "enable" ## send a different Server: header ## be nice and keep it at lighttpd # server.tag = "lighttpd" #### accesslog module accesslog.filename = "/var/log/lighttpd/access.log" ## deny access the file-extensions # # ~ is for backupfiles from vi, emacs, joe, ... # .inc is often used for code includes which should in general not be part # of the document-root url.access-deny = ( "~", ".inc" ) $HTTP["url"] =~ "\.pdf$" { server.range-requests = "disable" } ## # which extensions should not be handle via static-file transfer # # .php, .pl, .fcgi are most often handled by mod_fastcgi or mod_cgi static-file.exclude-extensions = ( ".php", ".pl", ".fcgi" ) ######### Options that are good to be but not neccesary to be changed ####### ## bind to port (default: 80) server.port = 9090 ## bind to localhost (default: all interfaces) server.bind = "127.0.0.1" ## error-handler for status 404 #server.error-handler-404 = "/error-handler.html" #server.error-handler-404 = "/error-handler.php" ## to help the rc.scripts #server.pid-file = "/var/run/lighttpd.pid" ###### virtual hosts ## ## If you want name-based virtual hosting add the next three settings and load ## mod_simple_vhost ## ## document-root = ## virtual-server-root + virtual-server-default-host + virtual-server-docroot ## or ## virtual-server-root + http-host + virtual-server-docroot ## #simple-vhost.server-root = "/srv/www/vhosts/" #simple-vhost.default-host = "www.example.org" #simple-vhost.document-root = "/htdocs/" ## ## Format: <errorfile-prefix><status-code>.html ## -> ..../status-404.html for 'File not found' #server.errorfile-prefix = "/usr/share/lighttpd/errors/status-" #server.errorfile-prefix = "/srv/www/errors/status-" ## virtual directory listings #dir-listing.activate = "enable" ## select encoding for directory listings #dir-listing.encoding = "utf-8" ## enable debugging #debug.log-request-header = "enable" #debug.log-response-header = "enable" #debug.log-request-handling = "enable" #debug.log-file-not-found = "enable" ### only root can use these options # # chroot() to directory (default: no chroot() ) #server.chroot = "/" ## change uid to <uid> (default: don't care) #server.username = "wwwrun" ## change uid to <uid> (default: don't care) #server.groupname = "wwwrun" #### compress module #compress.cache-dir = "/var/cache/lighttpd/compress/" #compress.filetype = ("text/plain", "text/html") #### proxy module ## read proxy.txt for more info #proxy.server = ( ".php" => # ( "localhost" => # ( # "host" => "192.168.0.101", # "port" => 80 # ) # ) # ) #### fastcgi module fastcgi.server = ( "/fastcgi_scripts/" => (( "host" => "127.0.0.1", "port" => 1026, "check-local" => "disable", "bin-path" => "/usr/local/bin/cgi-fcgi", #"docroot" => "/" # remote server may use # it's own docroot )) ) ## read fastcgi.txt for more info ## for PHP don't forget to set cgi.fix_pathinfo = 1 in the php.ini #fastcgi.server = ( ".php" => # ( "localhost" => # ( # "socket" => "/var/run/lighttpd/php-fastcgi.socket", # "bin-path" => "/usr/local/bin/php-cgi" # ) # ) # ) #### CGI module #cgi.assign = ( ".pl" => "/usr/bin/perl", # ".cgi" => "/usr/bin/perl" ) # #### SSL engine #ssl.engine = "enable" #ssl.pemfile = "/etc/ssl/private/lighttpd.pem" #### status module #status.status-url = "/server-status" #status.config-url = "/server-config" #### auth module ## read authentication.txt for more info #auth.backend = "plain" #auth.backend.plain.userfile = "lighttpd.user" #auth.backend.plain.groupfile = "lighttpd.group" #auth.backend.ldap.hostname = "localhost" #auth.backend.ldap.base-dn = "dc=my-domain,dc=com" #auth.backend.ldap.filter = "(uid=$)" #auth.require = ( "/server-status" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "user=jan" # ), # "/server-config" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "valid-user" # ) # ) #### url handling modules (rewrite, redirect, access) #url.rewrite = ( "^/$" => "/server-status" ) #url.redirect = ( "^/wishlist/(.+)" => "http://www.123.org/$1" ) #### both rewrite/redirect support back reference to regex conditional using %n #$HTTP["host"] =~ "^www\.(.*)" { # url.redirect = ( "^/(.*)" => "http://%1/$1" ) #} # # define a pattern for the host url finding # %% => % sign # %0 => domain name + tld # %1 => tld # %2 => domain name without tld # %3 => subdomain 1 name # %4 => subdomain 2 name # #evhost.path-pattern = "/srv/www/vhosts/%3/htdocs/" #### expire module #expire.url = ( "/buggy/" => "access 2 hours", "/asdhas/" => "access plus 1 seconds 2 minutes") #### ssi #ssi.extension = ( ".shtml" ) #### rrdtool #rrdtool.binary = "/usr/bin/rrdtool" #rrdtool.db-name = "/var/lib/lighttpd/lighttpd.rrd" #### setenv #setenv.add-request-header = ( "TRAV_ENV" => "mysql://user@host/db" ) #setenv.add-response-header = ( "X-Secret-Message" => "42" ) ## for mod_trigger_b4_dl # trigger-before-download.gdbm-filename = "/var/lib/lighttpd/trigger.db" # trigger-before-download.memcache-hosts = ( "127.0.0.1:11211" ) # trigger-before-download.trigger-url = "^/trigger/" # trigger-before-download.download-url = "^/download/" # trigger-before-download.deny-url = "http://127.0.0.1/index.html" # trigger-before-download.trigger-timeout = 10 #### variable usage: ## variable name without "." is auto prefixed by "var." and becomes "var.bar" #bar = 1 #var.mystring = "foo" ## integer add #bar += 1 ## string concat, with integer cast as string, result: "www.foo1.com" #server.name = "www." + mystring + var.bar + ".com" ## array merge #index-file.names = (foo + ".php") + index-file.names #index-file.names += (foo + ".php") #### include #include /etc/lighttpd/lighttpd-inc.conf ## same as above if you run: "lighttpd -f /etc/lighttpd/lighttpd.conf" #include "lighttpd-inc.conf" #### include_shell #include_shell "echo var.a=1" ## the above is same as: #var.a=1 Thank you.

    Read the article

< Previous Page | 327 328 329 330 331 332 333 334  | Next Page >