Search Results

Search found 47335 results on 1894 pages for 'find'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 341/1894 | < Previous Page | 337 338 339 340 341 342 343 344 345 346 347 348  | Next Page >

  • Test if single linked list is circular by traversing it only once

    - by user1589754
    I am a fresher and I was asked this question in a recent interview I gave. The question was --- By traversing each element of linked list just once find if the single linked list is circular at any point. To this I answered that we will store reference of each node while traversing the list in another linked list and for every node in the list being tested we will find if the reference exists in the list I am storing the references. The interviewer said that he needs a more optimized way to solve this problem. Can anyone please tell me what would be a more optimized method to solve this problem.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Website using JEE

    - by Rob
    Hi guys, I have a simple question, but I can't find out the answer. I'm wondering if we can see that a website is built using the JEE technology, or servlets/JSP. I think it could be possible to look for specials pages from the server (404, wrong parameters, ...) in some cases, but what about the everyday use ? In fact, I look for a collection of great (or wide used) website using the java technology, and I can't really find a list of these. I'llbe very happy if you can help me with these two small questions

    Read the article

  • The Reason of Service Termination

    - by Mariusz
    I use a service application I created in Delphi. My problem is that it is sometimes terminated by the operating system and I don't know why this happens. When I go the the system events, I can find a piece of information like this one: Event ID: 7034, The [...] service terminated unexpectedly. It has done this [...] time(s). I know you can't give me an answer why this happens, but could you please give me a clue what to pay attention to to find the reason of that behaviour? For instance what kind of exceptions could make the OS close an application. Thank you in advance.

    Read the article

  • jQuery: select all inputs with unique id (Regex/Wildcard Selectors)

    - by d3020
    I have some textboxes on a webform that have ids like this: txtFinalDeadline_1 txtFinalDeadline_2 txtFinalDeadline_3 txtFinalDeadline_4 In my jQuery how do I find all of those in order to assign a value to them. Before I had the underscore and they were all named txtFinalDeadline I could do this and it worked. $(this).find("#txtFinalDeadline").val(formatDate); However, that was when they were all named the same thing. Now I have the _x after the name and I'm not sure how to go about assigning that same value as before to them. Thanks.

    Read the article

  • Array.BinarySearch where a certain condition is met

    - by codymanix
    I have an array of a certain type. Now I want to find an entry where a certain condition is met. What is the preferred way to do this with the restriction that I don't want to create a temporary object to find, but instead I only want to give a search condition. MyClass[] myArray; // fill and sort array.. MyClass item = Array.BinarySearch(myArray, x=>x.Name=="Joe"); // is this possible? Maybe is it possible to use LINQ to solve it?

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • Multiple levels of 'collection.defaultdict' in Python

    - by Morlock
    Thanks to some great folks on SO, I discovered the possibilities offered by collections.defaultdict, notably in readability and speed. I have put them to use with success. Now I would like to implement three levels of dictionaries, the two top ones being defaultdict and the lowest one being int. I don't find the appropriate way to do this. Here is my attempt: from collections import defaultdict d = defaultdict(defaultdict) a = [("key1", {"a1":22, "a2":33}), ("key2", {"a1":32, "a2":55}), ("key3", {"a1":43, "a2":44})] for i in a: d[i[0]] = i[1] Now this works, but the following, which is the desired behavior, doesn't: d["key4"]["a1"] + 1 I suspect that I should have declared somewhere that the second level defaultdict is of type int, but I didn't find where or how to do so. The reason I am using defaultdict in the first place is to avoid having to initialize the dictionary for each new key. Any more elegant suggestion? Thanks pythoneers!

    Read the article

  • gwt compiling error

    - by Hoax
    Compiling module com.sem.Sem10 Finding entry point classes [ERROR] Unable to find type 'com.sem.client.Sem10' [ERROR] Hint: Previous compiler errors may have made this type unavailable [ERROR] Hint: Check the inheritance chain from your module; it may not be inheriting a required module or a module may not be adding its source path entries properly My package structure is com.sem com.sem.client com.sem.schema com.sem.server inherits name='com.google.gwt.user.User' inherits name='com.google.gwt.user.theme.standard.Standard' inherits name='com.google.gwt.maps.GoogleMaps' script src="http://maps.google.com/maps?gwt=1&file=api&amp.... entry-point class='com.sem.client.Sem10' source path='com.sem.schema' I have googled this thing for quite a while and could not find a solution...? any help appreciated

    Read the article

  • taskbar-free window manager

    - by 7vies
    I'm looking for a window manager that is not based on the "standard" taskbar (which I find a poor idea and I'm completely tired of). I'm aware of tiling window managers and improvements in last versions of operating systems, but I can't find what I need. I suppose that any window takes the whole screen (or can be tiled), and I imagine switching between windows like that: on a hotkey or mouse hot zone the screen becomes a task switcher where tasks are organized in a somewhat convenient manner. Well, it's a bit like a taskbar with autohide, but I think there could be some more convenient ideas than simply stacking icons and descriptions... It is also supposed to be lightweight enough, for example to run on a netbook. Any suggestions?

    Read the article

  • How do you assign a variable with the result of a if..else block?

    - by Pierre Olivier Martel
    I had an argument with a colleague about the best way to assign a variable in an if..else block. His orignal code was : @products = if params[:category] Category.find(params[:category]).products else Product.all end I rewrote it this way : if params[:category] @products = Category.find(params[:category]).products else @products = Product.all end This could also be rewritten with a one-liner using a ternery operator (? :) but let's pretend that product assignment was longer than a 100 character and couldn't fit in one line. Which of the two is clearer to you? The first solution takes a little less space but I thought that declaring a variable and assigning it three lines after can be more error prone. I also like to see my if and else aligned, makes it easier for my brain to parse it!

    Read the article

  • Sum of Fibonacci numbers

    - by Rafal
    Hi, I'm rather new to Haskell. The problem is to find the sum of all even Fibonacci numbers not greater than 4 million. I can't use lists. If I understand correctly, the below solution is wrong, because it uses lists: my_sum = sum $ filter (even) $ takeWhile (< 4000000) fibs Where fibs is the list of all Fibonacci numbers. Somehow, I find it difficult not to think in Haskell in terms of lists. Could anyone guide me to a solution to this problem? Regards

    Read the article

  • I have a filter for jquery masonry - but I want to filter moomasonry

    - by Jason
    Hi, I'm using jquery masonry for layout. But I am considering moving to mootools. I have found a masonry port to mootools, called moomasonry - http://www.crionics.com/products/opensource/mooMasonry/Demos/basic.html With help here, I have a filter on the masonry divs by class: $('a.filter').click(function(){ filterBoxes(this.id); }) function filterBoxes(klass){ if (klass == "all") { klass = "box" } $('#holder').find('.' + klass) .hide() .appendTo('#main') .fadeIn('200') $('#main').find('.box:not(.' + klass + ')') .fadeOut( '200', function(){ $(this).appendTo('#holder') ; }); setTimeout(function(){ $('#main').masonry() },500); } But, how would I filter divs by class in mootools? and have it reload masonry after each filter. See my site for example: http://jasondaydesign.com/masonry_demo/

    Read the article

  • How to control a NSView, located in a dedicated NSWindow, from the main NSWindow designed to support

    - by Michael
    Hi, This is probably a simple problem for the high skilled Cocoa programmers, but I can't find how to control the graph in a separate window. I read carefully the Cocoa related books, go through many web notes,but I can't find a solution to my problem. The purpose is to use a dedicated window to draw the I=F(Vg) curves extracted by the GUI from a specific hardware. All the GUI and the hardware works fine ( thanks to the help provided by several members of stackoverflow) , but no way to send the parameters to the NSView to display the results. So far, the GUI class is based on a NSObject, the graphic class is NSView. Any idea, examples, links will be appreciated. Thank you so much. Michael

    Read the article

  • C++ string array binary search

    - by Jose Vega
    string Haystack[] = { "Alabama", "Alaska", "American Samoa", "Arizona", "Arkansas", "California", "Colorado", "Connecticut", "Delaware", "District of Columbia", "Florida", "Georgia", "Guam", "Hawaii", "Idaho", "Illinois", "Indiana", "Iowa", "Kansas", "Kentucky", "Louisiana", "Maine", "Maryland", "Massachusetts", "Michigan", "Minnesota", "Mississippi", "Missouri", "Montana", "Nebraska", "Nevada", "New Hampshire", "New Jersey", "New Mexico", "New York", "North Carolina", "North Dakota", "Northern Mariana Islands", "Ohio", "Oklahoma", "Oregon", "Pennsylvania", "Puerto Rico", "Rhode Island", "South Carolina", "South Dakota", "Tennessee", "Texas", "US Virgin Islands", "Utah", "Vermont", "Virginia", "Washington", "West Virginia", "Wisconsin", "Wyoming"}; string Needle = "Virginia"; if(std::binary_search(Haystack, Haystack+56, Needle)) cout<<"Found"; If I also wanted to find the location of the needle in the string array, is there an "easy" way to find out?

    Read the article

  • Reading HttpRequest Body in REST WCF

    - by madness800
    Hi All, I got a REST WCF Service running in .net 4 and I've tested the web service it is working and accepting HttpRequest I make to it. But I ran into a problem trying to access the HttpRequest body within the web service. I've tried sending random sizes of data appended on the HttpRequest using both Fiddler and my WinForm app and I can't seem to find any objects in runtime where I can find my request body is located. My initial instinct was to look in the HttpContext.Current.Request.InputStream but the length of that property is 0, so I tried looking in IncomingWebRequestContext that object doesn't even have a method nor properties to get the body of the HttpRequest. So my question is, is there actually a way to access the HttpRequest request body in WCF? PS: The data inside the request body is JSON strings and for response it would return the data inside response body as JSON string too.

    Read the article

  • preg_match , regexp , php , ignore white spaces and new lines

    - by Michael
    I'm trying to extract richard123 using php preg_replace but there are a lot of white spaces and new lines and I think because of that my regexp doesn't work . The html can be seen here : http://pastebin.com/embed_iframe.php?i=vuD3z9ij My current preg_match is : $find = "/< tr bgcolor=\"F0F0F0\" valign=\"middle\">< td align=\"left\">< font size=\"-1\">(.*)<\/font><\/td>/"; preg_match_all($find, $res, $matches2); print_r($matches2); I also tried <\/td/s"; <\/td/m"; <\/td/x"; but doesn't work either .

    Read the article

  • JavaScript distributed computing project

    - by Ben L.
    I made a website that does absolutely nothing, and I've proven to myself that people like to stay there - I've already logged 11+ hours worth of cumulative time on the page. My question is whether it would be possible (or practical) to use the website as a distributed computing site. My first impulse was to find out if there were any JavaScript distributed computing projects already active, so that I could put a piece of code on the page and be done. Unfortunately, all I could find was a big list of websites that thought it might be a cool idea. I'm thinking that I might want to start with something like integer factorization - in this case, RSA numbers. It would be easy for the server to check if an answer was correct (simply test for modulus equals zero), and also easy to implement. Is my idea feasible? Is there already a project out there that I can use?

    Read the article

  • Need help with using regular expression in Java

    - by richard
    Hi, I am trying to match pattern like '@(a-zA-Z0-9)+ " but not like 'abc@test'. So this is what I tried: Pattern MY_PATTERN = Pattern.compile("\\s@(\\w)+\\s?"); String data = "[email protected] #gogasig @jytaz @tibuage"; Matcher m = MY_PATTERN.matcher(data); StringBuffer sb = new StringBuffer(); boolean result = m.find(); while(result) { System.out.println (" group " + m.group()); result = m.find(); } But I can only see '@jytaz', but not @tibuage. How can I fix my problem? Thank you.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 337 338 339 340 341 342 343 344 345 346 347 348  | Next Page >