Search Results

Search found 15863 results on 635 pages for 'made in india'.

Page 346/635 | < Previous Page | 342 343 344 345 346 347 348 349 350 351 352 353  | Next Page >

  • How to monitor MySQL query errors, timeouts and logon attempts?

    - by Abel
    While setting up a third party closed source CMS (Sitefinity) the setup doesn't create all tables and procedures necessary to run it. The software lacks a logging system itself and it made me wonder: could I trace and monitor failing SQL statements from MySQL? This serves more than only the purpose of solving my issue with Sitefinity. More often I wonder what's send to the MySQL server, not wanting to dive into the software products or setup a debugging environment etc. I tried JetProfiler (only performance) and looked through a few others, but although they monitor a lot, they don't monitor query failures, timeouts or logon attempts. Does anyone know a profiler, tracer, monitoring tool, commercial or free, that can show me this information?

    Read the article

  • How do I figure out which SOC or SDK board to use?

    - by Ram Bhat
    Hey guys Basically I'm working on a model of an automated vacuum cleaner. I currently have made software simulation of the same. How do I figure out which SOC or SDK board to use for the hardware implementation? My code is mostly written in C. Will this be compatible with the sdk provided by board manufacturers? How do i know what clock speed,memory etc the hardware will need? I'm a software guy and have only basic knowledge about practical hardware implementations. Have some experience in programming the 8086 to carry out basic tasks.

    Read the article

  • Disable keyboard on EditText

    - by Ferox
    I'm doing a calculator. So I made my own Buttons with numbers and functions. The expression that has to be calculated, is in an EditText, because I want users can add numbers or functions also in the middle of the expression, so with the EditText I have the cursor. But I want to disable the Keyboard when users click on the EditText. I found this example that it's ok for Android 2.3, but with ICS disable the Keyboard and also the cursor. public class NoImeEditText extends EditText { public NoImeEditText(Context context, AttributeSet attrs) { super(context, attrs); } @Override public boolean onCheckIsTextEditor() { return false; } } And then I use this NoImeEditText in my XML file <com.my.package.NoImeEditText android:id="@+id/etMy" .... /> How I can make compatible this EditText with ICS??? Thanks.

    Read the article

  • How do you sort files numerically?

    - by Zachary Young
    Hello all, First off, I'm posting this because when I was looking for a solution to the problem below, I could not find one on stackoverflow. So, I'm hoping to add a little bit to the knowledge base here. I need to process some files in a directory and need the files to be sorted numerically. I found some examples on sorting--specifically with using the lamba pattern--at wiki.python.org, and I put this together: #!env/python import re tiffFiles = """ayurveda_1.tif ayurveda_11.tif ayurveda_13.tif ayurveda_2.tif ayurveda_20.tif ayurveda_22.tif""".split('\n') numPattern = re.compile('_(\d{1,2})\.', re.IGNORECASE) tiffFiles.sort(cmp, key=lambda tFile: int(numPattern.search(tFile).group(1))) print tiffFiles I'm still rather new to Python and would like to ask the community if there are any improvements that can be made to this: shortening the code up (removing lambda), performance, style/readability? Thank you, Zachary

    Read the article

  • Access Database connect C# local director

    - by Bomboe Cristian
    I want my connection to the database to be available all the time, so if i move the folder with the project, to an other computer, the connection to be made automaticaly. So, how can i change this connection: this.oleDbConnection1.ConnectionString = "Provider=Microsoft.Jet.OLEDB.4.0;Data Source=\"C:\\Documents and Settings\\Cristi\\Do" + "cuments\\Visual Studio 2008\\Projects\\WindowsApplication3\\bd1.mdb\""; ??? It should read the project directory or something. I don't know. Any ideas? Thank You!

    Read the article

  • Any way to run DLL's at button click C#

    - by Sandeep Bansal
    Hi Guys, I'm looking for ways to speed my program to the max and one way I thought of was to strip all DLL's being run at startup and run them when they need to be. As an example, I have a DLL containing info required for an update module, but I don't want to have that running in the program if I don't need it till I have an update. (I know I can create a separate program and link it to that but this is just an example.) Is there anyway to attach this on a button click? Sorry if I haven't made my question understandable. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • gwt compiling error

    - by Hoax
    Compiling module com.sem.Sem10 Finding entry point classes [ERROR] Unable to find type 'com.sem.client.Sem10' [ERROR] Hint: Previous compiler errors may have made this type unavailable [ERROR] Hint: Check the inheritance chain from your module; it may not be inheriting a required module or a module may not be adding its source path entries properly My package structure is com.sem com.sem.client com.sem.schema com.sem.server inherits name='com.google.gwt.user.User' inherits name='com.google.gwt.user.theme.standard.Standard' inherits name='com.google.gwt.maps.GoogleMaps' script src="http://maps.google.com/maps?gwt=1&file=api&amp.... entry-point class='com.sem.client.Sem10' source path='com.sem.schema' I have googled this thing for quite a while and could not find a solution...? any help appreciated

    Read the article

  • Animated Circular bar on hover

    - by Anthony
    I'm building a portfolio website and want to implement a skill set page which feature an animated circular bar which represent each of my skills. There will be 6 buttons around the circle which when the user hovers over, and when one is hovered I want a circular bar to animate anti-clockwise. I've made a quick .gif in photoshop to demonstrate But I can't find any tutorial to help. I found this website which features a similar concept on the left hand side at the top, an animated pie chart - Website Example And this is a quick .gif Mockup I did in photoshop of what I am trying to achieve - Animated Circular Bar Animation

    Read the article

  • How can I prevent my Android app/service from being "killed" from a task manager?

    - by Don
    It is very important that my service stay running until someone with a password stops the service from my UI screen. My app runs great but it is designed to be turned on/off by parents (with a password) on their kids phones. I have managed to make everything work but the problem I'm having is that if the kid uses a task manager to kill my service then my app is useless. I would be grateful to anyone who knows a way to either 1) monitor the service and start it back up automatically if its "killed" or 2) prevent someone from being able to kill it except from the activity (administration screen) that launched the service. Or both? I'm sorry if I'm not very clear in describing the problem, I'm a beginner. I've made great progress so far but I am stuck at this last hurdle.

    Read the article

  • NHibernate & Cancelling Changes to Entities

    - by user129609
    Hi, This seems like it would be a common issue to be but I don't know the best way to solve it. I want to be able to send an Entity to a view, have changes be made to the entity in the view, but then cancel (remove) those changes if the user cancels out of the view. What is the proper way to do this. Here are two options I have but I think there should be others that are better 1) Take an entity, create a clone, send the clone to the view...if changes are accepted, update the original entity with the clone's values 2) Send the entity to the view, if the user cancels, remove the entity from NHibernate's cache and reload it from the database For (2), the issue for me would be that the old entity could still be referenced throughout my project after it has been removed from the cache.

    Read the article

  • What causes "java.lang.IncompatibleClassChangeError: vtable stub"?

    - by JimN
    What causes "java.lang.IncompatibleClassChangeError: vtable stub"? In our application, we have seen this error pop up randomly and very seldom (just twice so far, and we run it a lot). It is not readily reproducible, even when restarting the app, using the same jvm/jars without rebuilding. As for our build process, we clean all classes/jars and rebuild them, so it's not the same problem as others have encountered where they made a change in one class and didn't recompile some other dependent classes. This is unlike some of the other questions related to IncompatibleClassChangeError -- none of them mention "vtable stub". In fact, there are surprisingly few google results when searching for "IncompatibleClassChangeError "vtable stub"".

    Read the article

  • Saving Types generated via Reflection.Emit as code file (.cs) instead of saving it in .dll files

    - by Manish Sinha
    Before start let me tell my experience: I am experienced with C#.NET, web services, XML part and few more. Reflection is something new to me, though I have read extensively on it and tried out some experimental code, but haven't made anything great using reflection I checked out many examples of how we can create Type at runtime and then which can be saved in an assembly (.dll) files. Of all the examples I have seen is about saving the created types in the .dll files instead of code file. Isn't there any way to create the code file out of reflection? I need to create code file since I want to distribute code instead of compiled assemblies. What I want to do is something like xsd.exe does, either spit out a .dll or the code file(in any language). Isn't there any way to create a code file, since most of the place I can find is AssemblyBuilder ab = System.AppDomain.CurrentDomain.DefineDynamicAssembly(an, AssemblyBuilderAccess.Save); and then lastly ab.Save("QuoteOfTheDay.dll");

    Read the article

  • Problem with CommandFinder class...

    - by Patrick
    and I'm not sure why... Hello Everbody! I'm trying to make my first steps with SWTBot. I'm trying to test an Eclipse RCP Application. In one test i'm trying to call a command to save a dirty editor. But an assertion after the call, tells me that the editor is still dirty. An the data in the dirty editor is not showing up in the database. On the other hand, i'm not getting an Exception when calling the command... new CommandFinder().findCommand(CoreMatchers.equalTo(COMMANDNAME_SAVE)).get(0).click(); Has anyone any insperation for me, where i made a mistake?

    Read the article

  • DIRECTOR "TCP/IP Socket sever/client"

    - by VideoDnd
    Would Director be an option for creating a socket client? My client needs to accept server commands; frame rate, start etc. Director seems like it was made for controlling movies. I've got Director 11.5 at the office. Any lingo experts that could advise? Please post examples if you have any. I'm fed up with Flex and as3 at the moment. SERVER==XML PACKET==CLIENT==swf plays on given frame and duration

    Read the article

  • jQuery Cloud Zoom Plugin and image zoom being actived by mouseenter or mouseover

    - by masimao
    I am using the jQuery Cloud Zoom Plugin and i need to add the "mouseenter" or "mouseover" event to activate the zoom when the user put the mouse over the thumbs. So i have made this change in the line 359 of the file cloud-zoom.1.0.2.js (Version 1.0.2) $(this).bind('mouseenter click', $(this) ... It works, but if i pass the mouse quickly over the thumbs the "Loading" text doesn't disapear. Someone knows what i have to change to solve this? Thanks for any help!

    Read the article

  • Cloned Cached item has memory issues

    - by ioWint
    Hi there, we are having values stored in Cache-Enterprise library Caching Block. The accessors of the cached item, which is a List, modify the values. We didnt want the Cached Items to get affected. Hence first we returned a new List(IEnumerator of the CachedItem) This made sure accessors adding and removing items had little effect on the original Cached item. But we found, all the instances of the List we returned to accessors were ALIVE! Object relational Graph showed a relationship between this list and the EnterpriseLibrary.CacheItem. So we changed the return to be a newly cloned List. For this we used a LINQ say (from item in Data select new DataClass(item) ).ToList() even when you do as above, the ORG shows there is a relationship between this list and the CacheItem. Cant we do anything to create a CLONE of the List item which is present in the Enterprise library cache, which DOESNT have ANY relationship with CACHE?!

    Read the article

  • Office 2010: It&rsquo;s not just DOC(X) and XLS(X)

    - by andrewbrust
    Office 2010 has released to manufacturing.  The bits have left the (product team’s) building.  Will you upgrade? This version of Office is officially numbered 14, a designation that correlates with the various releases, through the years, of Microsoft Word.  There were six major versions of Word for DOS, during whose release cycles came three 16-bit Windows versions.  Then, starting with Word 95 and counting through Word 2007, there have been six more versions – all for the 32-bit Windows platform.  Skip version 13 to ward off folksy bad luck (and, perhaps, the bugs that could come with it) and that brings us to version 14, which includes implementations for both 32- and 64-bit Windows platforms.  We’ve come a long way baby.  Or have we? As it does every three years or so, debate will now start to rage on over whether we need a “14th” version the PC platform’s standard word processor, or a “13th” version of the spreadsheet.  If you accept the premise of that question, then you may be on a slippery slope toward answering it in the negative.  Thing is, that premise is valid for certain customers and not others. The Microsoft Office product has morphed from one that offered core word processing, spreadsheet, presentation and email functionality to a suite of applications that provides unique, new value-added features, and even whole applications, in the context of those core services.  The core apps thus grow in mission: Excel is a BI tool.  Word is a collaborative editorial system for the production of publications.  PowerPoint is a media production platform for for live presentations and, increasingly, for delivering more effective presentations online.  Outlook is a time and task management system.  Access is a rich client front-end for data-driven self-service SharePoint applications.  OneNote helps you capture ideas, corral random thoughts in a semi-structured way, and then tie them back to other, more rigidly structured, Office documents. Google Docs and other cloud productivity platforms like Zoho don’t really do these things.  And there is a growing chorus of voices who say that they shouldn’t, because those ancillary capabilities are over-engineered, over-produced and “under-necessary.”  They might say Microsoft is layering on superfluous capabilities to avoid admitting that Office’s core capabilities, the ones people really need, have become commoditized. It’s hard to take sides in that argument, because different people, and the different companies that employ them, have different needs.  For my own needs, it all comes down to three basic questions: will the new version of Office save me time, will it make the mundane parts of my job easier, and will it augment my services to customers?  I need my time back.  I need to spend more of it with my family, and more of it focusing on my own core capabilities rather than the administrative tasks around them.  And I also need my customers to be able to get more value out of the services I provide. Help me triage my inbox, help me get proposals done more quickly and make them easier to read.  Let me get my presentations done faster, make them more effective and make it easier for me to reuse materials from other presentations.  And, since I’m in the BI and data business, help me and my customers manage data and analytics more easily, both on the desktop and online. Those are my criteria.  And, with those in mind, Office 2010 is looking like a worthwhile upgrade.  Perhaps it’s not earth-shattering, but it offers a combination of incremental improvements and a few new major capabilities that I think are quite compelling.  I provide a brief roundup of them here.  It’s admittedly arbitrary and not comprehensive, but I think it tells the Office 2010 story effectively. Across the Suite More than any other, this release of Office aims to give collaboration a real workout.  In certain apps, for the first time, documents can be opened simultaneously by multiple users, with colleagues’ changes appearing in near real-time.  Web-browser-based versions of Word, Excel, PowerPoint and OneNote will be available to extend collaboration to contributors who are off the corporate network. The ribbon user interface is now more pervasive (for example, it appears in OneNote and in Outlook’s main window).  It’s also customizable, allowing users to add, easily, buttons and options of their choosing, into new tabs, or into new groups within existing tabs. Microsoft has also taken the File menu (which was the “Office Button” menu in the 2007 release) and made it into a full-screen “Backstage” view where document-wide operations, like saving, printing and online publishing are performed. And because, more and more, heavily formatted content is cut and pasted between documents and applications, Office 2010 makes it easier to manage the retention or jettisoning of that formatting right as the paste operation is performed.  That’s much nicer than stripping it off, or adding it back, afterwards. And, speaking of pasting, a number of Office apps now make it especially easy to insert screenshots within their documents.  I know that’s useful to me, because I often document or critique applications and need to show them in action.  For the vast majority of users, I expect that this feature will be more useful for capturing snapshots of Web pages, but we’ll have to see whether this feature becomes popular.   Excel At first glance, Excel 2010 looks and acts nearly identically to the 2007 version.  But additional glances are necessary.  It’s important to understand that lots of people in the working world use Excel as more of a database, analytics and mathematical modeling tool than merely as a spreadsheet.  And it’s also important to understand that Excel wasn’t designed to handle such workloads past a certain scale.  That all changes with this release. The first reason things change is that Excel has been tuned for performance.  It’s been optimized for multi-threaded operation; previously lengthy processes have been shortened, especially for large data sets; more rows and columns are allowed and, for the first time, Excel (and the rest of Office) is available in a 64-bit version.  For Excel, this means users can take advantage of more than the 2GB of memory that the 32-bit version is limited to. On the analysis side, Excel 2010 adds Sparklines (tiny charts that fit into a single cell and can therefore be presented down an entire column or across a row) and Slicers (a more user-friendly filter mechanism for PivotTables and charts, which visually indicates what the filtered state of a given data member is).  But most important, Excel 2010 supports the new PowerPIvot add-in which brings true self-service BI to Office.  PowerPivot allows users to import data from almost anywhere, model it, and then analyze it.  Rather than forcing users to build “spreadmarts” or use corporate-built data warehouses, PowerPivot models function as true columnar, in-memory OLAP cubes that can accommodate millions of rows of data and deliver fast drill-down performance. And speaking of OLAP, Excel 2010 now supports an important Analysis Services OLAP feature called write-back.  Write-back is especially useful in financial forecasting scenarios for which Excel is the natural home.  Support for write-back is long overdue, but I’m still glad it’s there, because I had almost given up on it.   PowerPoint This version of PowerPoint marks its progression from a presentation tool to a video and photo editing and production tool.  Whether or not it’s successful in this pursuit, and if offering this is even a sensible goal, is another question. Regardless, the new capabilities are kind of interesting.  A greatly enhanced set of slide transitions with 3D effects; in-product photo and video editing; accommodation of embedded videos from services such as YouTube; and the ability to save a presentation as a video each lay testimony to PowerPoint’s transformation into a media tool and away from a pure presentation tool. These capabilities also recognize the importance of the Web as both a source for materials and a channel for disseminating PowerPoint output. Congruent with that is PowerPoint’s new ability to broadcast a slide presentation, using a quickly-generated public URL, without involving the hassle or expense of a Web meeting service like GoToMeeting or Microsoft’s own LiveMeeting.  Slides presented through this broadcast feature retain full color fidelity and transitions and animations are preserved as well.   Outlook Microsoft’s ubiquitous email/calendar/contact/task management tool gains long overdue speed improvements, especially against POP3 email accounts.  Outlook 2010 also supports multiple Exchange accounts, rather than just one; tighter integration with OneNote; and a new Social Connector providing integration with, and presence information from, online social network services like LinkedIn and Facebook (not to mention Windows Live).  A revamped conversation view now includes messages that are part of a given thread regardless of which folder they may be stored in. I don’t know yet how well the Social Connector will work or whether it will keep Outlook relevant to those who live on Facebook and LinkedIn.  But among the other features, there’s very little not to like.   OneNote To me, OneNote is the part of Office that just keeps getting better.  There is one major caveat to this, which I’ll cover in a moment, but let’s first catalog what new stuff OneNote 2010 brings.  The best part of OneNote, is the way each of its versions have managed hierarchy: Notebooks have sections, sections have pages, pages have sub pages, multiple notes can be contained in either, and each note supports infinite levels of indentation.  None of that is new to 2010, but the new version does make creation of pages and subpages easier and also makes simple work out of promoting and demoting pages from sub page to full page status.  And relationships between pages are quite easy to create now: much like a Wiki, simply typing a page’s name in double-square-brackets (“[[…]]”) creates a link to it. OneNote is also great at integrating content outside of its notebooks.  With a new Dock to Desktop feature, OneNote becomes aware of what window is displayed in the rest of the screen and, if it’s an Office document or a Web page, links the notes you’re typing, at the time, to it.  A single click from your notes later on will bring that same document or Web page back on-screen.  Embedding content from Web pages and elsewhere is also easier.  Using OneNote’s Windows Key+S combination to grab part of the screen now allows you to specify the destination of that bitmap instead of automatically creating a new note in the Unfiled Notes area.  Using the Send to OneNote buttons in Internet Explorer and Outlook result in the same choice. Collaboration gets better too.  Real-time multi-author editing is better accommodated and determining author lineage of particular changes is easily carried out. My one pet peeve with OneNote is the difficulty using it when I’m not one a Windows PC.  OneNote’s main competitor, Evernote, while I believe inferior in terms of features, has client versions for PC, Mac, Windows Mobile, Android, iPhone, iPad and Web browsers.  Since I have an Android phone and an iPad, I am practically forced to use it.  However, the OneNote Web app should help here, as should a forthcoming version of OneNote for Windows Phone 7.  In the mean time, it turns out that using OneNote’s Email Page ribbon button lets you move a OneNote page easily into EverNote (since every EverNote account gets a unique email address for adding notes) and that Evernote’s Email function combined with Outlook’s Send to OneNote button (in the Move group of the ribbon’s Home tab) can achieve the reverse.   Access To me, the big change in Access 2007 was its tight integration with SharePoint lists.  Access 2010 and SharePoint 2010 continue this integration with the introduction of SharePoint’s Access Services.  Much as Excel Services provides a SharePoint-hosted experience for viewing (and now editing) Excel spreadsheet, PivotTable and chart content, Access Services allows for SharePoint browser-hosted editing of Access data within the forms that are built in the Access client itself. To me this makes all kinds of sense.  Although it does beg the question of where to draw the line between Access, InfoPath, SharePoint list maintenance and SharePoint 2010’s new Business Connectivity Services.  Each of these tools provide overlapping data entry and data maintenance functionality. But if you do prefer Access, then you’ll like  things like templates and application parts that make it easier to get off the blank page.  These features help you quickly get tables, forms and reports built out.  To make things look nice, Access even gets its own version of Excel’s Conditional Formatting feature, letting you add data bars and data-driven text formatting.   Word As I said at the beginning of this post, upgrades to Office are about much more than enhancing the suite’s flagship word processing application. So are there any enhancements in Word worth mentioning?  I think so.  The most important one has to be the collaboration features.  Essentially, when a user opens a Word document that is in a SharePoint document library (or Windows Live SkyDrive folder), rather than the whole document being locked, Word has the ability to observe more granular locks on the individual paragraphs being edited.  Word also shows you who’s editing what and its Save function morphs into a sync feature that both saves your changes and loads those made by anyone editing the document concurrently. There’s also a new navigation pane that lets you manage sections in your document in much the same way as you manage slides in a PowerPoint deck.  Using the navigation pane, you can reorder sections, insert new ones, or promote and demote sections in the outline hierarchy.  Not earth shattering, but nice.   Other Apps and Summarized Findings What about InfoPath, Publisher, Visio and Project?  I haven’t looked at them yet.  And for this post, I think that’s fine.  While those apps (and, arguably, Access) cater to specific tasks, I think the apps we’ve looked at in this post service the general purpose needs of most users.  And the theme in those 2010 apps is clear: collaboration is key, the Web and productivity are indivisible, and making data and analytics into a self-service amenity is the way to go.  But perhaps most of all, features are still important, as long as they get you through your day faster, rather than adding complexity for its own sake.  I would argue that this is true for just about every product Microsoft makes: users want utility, not complexity.

    Read the article

  • Google map in user control not loading from aspx code behind

    - by poojad
    I am using Google maps API for proximity search. I have all this in an ascx client side. I have a button in the aspx code behind. The initial load of the map is fine. But on the button click, the map is not being loaded though all the other controls are loading properly. The controls are in an Update Panel and I am new to using these. Would appreciate in any suggestions made.

    Read the article

  • php / mysql pagination

    - by arrgggg
    Hi, I have a table with 58 records in mysql database. I was able to connect to my database and retrive all records and made 5 pages with links to view each pages using php script. webpage will look like this: name number john 1232343456 tony 9878768544 jack 3454562345 joe 1232343456 jane 2343454567 andy 2344560987 marcy 9873459876 sean 8374623534 mark 9898787675 nancy 8374650493 1 2 3 4 5 that's the first page of 58 records and those 5 numbers at bottom are links to each page that will display next 10 records. I got all that. but what I want to do is display the links in this way: 1-10 11-20 21-30 31-40 41-50 51-58 note: since i have 58 records, last link will display upto 58, instead of 60. Since I used the loop to create this link, depending on how many records i have, the link will change according to the number of records in my table. How can i do this? Thanks.

    Read the article

  • Adobe Flex, loading a remote swf

    - by JonoB
    I have a flex app running on my server. I have had a request from some clients to have the swf loaded on their server, so that their customers dont have to be transferred to my server to login; i.e. from the user's point of view it looks like they are logging in from theirsite.com instead of mysite.com I tried something really simple, and that was to give them a html wrapper to host on their site. The only modification that I made was to change the "src" var to: "src", "https://www.mysite.com/app/myapp.swf" and embed src="https://www.mysite.com/app/myapp.swf" To my surprise, this worked perfectly. And best of all, the service calls still seem to come from mysite.com, so I dont have to bother with modifying the crossdomain.xml file. All good it seems. Are there any issues or downsides to the above that I should be aware of?

    Read the article

  • "a valid provisioning file for this executable was not found" in XCode

    - by dbonneville
    I'm trying to submit my second app to the App Store. I've followed all the instructions to the best of my knowledge, but I keep getting this error when I try to build and run: "a valid provisioning file for this executable was not found" I'm letting XCode auto select the profile automatically. The one I'd like to select is greyed out. But the dropdown selection in the Build tab of the Target window says "profile doesn't match application identifier" The other thing I don't get about this is that the selection dropdown shows "com.mycompany.myapp" and then "ABCDEDFG.com.mycompany.myapp" (both of those made up) so that I see they don't match. I have the unique identifier profile installed in the Organizer and in plist file. I'm totally confused. I have followed the instructions in my book a few times and just can't get it.

    Read the article

  • Setting up java configurations in eclipse. multiple .param files

    - by Charlie
    I'm going to be using ECJ for doing genetic programming and I haven't touched java in years. I'm working on setting up the eclipse environment and I'm catching a few snags. The ECJ source has several packages, and several sample programs come along with it. I ran one sample program (called tutorial1) by going to the run configurations and adding -file pathToParamsFile to the program arguments. This made it point to the params file of that tutorial and run that sample. In a new example I am testing (from the package gui) there are TWO params files. I tried pointing to just one param file and a program ran in the console, but there was supposed to be a GUI which did not load. I'm not sure what I'm doing wrong. Any help would be greaaatly appreciated.

    Read the article

  • What guides or standards do you use for CVS in your team ?

    - by PaulHurleyuk
    I'm starting to do a small amount of development within my company. I'm intending to use Git for CVS, and I'm interested to see what guidelines or standards people are using around CVS in their groups, similar to coding standards are often written within the group for the group. I'm assuming there will be things like; Commit often (at least every day/week/meeting etc) Release builds are always made from the master branch Prior to release, a new branch will be created for Testing and tagged as such. only bug fixes from this point onwards. The final release of this will be tagged as such and the bug fixes merged back into the trunk Each developer will have a public repo New features should get their own branch Obviously a lot of this will depend on what cvs you're using and how you've structured it. Similar Questions; http://stackoverflow.com/questions/273695/git-branch-naming-best-practices http://stackoverflow.com/questions/2006265/is-there-an-standard-naming-convention-for-git-tags

    Read the article

  • How do I repeat part of an image using background-position and CSS sprites?

    - by thor
    I would like to create some buttons with dynamic width using CSS sprites and background-position but I'm not sure if what I want is possible.. I would like the button to have a left-side, middle, and right-side, with the middle repeating as required. Ideally I would like this to be made up of one image of 11px wide so the left and right sides are both 5px wide and the middle is 1px repeated. Is there some way I can define in CSS to use the one centre pixel of the image and repeat if for the required (unknown) width? Normally I've used two images to achieve similar results - one for the sides and a second image of 1px width for the middle, but if there's some way of combining them into one image I would prefer to use that.

    Read the article

< Previous Page | 342 343 344 345 346 347 348 349 350 351 352 353  | Next Page >