Search Results

Search found 87514 results on 3501 pages for 'with open file'.

Page 34/3501 | < Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Open Multiple Sites Without Reopening the Menus in Firefox

    - by Asian Angel
    Are you frustrated with having to reopen your menus for each website that you need or want to view? Now you can keep those menus open while opening multiple websites with the Stay-Open Menu extension for Firefox. Stay-Open Menu in Action You can start using the extension as soon as you have installed it…simply access your favorite links in the “Bookmarks Menu, Bookmarks Toolbar, Awesome Bar, or History Menu” and middle click on the appropriate entries. Here you can see our browser opening the Productive Geek website and that the “Bookmarks Menu” is still open. As soon as you left click on a link or click outside the menus they will close normally like before. Note: Middle clicked links open in new tabs. The only time during our tests that a newly opened link “remained in the background” was for any links opened from the “Awesome Bar”. But as soon as the “Awesome Bar” was closed the new tabs automatically focused to the front. A link being opened from the “History Menu”…still open while the webpage is loading. Options The options are simple to sort through…enable or disable the additional “stay open” functions and enable automatic menu closing if desired. Conclusion If you get frustrated with having to reopen menus to access multiple webpages at one time then you might want to give this extension a try. Links Download the Stay-Open Menu extension (Mozilla Add-ons) Similar Articles Productive Geek Tips Make Firefox Use Multiple Rows of TabsDisable Web Site Window Resizing in FirefoxQuick Hits: 11 Firefox Tab How-TosPrevent Annoying Websites From Messing With the Right-Click Menu in FirefoxJatecblog Moves to How-To Geek Blogs (Linux Readers Should Subscribe) TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 PCmover Professional StockFox puts a Lightweight Stock Ticker in your Statusbar Explore Google Public Data Visually The Ultimate Excel Cheatsheet Convert the Quick Launch Bar into a Super Application Launcher Automate Tasks in Linux with Crontab Discover New Bundled Feeds in Google Reader

    Read the article

  • How to run video from wine?

    - by 101
    I tried to run it from total commander, I tried to make a link to it /media/DATA/#TO_BACKUP/_MUSIC/MUSIC2/Black Eyed Peas - The Time (Dirty Bit).avi but it says Failed to execute child process "/media/DATA/" (Permission denied) Opening the full location from MediaPlayer does not work (open location) Location not found I can open it slowly by navigating in the slow file open dialog, but I would like to open it from totalcmd or by created link or by passing full location. P.S. Before that I have opened the DATA Partition.

    Read the article

  • How to run video from total commander(wine)?

    - by 101
    When I click on video file nothing happens, I tried to make a link to it /media/DATA/#TO_BACKUP/_MUSIC/MUSIC2/Black Eyed Peas - The Time (Dirty Bit).avi but it says Failed to execute child process "/media/DATA/" (Permission denied) Opening the full location from MediaPlayer does not work (open location) Location not found I can open it slowly by navigating in the slow file open dialog, but I would like to open it from totalcmd or by created link or by passing full location. P.S. Before that I have opened the DATA Partition.

    Read the article

  • Rails: Open HTTP URL From HTTPS site

    - by Imran
    I have a rails application running on SSL. I also have setup Piwik (for analytics) and it is running non-secure i.e. HTTP. When I try to make a call to Piwik API from my ruby code (the application running on SSL) it gives me the following error: SocketError (getaddrinfo: Name or service not known): /usr/lib/ruby/1.8/net/http.rb:560:in initialize' /usr/lib/ruby/1.8/net/http.rb:560:inopen' /usr/lib/ruby/1.8/net/http.rb:560:in connect' /usr/lib/ruby/1.8/timeout.rb:53:intimeout' /usr/lib/ruby/1.8/timeout.rb:93:in timeout' /usr/lib/ruby/1.8/net/http.rb:560:inconnect' /usr/lib/ruby/1.8/net/http.rb:553:in do_start' /usr/lib/ruby/1.8/net/http.rb:542:instart' /usr/lib/ruby/1.8/net/http.rb:379:in get_response' app/controllers/piwik_charts_controller.rb:195:inmake_graph' It works perfect when I make call from an application running on HTTP. Please advise. Thanks, Imran

    Read the article

  • dz's Open Flash Chart 2 disabling animation problem (Rails)

    - by greg
    How to disable the startup animation in OFC2? Since I started using the dz build, the on-show animation is on by default, which sucks quite a lot. Neither of these work: graph.animate=false graph.on_show=false Also, dz's build implements the tooltip hover support poorly - the tooltip continues to hover even when the cursor is on another flash object. Has anyone overcome these problems?

    Read the article

  • Open Source Mozilla Prism Alternative

    - by Patrick Klingemann
    Here is what I want to do, very simply: I want to put a URL into a Mozilla Prism (or some alternative), then be provided with an icon on my desktop that when I click it a window opens and the page is displayed. The process for this instance of Prism should be completely independent of any other Prism "applications" that are running. Prism looks like it does this exactly, but I'm running Fedora 12 x86_64 and I can't get it to work, so I'm wondering if there are any alternatives to Prism.

    Read the article

  • Open source license for test code

    - by Gary
    I'm creating a project to house an iPhone library for common code for the iPhone... essentially it's a library that'll save people from finding solutions to common problems that amount to copying and pasting snippets of code. The site is located here: http://code.google.com/p/devkit-bb/ I licensed it under Eclipse, because fosters the extension of the library without requiring constraints like LGPL on object files being provided/made available, which would be the case since everything is statically linked. What I'm wondering is how/what license to apply to the unit tests? Since they essentially demonstrate how to use various interfaces and components. Thus they're designed for potential copy and paste situations, and I don't want people who might end up using this as part of the building blocks of their environment to feel like the license would prohibit that "derivative work", ie. their application or game.

    Read the article

  • What's the best Open Php newsletter manager ?

    - by Bilel
    Hi :) I'm looking for a nice newsletter management solution. I tried CCmail a good script but whaere I can't imort usernames !!! I would like to find a system that is able to import Opt-in lists in the following format : John Smith;[email protected];other paramaeters...;[like] ;Male;Age... I will develop my own module if I could find another emailing manager Are you already satisfied with a similar application with a trusted (spam-prevention) emailer ? Thank you :)

    Read the article

  • Open Source Alternative to ASP.NET membership

    - by Tony Lenzi
    I'm currently supporting a Python web app with increasingly complicated user/role/permission management requirements. Currently, we are rolling our own user, groups, permissions, etc. code and supporting database. I'd like to find something like ASP.NET membership that can help manage user authentication and authorization, rather than risk security issues in continuing to create an increasingly complicated custom solution. Are there any similar projects out there worth taking a look at?

    Read the article

  • What open source database platform is most easily transferred from my personal machine into a window

    - by Tom
    I would like eventual interaction with MS Dynamics SL and/or MindTouch Core (running on WMware) for eventual intranet and/or internet display. I guess I am asking for front and back end recommendations for a database I am constructing, but since this is my first major project I would greatly appreciate any help and advice. I would also love an opportunity to learn a new language so the code base could be in any language. I do have a few more related questions for discussion; What is the viability of using Google hosting to provide the service to the public for free? Should I implement plone or another CMS if I have a large amount of output? Is there a structuring questionnaire or standards publication I could reference? Does UML diagramming provide additional options for portability? Thank you.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Are open source projects considered community service?

    - by Gio Borje
    I'm currently a junior in high school and I've been slacking off on my community service to develop websites and do some personal projects in C#. Currently, I'm developing an web-based IM-Chat through node.js (the server-side Javascript). If I were to post this or other projects on Github or on Google Code, could this be considered community service?—to the programming community?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Open-source navigation software and 3rd party hardware

    - by anttir
    I'm a bit fed up with the current navigator (TomTom) as it turned to adware after six months of use. "Please buy new maps at www.tomtom.com, click this button to see what you wanted to do". Is there any (good) OSS navigation software with support for proprietary hardware? I'm perfectly happy to purchase separate maps and hardware for the software as long as I don't have to give my money to TomTom or Navigon.

    Read the article

  • open source project requirements

    - by skidding
    I know it's a very common question, but I don't see a previous one to be asked, since I'm interested in the basic steps, nothing in particular. It's the first time I want to license one of my projects, and it turns out, I don't know much about it. Let's say I want to use the MIT License. Do I just take the definition and paste it into my files? Does it need to be in ALL the files, or just one? or? I don't want any fancy rights so MIT has been recommended to me, do you suggest something else? I'm looking for impartial opinions. Thanks. What other aspects must I take into account? It's PHP, btw.

    Read the article

  • error come to execute the stored procedure using with open xml in sql server

    - by Muthumari
    Hi, i execute the below stored procedure.but it shows the error. The error is 'Incorrect syntax near '.'.i.e error shows in 'xmlFields.Country' please look this stored procedure also and help me thanks, in advance create procedure sp_SuUpdateSUADUsersStatus ( @FinalEMPCode nvarchar(50), @xmlFields NTEXT ) AS DECLARE @CityIDReturn INT SET NOCOUNT ON BEGIN DECLARE @hdoc INT EXEC sp_xml_preparedocument @hdoc OUTPUT, @xmlFields BEGIN EXEC @CityIDReturn=sp_SuSaveADUsersLocation @Country=xmlFields.Country, xmlFields.State,xmlFields.City FROM OPENXML(@hDoc, 'EmpCode/User', 2) WITH (Country nvarchar(500),State nvarchar(500),City nvarchar(500)) as xmlFields where xmlFields.Country <>'' and xmlFields.State <>'' and xmlFields.City <>'') END EXEC sp_xml_removedocument @hdoc End

    Read the article

< Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >