Search Results

Search found 8883 results on 356 pages for 'meta description'.

Page 346/356 | < Previous Page | 342 343 344 345 346 347 348 349 350 351 352 353  | Next Page >

  • Javascript to PHP, mysql uploading, one button pressing solution

    - by user2897858
    my program is generating buttons from a mysql database.When one of the button is pressed, it would uplod the current time and the gps coordinate. Sadly, it only works if the same button is pressed twice, but its not an option, because the button has to dissappear. I would like to have some help in coding how to make that possible the user only need to press the button once for the correct upload.Thanks in advance Here is the full code of my my file: <?php session_start(); ?> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>title</title> </head> <?php $maidatum=date("Ymj"); echo "<script>getLocation();</script>"; //Az adatbázishoz való csatlakozás $conn = mysql_connect("localhost","root","asd"); if(!($conn))die("Nincs conn a kiszolgálóval!".mysql_error()); $adatbazisneve="schtrans"; mysql_select_db($adatbazisneve,$conn); mysql_query("set names 'utf8'"); mysql_query("set character set 'utf8'"); //Combobox $sql = "SELECT Jaratszam,Vezeto FROM user"; $rs = mysql_query($sql) or die(mysql_error()); echo "<form action=\"\" method=\"post\">"; echo<<<nev <select name='Lista'> nev; while($row = mysql_fetch_array($rs)){ echo "<option value='".$row["Jaratszam"]."'>".$row["Vezeto"]."</option>"; }mysql_free_result($rs); echo "</select>"; ///Combox vége echo<<<lekerd <form action="" method="post"> <input type="submit" name="bekuldes" value="Lekérdez" /> </form> </form> lekerd; echo<<<gps <form action="" method="post"> <input type="hidden" name= "longitude" id="longitude"> <input type= "hidden" name ="latitude" id="latitude"> </form> gps; if(isset($_POST["bekuldes"])) { $jaratszam = $_POST['Lista']; $_SESSION['jaratsz']=$jaratszam; $lekerdez_parancs="SELECT * FROM cim_$maidatum WHERE jarat=$jaratszam;"; $lekerdez=mysql_query($lekerdez_parancs, $conn); echo "<table border=\"1\">"; echo "<td>Utánvétel</td> <td>Megrendelés összege</td> <td>ISZ</td> <td>Város</td> <td>Utca</td> <td>Megjegyzés</td> <td>Csomagok</td> <td>Raklaphely</td> <td>Súly</td><td>Térfogat</td><td>Latitude</td><td>Longitude</td><td>Ido</td>"; $g=1; //cimszámláló while ($adatok=mysql_fetch_array($lekerdez)) { echo "<tr>"; $_SESSION['adatok0'][$g]=$adatok[0]; echo "<td>$adatok[2]</td> <td>$adatok[3]</td> <td>$adatok[4]</td> <td>$adatok[5]</td> <td>$adatok[6]</td> <td>$adatok[7]</td> <td>$adatok[8]</td> <td>$adatok[9]</td> <td>$adatok[10]</td><td>$adatok[11]</td><td>$adatok[13]</td><td>$adatok[14]</td>"; if ($adatok[12]==null) { echo<<<gomb <form action="" method="post"> <td> <input type="hidden" name= "longitude" id="longitude$g"> <input type= "hidden" name ="latitude" id="latitude$g"> <input type="submit" name="ido" value="$g" /></td> </form> gomb; } else {echo "<td>$adatok[12]</td>";} $g++; } echo "</table>"; } if(isset($_POST["ido"])) { $hanyadik=$_POST["ido"]; $longitudee="longitude$hanyadik"; $latitudee="latitude$hanyadik"; ?> <script> var x=document.getElementById("log"); function getLocation() { if (navigator.geolocation) { navigator.geolocation.getCurrentPosition(showPosition); } else{x.innerHTML="GPS szolgáltatás nem müködik ezen a böngészon, kérlek értesítsd a rendszergazdát!";} } function showPosition(position) { var latitude = position.coords.latitude; var longitude = position.coords.longitude; document.getElementById("<?php echo $longitudee;?>").value = longitude; document.getElementById("<?php echo $latitudee;?>").value = latitude; } </script> <?php echo "<script>getLocation();</script>"; $latitude=$_POST["latitude"]; $longitude=$_POST["longitude"]; print_r($_POST); $currentime=date("H:i:s"); $acim=$_SESSION['adatok0'][$hanyadik]; $idofeltolt_parancs="UPDATE cim_$maidatum SET ido='$currentime',lat='$latitude',longi='$longitude' WHERE cimid='$acim';"; $feltoltes=mysql_query($idofeltolt_parancs, $conn) or die(mysql_error()); //tryy $jaratszam=$_SESSION['jaratsz']; $lekerdez_parancs="SELECT * FROM cim_$maidatum WHERE jarat=$jaratszam;"; $lekerdez=mysql_query($lekerdez_parancs, $conn); mysql_query("set names 'utf8'"); mysql_query("set character set 'utf8'"); echo "<table border=\"1\">"; echo "<td>Utánvétel</td> <td>Megrendelés összege</td> <td>ISZ</td> <td>Város</td> <td>Utca</td> <td>Megjegyzés</td> <td>Csomagok</td> <td>Raklaphely</td> <td>Súly</td><td>Térfogat</td><td>Latitude</td><td>Longitude</td><td>Ido</td>"; $g=1; //cimszámláló while ($adatok=mysql_fetch_array($lekerdez)) { echo "<tr>"; $_SESSION['adatok0'][$g]=$adatok[0]; echo "<td>$adatok[2]</td> <td>$adatok[3]</td> <td>$adatok[4]</td> <td>$adatok[5]</td> <td>$adatok[6]</td> <td>$adatok[7]</td> <td>$adatok[8]</td> <td>$adatok[9]</td> <td>$adatok[10]</td><td>$adatok[11]</td><td>$adatok[13]</td><td>$adatok[14]</td>"; if ($adatok[12]==null) { echo<<<gomb <form action="" method="post"> <td> <input type="hidden" name= "longitude" id="longitude$g"> <input type= "hidden" name ="latitude" id="latitude$g"> <input type="submit" name="ido" value="$g" /></td> </form> gomb; } else {echo "<td>$adatok[12]</td>";} $g++; } echo "</table>"; } mysql_close($conn); ?> </html>

    Read the article

  • Finding the heaviest length-constrained path in a weighted Binary Tree

    - by Hristo
    UPDATE I worked out an algorithm that I think runs in O(n*k) running time. Below is the pseudo-code: routine heaviestKPath( T, k ) // create 2D matrix with n rows and k columns with each element = -8 // we make it size k+1 because the 0th column must be all 0s for a later // function to work properly and simplicity in our algorithm matrix = new array[ T.getVertexCount() ][ k + 1 ] (-8); // set all elements in the first column of this matrix = 0 matrix[ n ][ 0 ] = 0; // fill our matrix by traversing the tree traverseToFillMatrix( T.root, k ); // consider a path that would arc over a node globalMaxWeight = -8; findArcs( T.root, k ); return globalMaxWeight end routine // node = the current node; k = the path length; node.lc = node’s left child; // node.rc = node’s right child; node.idx = node’s index (row) in the matrix; // node.lc.wt/node.rc.wt = weight of the edge to left/right child; routine traverseToFillMatrix( node, k ) if (node == null) return; traverseToFillMatrix(node.lc, k ); // recurse left traverseToFillMatrix(node.rc, k ); // recurse right // in the case that a left/right child doesn’t exist, or both, // let’s assume the code is smart enough to handle these cases matrix[ node.idx ][ 1 ] = max( node.lc.wt, node.rc.wt ); for i = 2 to k { // max returns the heavier of the 2 paths matrix[node.idx][i] = max( matrix[node.lc.idx][i-1] + node.lc.wt, matrix[node.rc.idx][i-1] + node.rc.wt); } end routine // node = the current node, k = the path length routine findArcs( node, k ) if (node == null) return; nodeMax = matrix[node.idx][k]; longPath = path[node.idx][k]; i = 1; j = k-1; while ( i+j == k AND i < k ) { left = node.lc.wt + matrix[node.lc.idx][i-1]; right = node.rc.wt + matrix[node.rc.idx][j-1]; if ( left + right > nodeMax ) { nodeMax = left + right; } i++; j--; } // if this node’s max weight is larger than the global max weight, update if ( globalMaxWeight < nodeMax ) { globalMaxWeight = nodeMax; } findArcs( node.lc, k ); // recurse left findArcs( node.rc, k ); // recurse right end routine Let me know what you think. Feedback is welcome. I think have come up with two naive algorithms that find the heaviest length-constrained path in a weighted Binary Tree. Firstly, the description of the algorithm is as follows: given an n-vertex Binary Tree with weighted edges and some value k, find the heaviest path of length k. For both algorithms, I'll need a reference to all vertices so I'll just do a simple traversal of the Tree to have a reference to all vertices, with each vertex having a reference to its left, right, and parent nodes in the tree. Algorithm 1 For this algorithm, I'm basically planning on running DFS from each node in the Tree, with consideration to the fixed path length. In addition, since the path I'm looking for has the potential of going from left subtree to root to right subtree, I will have to consider 3 choices at each node. But this will result in a O(n*3^k) algorithm and I don't like that. Algorithm 2 I'm essentially thinking about using a modified version of Dijkstra's Algorithm in order to consider a fixed path length. Since I'm looking for heaviest and Dijkstra's Algorithm finds the lightest, I'm planning on negating all edge weights before starting the traversal. Actually... this doesn't make sense since I'd have to run Dijkstra's on each node and that doesn't seem very efficient much better than the above algorithm. So I guess my main questions are several. Firstly, do the algorithms I've described above solve the problem at hand? I'm not totally certain the Dijkstra's version will work as Dijkstra's is meant for positive edge values. Now, I am sure there exist more clever/efficient algorithms for this... what is a better algorithm? I've read about "Using spine decompositions to efficiently solve the length-constrained heaviest path problem for trees" but that is really complicated and I don't understand it at all. Are there other algorithms that tackle this problem, maybe not as efficiently as spine decomposition but easier to understand? Thanks.

    Read the article

  • Choosing a scripting language for game and implementing it

    - by Radius
    Hello, I am currently developing a 3D Action/RPG game in C++, and I would like some advice in choosing a scripting language to program the AI of the game. My team comes from a modding background, and in fact we are still finishing work on a mod of the game Gothic. In that game (which we also got our inspiration from) the language DAEDALUS (created by Piranha Bytes, the makers of the game) is used. Here is a full description of said language. The main thing to notice about this is that it uses instances moreso than classes. The game engine is closed, and so one can only guess about the internal implementation of this language, but the main thing I am looking for in a scripting language (which ideally would be quite similar but preferably also more powerful than DAEDALUS) is the fact that there are de facto 3 'separations' of classes - ie classes, instances and (instances of instances?). I think it will be easier to understand what I want if I provide an example. Take a regular NPC. First of all you have a class defined which (I understand) mirrors the (class or structure) inside the engine: CLASS C_NPC { VAR INT id ; // absolute ID des NPCs VAR STRING name [5] ; // Namen des NPC VAR STRING slot ; VAR INT npcType ; VAR INT flags ; VAR INT attribute [ATR_INDEX_MAX] ; VAR INT protection [PROT_INDEX_MAX]; VAR INT damage [DAM_INDEX_MAX] ; VAR INT damagetype ; VAR INT guild,level ; VAR FUNC mission [MAX_MISSIONS] ; var INT fight_tactic ; VAR INT weapon ; VAR INT voice ; VAR INT voicePitch ; VAR INT bodymass ; VAR FUNC daily_routine ; // Tagesablauf VAR FUNC start_aistate ; // Zustandsgesteuert // ********************** // Spawn // ********************** VAR STRING spawnPoint ; // Beim Tod, wo respawnen ? VAR INT spawnDelay ; // Mit Delay in (Echtzeit)-Sekunden // ********************** // SENSES // ********************** VAR INT senses ; // Sinne VAR INT senses_range ; // Reichweite der Sinne in cm // ********************** // Feel free to use // ********************** VAR INT aivar [50] ; VAR STRING wp ; // ********************** // Experience dependant // ********************** VAR INT exp ; // EXerience Points VAR INT exp_next ; // EXerience Points needed to advance to next level VAR INT lp ; // Learn Points }; Then, you can also define prototypes (which set some default values). But how you actually define an NPC is like this: instance BAU_900_Ricelord (Npc_Default) //Inherit from prototype Npc_Default { //-------- primary data -------- name = "Ryzowy Ksiaze"; npctype = NPCTYPE_GUARD; guild = GIL_BAU; level = 10; voice = 12; id = 900; //-------- abilities -------- attribute[ATR_STRENGTH] = 50; attribute[ATR_DEXTERITY] = 10; attribute[ATR_MANA_MAX] = 0; attribute[ATR_MANA] = 0; attribute[ATR_HITPOINTS_MAX]= 170; attribute[ATR_HITPOINTS] = 170; //-------- visuals -------- // animations Mdl_SetVisual (self,"HUMANS.MDS"); Mdl_ApplyOverlayMds (self,"Humans_Arrogance.mds"); Mdl_ApplyOverlayMds (self,"HUMANS_DZIDA.MDS"); // body mesh ,bdytex,skin,head mesh ,headtex,teethtex,ruestung Mdl_SetVisualBody (self,"Hum_Body_CookSmith",1,1,"Hum_Head_FatBald",91 , 0,-1); B_Scale (self); Mdl_SetModelFatness(self,2); fight_tactic = FAI_HUMAN_STRONG; //-------- Talente -------- Npc_SetTalentSkill (self,NPC_TALENT_1H,1); //-------- inventory -------- CreateInvItems (self, ItFoRice,10); CreateInvItem (self, ItFoWine); CreateInvItems(self, ItMiNugget,40); EquipItem (self, Heerscherstab); EquipItem (self, MOD_AMULETTDESREISLORDS); CreateInvItem (self, ItMi_Alchemy_Moleratlubric_01); //CreateInvItem (self,ItKey_RB_01); EquipItem (self, Ring_des_Lebens); //-------------Daily Routine------------- daily_routine = Rtn_start_900; }; FUNC VOID Rtn_start_900 () { TA_Boss (07,00,20,00,"NC_RICELORD"); TA_SitAround (20,00,24,00,"NC_RICELORD_SIT"); TA_Sleep (24,00,07,00,"NC_RICEBUNKER_10"); }; As you can see, the instance declaration is more like a constructor function, setting values and calling functions from within. This still wouldn't pose THAT much of a problem, if not for one more thing: multiple copies of this instance. For example, you can spawn multiple BAU_900_Ricelord's, and each of them keeps track of its own AI state, hitpoints etc. Now I think the instances are represented as ints (maybe even as the id of the NPC) inside the engine, as whenever (inside the script) you use the expression BAU_900_Ricelord it can be only assigned to an int variable, and most functions that operate on NPCs take that int value. However to directly modify its hitpoints etc you have to do something like var C_NPC npc = GetNPC(Bau_900_Ricelord); npc.attribute[ATR_HITPOINTS] = 10; ie get the actual C_NPC object that represents it. To finally recap - is it possible to get this kind of behaviour in any scripting languages you know of, or am I stuck with having to make my own? Or maybe there is an even better way of representing NPC's and their behaviours that way. The IDEAL language for scripting for me would be C#, as I simply adore that language, but somehow I doubt it is possible or indeed feasible to try and implement a similar kind of behaviour in C#. Many thanks

    Read the article

  • problem processing xml in flex3

    - by john
    Hi All, First time here asking a question and still learning on how to format things better... so sorry about the format as it does not look too well. I have started learning flex and picked up a book and tried to follow the examples in it. However, I got stuck with a problem. I have a jsp page which returns xml which basically have a list of products. I am trying to parse this xml, in other words go through products, and create Objects for each product node and store them in an ArrayCollection. The problem I believe I am having is I am not using the right way of navigating through xml. The xml that is being returned from the server looks like this: <?xml version="1.0" encoding="ISO-8859-1"?><result type="success"> <products> <product> <id>6</id> <cat>electronics</cat> <name>Plasma Television</name> <desc>65 inch screen with 1080p</desc> <price>$3000.0</price> </product> <product> <id>7</id> <cat>electronics</cat> <name>Surround Sound Stereo</name> <desc>7.1 surround sound receiver with wireless speakers</desc> <price>$1000.0</price> </product> <product> <id>8</id> <cat>appliances</cat> <name>Refrigerator</name> <desc>Bottom drawer freezer with water and ice on the door</desc> <price>$1200.0</price> </product> <product> <id>9</id> <cat>appliances</cat> <name>Dishwasher</name> <desc>Large capacity with water saver setting</desc> <price>$500.0</price> </product> <product> <id>10</id> <cat>furniture</cat> <name>Leather Sectional</name> <desc>Plush leather with room for 6 people</desc> <price>$1500.0</price> </product> </products></result> And I have flex code that tries to iterate over products like following: private function productListHandler(e:JavaFlexStoreEvent):void { productData = new ArrayCollection(); trace(JavaServiceHandler(e.currentTarget).response); for each (var item:XML in JavaServiceHandler(e.currentTarget).response..product ) { productData.addItem( { id:item.id, item:item.name, price:item.price, description:item.desc }); } } with trace, I can see the xml being returned from the server. However, I cannot get inside the loop as if the xml was empty. In other words, JavaServiceHandler(e.currentTarget).response..product must be returning nothing. Can someone please help/point out what I could be doing wrong. My JavaServiceHandler class looks like this: package com.wiley.jfib.store.data { import com.wiley.jfib.store.events.JavaFlexStoreEvent; import flash.events.Event; import flash.events.EventDispatcher; import flash.net.URLLoader; import flash.net.URLRequest; public class JavaServiceHandler extends EventDispatcher { public var serviceURL:String = ""; public var response:XML; public function JavaServiceHandler() { } public function callServer():void { if(serviceURL == "") { throw new Error("serviceURL is a required parameter"); return; } var loader:URLLoader = new URLLoader(); loader.addEventListener(Event.COMPLETE, handleResponse); loader.load(new URLRequest(serviceURL)); // var httpService:HTTPService = new HTTPService(); // httpService.url = serviceURL; // httpService.resultFormat = "e4x"; // httpService.addEventListener(Event.COMPLETE, handleResponse); // httpService.send(); } private function handleResponse(e:Event):void { var loader:URLLoader = URLLoader(e.currentTarget); response = XML(loader.data); dispatchEvent(new JavaFlexStoreEvent(JavaFlexStoreEvent.DATA_LOADED) ); // var httpService:HTTPService = HTTPService(e.currentTarget); // response = httpService.lastResult.product; // dispatchEvent(new JavaFlexStoreEvent(JavaFlexStoreEvent.DATA_LOADED) ); } } } Even though I refer to this as mine and it is not in reality. This is from a Flex book as a code sample which does not work, go figure. Any help is appreciated. Thanks john

    Read the article

  • background image not showing in html

    - by Registered User
    I am having following css <!DOCTYPE html > <html> <head> <meta charset="utf-8"> <title>Black Goose Bistro Summer Menu</title> <link href='http://fonts.googleapis.com/css?family=Marko+One' rel='stylesheet' type='text/css'> <style> body { font-family: Georgia, serif; font-size: 100%; line-height: 175%; margin: 0 15% 0; background-image:url(images/bullseye.png); } #header { margin-top: 0; padding: 3em 1em 2em 1em; text-align: center; } a { text-decoration: none; } h1 { font: bold 1.5em Georgia, serif; text-shadow: .1em .1em .2em gray; } h2 { font-size: 1em; text-transform: uppercase; letter-spacing: .5em; text-align: center; } dt { font-weight: bold; } strong { font-style: italic; } ul { list-style-type: none; margin: 0; padding: 0; } #info p { font-style: italic; } .price { font-family: Georgia, serif; font-style: italic; } p.warning, sup { font-size: small; } .label { font-weight: bold; font-variant: small-caps; font-style: normal; } h2 + p { text-align: center; font-style: italic; } ); </style> </head> <body> <div id="header"> <h1>Black Goose Bistro &bull; Summer Menu</h1> <div id="info"> <p>Baker's Corner, Seekonk, Massachusetts<br> <span class="label">Hours: Monday through Thursday:</span> 11 to 9, <span class="label">Friday and Saturday;</span> 11 to midnight</p> <ul> <li><a href="#appetizers">Appetizers</a></li> <li><a href="#entrees">Main Courses</a></li> <li><a href="#toast">Traditional Toasts</a></li> <li><a href="#dessert">Dessert Selection</a></li> </ul> </div> </div> <div id="appetizers"> <h2>Appetizers</h2> <p>This season, we explore the spicy flavors of the southwest in our appetizer collection.</p> <dl> <dt>Black bean purses</dt> <dd>Spicy black bean and a blend of mexican cheeses wrapped in sheets of phyllo and baked until golden. <span class="price">$3.95</span></dd> <dt class="newitem">Southwestern napoleons with lump crab &mdash; <strong>new item!</strong></dt> <dd>Layers of light lump crab meat, bean and corn salsa, and our handmade flour tortillas. <span class="price">$7.95</span></dd> </dl> </div> <div id="entrees"> <h2>Main courses</h2> <p>Big, bold flavors are the name of the game this summer. Allow us to assist you with finding the perfect wine.</p> <dl> <dt class="newitem">Jerk rotisserie chicken with fried plantains &mdash; <strong>new item!</strong></dt> <dd>Tender chicken slow-roasted on the rotisserie, flavored with spicy and fragrant jerk sauce and served with fried plantains and fresh mango. <strong>Very spicy.</strong> <span class="price">$12.95</span></dd> <dt>Shrimp sate kebabs with peanut sauce</dt> <dd>Skewers of shrimp marinated in lemongrass, garlic, and fish sauce then grilled to perfection. Served with spicy peanut sauce and jasmine rice. <span class="price">$12.95</span></dd> <dt>Grilled skirt steak with mushroom fricasee</dt> <dd>Flavorful skirt steak marinated in asian flavors grilled as you like it<sup>*</sup>. Served over a blend of sauteed wild mushrooms with a side of blue cheese mashed potatoes. <span class="price">$16.95</span></dd> </dl> </div> <div id="toast"> <h2>Traditional Toasts</h2> <p>The ultimate comfort food, our traditional toast recipes are adapted from <a href="http://www.gutenberg.org/files/13923/13923-h/13923-h.htm"><cite>The Whitehouse Cookbook</cite></a> published in 1887.</p> <dl> <dt>Cream toast</dt> <dd>Simple cream sauce over highest quality toasted bread, baked daily. <span class="price">$3.95</span></dd> <dt>Mushroom toast</dt> <dd>Layers of light lump crab meat, bean and corn salsa, and our handmade flour tortillas. <span class="price">$6.95</span></dd> <dt>Nun's toast</dt> <dd>Onions and hard-boiled eggs in a cream sauce over buttered hot toast. <span class="price">$6.95</span></dd> <dt>Apple toast</dt> <dd>Sweet, cinnamon stewed apples over delicious buttery grilled bread. <span class="price">$6.95</span></dd> </dl> </div> <div id="dessert"> <h2>Dessert Selection</h2> <p>Be sure to save room for our desserts, made daily by our own <a href="http://www.jwu.edu/college.aspx?id=19510">Johnson & Wales</a> trained pastry chef.</p> <dl> <dt class="newitem">Lemon chiffon cake &mdash; <strong>new item!</strong></dt> <dd>Light and citrus flavored sponge cake with buttercream frosting as light as a cloud. <span class="price">$2.95</span></dd> <dt class="newitem">Molten chocolate cake</dt> <dd>Bubba's special dark chocolate cake with a warm, molten center. Served with or without a splash of almond liqueur. <span class="price">$3.95</span></dd> </dl> </div> <p class="warning"><sup>*</sup> We are required to warn you that undercooked food is a health risk.</p> </body> </html> but the background image does not appear in body tag you can see background-image:url(images/bullseye.png); this html page is bistro.html and the directory in which it is contained there is a folder images and inside images folder I have a file bullseye.png .I expect the png to appear in background.But that does not happen. For sake of question I am posting the image here also Let me know if the syntax of css wrong? following is image http://i.stack.imgur.com/YUKgg.png

    Read the article

  • How should I model the database for this problem? And which ORM can handle it?

    - by Kristof Claes
    I need to build some sort of a custom CMS for a client of ours. These are some of the functional requirements: Must be able to manage the list of Pages in the site Each Page can contain a number of ColumnGroups A ColumnGroup is nothing more than a list of Columns in a certain ColumnGroupLayout. For example: "one column taking up the entire width of the page", "two columns each taking up half of the width", ... Each Column can contain a number ContentBlocks Examples of a ContentBlock are: TextBlock, NewsBlock, PictureBlock, ... ContentBlocks can be given a certain sorting within a Column A ContentBlock can be put in different Columns so that content can be reused without having to be duplicated. My first quick draft of how this could look like in C# code (we're using ASP.NET 4.0 to develop the CMS) can be found at the bottom of my question. One of the technical requirements is that it must be as easy as possible to add new types of ContentBlocks to the CMS. So I would like model everything as flexible as possible. Unfortunately, I'm already stuck at trying to figure out how the database should look like. One of the problems I'm having has to do with sorting different types of ContentBlocks in a Column. I guess each type of ContentBlock (like TextBlock, NewsBlock, PictureBlock, ...) should have it's own table in the database because each has it's own different fields. A TextBlock might only have a field called Text whereas a NewsBlock might have fields for the Text, the Summary, the PublicationDate, ... Since one Column can have ContentBlocks located in different tables, I guess I'll have to create a many-to-many association for each type of ContentBlock. For example: ColumnTextBlocks, ColumnNewsBlocks and ColumnPictureBlocks. The problem I have with this setup is the sorting of the different ContentBlocks in a column. This could be something like this: TextBlock NewsBlock TextBlock TextBlock PictureBlock Where do I store the sorting number? If I store them in the associaton tables, I'll have to update a lot of tables when changing the sorting order of ContentBlocks in a Column. Is this a good approach to the problem? Basically, my question is: What is the best way to model this keeping in mind that it should be easy to add new types of ContentBlocks? My next question is: What ORM can deal with that kind of modeling? To be honest, we are ORM-virgins at work. I have been reading a bit about Linq-to-SQL and NHibernate, but we have no experience with them. Because of the IList in the Column class (see code below) I think we can rule out Linq-to-SQL, right? Can NHibernate handle the mapping of data from many different tables to one IList? Also keep in mind that this is just a very small portion of the domain. Other parts are Users belonging to a certain UserGroup having certain Permissions on Pages, ColumnGroups, Columns and ContentBlocks. The code (just a quick first draft): public class Page { public int PageID { get; set; } public string Title { get; set; } public string Description { get; set; } public string Keywords { get; set; } public IList<ColumnGroup> ColumnGroups { get; set; } } public class ColumnGroup { public enum ColumnGroupLayout { OneColumn, HalfHalf, NarrowWide, WideNarrow } public int ColumnGroupID { get; set; } public ColumnGroupLayout Layout { get; set; } public IList<Column> Columns { get; set; } } public class Column { public int ColumnID { get; set; } public IList<IContentBlock> ContentBlocks { get; set; } } public interface IContentBlock { string GetSummary(); } public class TextBlock : IContentBlock { public string GetSummary() { return "I am a piece of text."; } } public class NewsBlock : IContentBlock { public string GetSummary() { return "I am a news item."; } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • i have made a from and want to connect it to a oracle 10g data base using php.can you please assume

    - by nachiket-panse
    http://www.freecsstemplates.org Released for free under a Creative Commons Attribution 2.5 License -- Sitename.com by Free Css Templates MANAGEMEINT INFORMATION SYSTEM   <p class="style2">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;REGISTRY ENTRY FORM </p> <form id="form2" method="post" action=""> <p align="center">&nbsp;</p> <p align="center"><span class="style3">JOB DESCRIPTION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <textarea name="textarea"></textarea> </p> <p align="center"><span class="style3">QUANTITY :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield5" /> </p> <p align="center">&nbsp;<span class="style3">CONTACT PERSON </span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield3" /> </p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">DIVISION CODE: <textarea name="textarea3"></textarea> </span></p> <p align="center"><span class="style3">ACCEPTANCE DATE </span>: <input type="text" name="textfield4" /> </p> <p align="center"><span class="style3">REFERENCE NUMBER :</span> <input type="text" name="textfield2" /> </p> <p align="center"><span class="style3">CLASSIFICATION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield" /></p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">CUMULATIVE COST: </span> <select name="select"> </select> </p> <p align="center"><span class="style3">PLANNING ENGR: </span> <textarea name="textarea2"></textarea> </p> <p align="center"><span class="style3">PLANNING: </span> <input type="text" name="textfield6" /> </p> <p align="center"> <span class="style3">FILL THE COMPLETION DATE: </span> <input type="text" name="textfield7" /> </p> <p align="center"><span class="style3">REMARKS: </span> <input type="text" name="textfield8" /> </p> <p align="center">&nbsp;</p> <p align="center"> <input type="submit" name="SAVE" value="SAVE" /> <input type="submit" name="Submit2" value="LIST" /> <input type="submit" name="Submit" value="ADD" /> <input type="submit" name="Submit3" value="CANCEL" /> <input type="submit" name="BACK" value="BACK" /></p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> </form> <p align="center" class="style2">&nbsp;</p>

    Read the article

  • Why can I query with an int but not a string here? PHP MySQL Datatypes

    - by CT
    I am working on an Asset Database problem. I receive $id from $_GET["id"]; I then query the database and display the results. This works if my id is an integer like "93650" but if it has other characters like "wci1001", it displays this MySQL error: Unknown column 'text' in 'where clause' All fields in tables are of type: VARCHAR(50) What would I need to do to be able to use this query to search by id that includes other characters? Thank you. <?php <?php /* * ASSET DB FUNCTIONS SCRIPT * */ # connect to database function ConnectDB(){ mysql_connect("localhost", "asset_db", "asset_db") or die(mysql_error()); mysql_select_db("asset_db") or die(mysql_error()); } # find asset type returns $type function GetAssetType($id){ $sql = "SELECT asset.type From asset WHERE asset.id = $id"; $result = mysql_query($sql) or die(mysql_error()); $row = mysql_fetch_assoc($result); $type = $row['type']; return $type; } # query server returns $result (sql query array) function QueryServer($id){ $sql = " SELECT asset.id ,asset.company ,asset.location ,asset.purchaseDate ,asset.purchaseOrder ,asset.value ,asset.type ,asset.notes ,server.manufacturer ,server.model ,server.serialNumber ,server.esc ,server.warranty ,server.user ,server.prevUser ,server.cpu ,server.memory ,server.hardDrive FROM asset LEFT JOIN server ON server.id = asset.id WHERE asset.id = $id "; $result = mysql_query($sql); return $result; } # get server data returns $serverArray function GetServerData($result){ while($row = mysql_fetch_assoc($result)) { $id = $row['id']; $company = $row['company']; $location = $row['location']; $purchaseDate = $row['purchaseDate']; $purchaseOrder = $row['purchaseOrder']; $value = $row['value']; $type = $row['type']; $notes = $row['notes']; $manufacturer = $row['manufacturer']; $model = $row['model']; $serialNumber = $row['serialNumber']; $esc = $row['esc']; $warranty = $row['warranty']; $user = $row['user']; $prevUser = $row['prevUser']; $cpu = $row['cpu']; $memory = $row['memory']; $hardDrive = $row['hardDrive']; $serverArray = array($id, $company, $location, $purchaseDate, $purchaseOrder, $value, $type, $notes, $manufacturer, $model, $serialNumber, $esc, $warranty, $user, $prevUser, $cpu, $memory, $hardDrive); } return $serverArray; } # print server table function PrintServerTable($serverArray){ $id = $serverArray[0]; $company = $serverArray[1]; $location = $serverArray[2]; $purchaseDate = $serverArray[3]; $purchaseOrder = $serverArray[4]; $value = $serverArray[5]; $type = $serverArray[6]; $notes = $serverArray[7]; $manufacturer = $serverArray[8]; $model = $serverArray[9]; $serialNumber = $serverArray[10]; $esc = $serverArray[11]; $warranty = $serverArray[12]; $user = $serverArray[13]; $prevUser = $serverArray[14]; $cpu = $serverArray[15]; $memory = $serverArray[16]; $hardDrive = $serverArray[17]; echo "<table width=\"100%\" border=\"0\"><tr><td style=\"vertical-align:top\"><table width=\"100%\" border=\"0\"><tr><td colspan=\"2\"><h2>General Info</h2></td></tr><tr id=\"hightlight\"><td>Asset ID:</td><td>"; echo $id; echo "</td></tr><tr><td>Company:</td><td>"; echo $company; echo "</td></tr><tr id=\"hightlight\"><td>Location:</td><td>"; echo $location; echo "</td></tr><tr><td>Purchase Date:</td><td>"; echo $purchaseDate; echo "</td></tr><tr id=\"hightlight\"><td>Purchase Order #:</td><td>"; echo $purchaseOrder; echo "</td></tr><tr><td>Value:</td><td>"; echo $value; echo "</td></tr><tr id=\"hightlight\"><td>Type:</td><td>"; echo $type; echo "</td></tr><tr><td>Notes:</td><td>"; echo $notes; echo "</td></tr></table></td><td style=\"vertical-align:top\"><table width=\"100%\" border=\"0\"><tr><td colspan=\"2\"><h2>Server Info</h2></td></tr><tr id=\"hightlight\"><td>Manufacturer:</td><td>"; echo $manufacturer; echo "</td></tr><tr><td>Model:</td><td>"; echo $model; echo "</td></tr><tr id=\"hightlight\"><td>Serial Number:</td><td>"; echo $serialNumber; echo "</td></tr><tr><td>ESC:</td><td>"; echo $esc; echo "</td></tr><tr id=\"hightlight\"><td>Warranty:</td><td>"; echo $warranty; echo "</td></tr><tr><td colspan=\"2\">&nbsp;</td></tr><tr><td colspan=\"2\"><h2>User Info</h2></td></tr><tr id=\"hightlight\"><td>User:</td><td>"; echo $user; echo "</td></tr><tr><td>Previous User:</td><td>"; echo $prevUser; echo "</td></tr></table></td><td style=\"vertical-align:top\"><table width=\"100%\" border=\"0\"><tr><td colspan=\"2\"><h2>Specs</h2></td></tr><tr id=\"hightlight\"><td>CPU:</td><td>"; echo $cpu; echo "</td></tr><tr><td>Memory:</td><td>"; echo $memory; echo "</td></tr><tr id=\"hightlight\"><td>Hard Drive:</td><td>"; echo $hardDrive; echo "</td></tr><tr><td colspan=\"2\">&nbsp;</td></tr><tr><td colspan=\"2\">&nbsp;</td></tr><tr><td colspan=\"2\"><h2>Options</h2></td></tr><tr><td colspan=\"2\"><a href=\"#\">Edit Asset</a></td></tr><tr><td colspan=\"2\"><a href=\"#\">Delete Asset</a></td></tr></table></td></tr></table>"; } ?> __ /* * View Asset * */ # include functions script include "functions.php"; $id = $_GET["id"]; if (empty($id)):$id="000"; endif; ConnectDB(); $type = GetAssetType($id); ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <link rel="stylesheet" type="text/css" href="style.css" /> <title>Wagman IT Asset</title> </head> <body> <div id="page"> <div id="header"> <img src="images/logo.png" /> </div> </div> <div id="content"> <div id="container"> <div id="main"> <div id="menu"> <ul> <table width="100%" border="0"> <tr> <td width="15%"></td> <td width="30%%"><li><a href="index.php">Search Assets</a></li></td> <td width="30%"><li><a href="addAsset.php">Add Asset</a></li></td> <td width="25%"></td> </tr> </table> </ul> </div> <div id="text"> <ul> <li> <h1>View Asset</h1> </li> </ul> <?php if (empty($type)):echo "<ul><li><h2>Asset ID does not match any database entries.</h2></li></ul>"; else: switch ($type){ case "Server": $result = QueryServer($id); $ServerArray = GetServerData($result); PrintServerTable($ServerArray); break; case "Desktop"; break; case "Laptop"; break; } endif; ?> </div> </div> </div> <div class="clear"></div> <div id="footer" align="center"> <p>&nbsp;</p> </div> </div> <div id="tagline"> Wagman Construction - Bridging Generations since 1902 </div> </body> </html>

    Read the article

  • Windows-1251 file inside UTF-8 site?

    - by Spoonk
    Hello everyone Masters Of Web Delevopment :) I have a piece of PHP script that fetches last 10 played songs from my winamp. This script is inside file (lets call it "lastplayed.php") which is included in my site with php include function inside a "div". My site is on UTF-8 encoding. The problem is that some songs titles are in Windows-1251 encoding. And in my site they displays like "??????"... Is there any known way to tell to this div with included "lastplayed.php" in it, to be with windows-1251 encoding? Or any other suggestions? P.S: The file with fetching script a.k.a. "lastplayed.php", is converted to UTF-8. But if it is ANCII it's the same result. I try to put and meta tag with windows-1251 between head tag but nothing happens again. P.P.S: Script that fetches the Winamp's data (lastplayed.php): <?php /****** * You may use and/or modify this script as long as you: * 1. Keep my name & webpage mentioned * 2. Don't use it for commercial purposes * * If you want to use this script without complying to the rules above, please contact me first at: [email protected] * * Author: Martijn Korse * Website: http://devshed.excudo.net * * Date: 08-05-2006 ***/ /** * version 2.0 */ class Radio { var $fields = array(); var $fieldsDefaults = array("Server Status", "Stream Status", "Listener Peak", "Average Listen Time", "Stream Title", "Content Type", "Stream Genre", "Stream URL", "Current Song"); var $very_first_str; var $domain, $port, $path; var $errno, $errstr; var $trackLists = array(); var $isShoutcast; var $nonShoutcastData = array( "Server Status" => "n/a", "Stream Status" => "n/a", "Listener Peak" => "n/a", "Average Listen Time" => "n/a", "Stream Title" => "n/a", "Content Type" => "n/a", "Stream Genre" => "n/a", "Stream URL" => "n/a", "Stream AIM" => "n/a", "Stream IRC" => "n/a", "Current Song" => "n/a" ); var $altServer = False; function Radio($url) { $parsed_url = parse_url($url); $this->domain = isset($parsed_url['host']) ? $parsed_url['host'] : ""; $this->port = !isset($parsed_url['port']) || empty($parsed_url['port']) ? "80" : $parsed_url['port']; $this->path = empty($parsed_url['path']) ? "/" : $parsed_url['path']; if (empty($this->domain)) { $this->domain = $this->path; $this->path = ""; } $this->setOffset("Current Stream Information"); $this->setFields(); // setting default fields $this->setTableStart("<table border=0 cellpadding=2 cellspacing=2>"); $this->setTableEnd("</table>"); } function setFields($array=False) { if (!$array) $this->fields = $this->fieldsDefaults; else $this->fields = $array; } function setOffset($string) { $this->very_first_str = $string; } function setTableStart($string) { $this->tableStart = $string; } function setTableEnd($string) { $this->tableEnd = $string; } function getHTML($page=False) { if (!$page) $page = $this->path; $contents = ""; $domain = (substr($this->domain, 0, 7) == "http://") ? substr($this->domain, 7) : $this->domain; if (@$fp = fsockopen($domain, $this->port, $this->errno, $this->errstr, 2)) { fputs($fp, "GET ".$page." HTTP/1.1\r\n". "User-Agent: Mozilla/4.0 (compatible; MSIE 5.5; Windows 98)\r\n". "Accept: */*\r\n". "Host: ".$domain."\r\n\r\n"); $c = 0; while (!feof($fp) && $c <= 20) { $contents .= fgets($fp, 4096); $c++; } fclose ($fp); preg_match("/(Content-Type:)(.*)/i", $contents, $matches); if (count($matches) > 0) { $contentType = trim($matches[2]); if ($contentType == "text/html") { $this->isShoutcast = True; return $contents; } else { $this->isShoutcast = False; $htmlContent = substr($contents, 0, strpos($contents, "\r\n\r\n")); $dataStr = str_replace("\r", "\n", str_replace("\r\n", "\n", $contents)); $lines = explode("\n", $dataStr); foreach ($lines AS $line) { if ($dp = strpos($line, ":")) { $key = substr($line, 0, $dp); $value = trim(substr($line, ($dp+1))); if (preg_match("/genre/i", $key)) $this->nonShoutcastData['Stream Genre'] = $value; if (preg_match("/name/i", $key)) $this->nonShoutcastData['Stream Title'] = $value; if (preg_match("/url/i", $key)) $this->nonShoutcastData['Stream URL'] = $value; if (preg_match("/content-type/i", $key)) $this->nonShoutcastData['Content Type'] = $value; if (preg_match("/icy-br/i", $key)) $this->nonShoutcastData['Stream Status'] = "Stream is up at ".$value."kbps"; if (preg_match("/icy-notice2/i", $key)) { $this->nonShoutcastData['Server Status'] = "This is <span style=\"color: red;\">not</span> a Shoutcast server!"; if (preg_match("/ultravox/i", $value)) $this->nonShoutcastData['Server Status'] .= " But an <a href=\"http://ultravox.aol.com/\" target=\"_blank\">Ultravox</a> Server"; $this->altServer = $value; } } } return nl2br($htmlContent); } } else return $contents; } else { return False; } } function getServerInfo($display_array=null, $very_first_str=null) { if (!isset($display_array)) $display_array = $this->fields; if (!isset($very_first_str)) $very_first_str = $this->very_first_str; if ($html = $this->getHTML()) { // parsing the contents $data = array(); foreach ($display_array AS $key => $item) { if ($this->isShoutcast) { $very_first_pos = stripos($html, $very_first_str); $first_pos = stripos($html, $item, $very_first_pos); $line_start = strpos($html, "<td>", $first_pos); $line_end = strpos($html, "</td>", $line_start) + 4; $difference = $line_end - $line_start; $line = substr($html, $line_start, $difference); $data[$key] = strip_tags($line); } else { $data[$key] = $this->nonShoutcastData[$item]; } } return $data; } else { return $this->errstr." (".$this->errno.")"; } } function createHistoryArray($page) { if (!in_array($page, $this->trackLists)) { $this->trackLists[] = $page; if ($html = $this->getHTML($page)) { $fromPos = stripos($html, $this->tableStart); $toPos = stripos($html, $this->tableEnd, $fromPos); $tableData = substr($html, $fromPos, ($toPos-$fromPos)); $lines = explode("</tr><tr>", $tableData); $tracks = array(); $c = 0; foreach ($lines AS $line) { $info = explode ("</td><td>", $line); $time = trim(strip_tags($info[0])); if (substr($time, 0, 9) != "Copyright" && !preg_match("/Tag Loomis, Tom Pepper and Justin Frankel/i", $info[1])) { $this->tracks[$c]['time'] = $time; $this->tracks[$c++]['track'] = trim(strip_tags($info[1])); } } if (count($this->tracks) > 0) { unset($this->tracks[0]); if (isset($this->tracks[1])) $this->tracks[1]['track'] = str_replace("Current Song", "", $this->tracks[1]['track']); } } else { $this->tracks[0] = array("time"=>$this->errno, "track"=>$this->errstr); } } } function getHistoryArray($page="/played.html") { if (!in_array($page, $this->trackLists)) $this->createHistoryArray($page); return $this->tracks; } function getHistoryTable($page="/played.html", $trackColText=False, $class=False) { $title_utf8 = mb_convert_encoding($trackArr ,"utf-8" ,"auto"); if (!in_array($page, $this->trackLists)) $this->createHistoryArray($page); if ($trackColText) $output .= " <div class='lastplayed_top'></div> <div".($class ? " class=\"".$class."\"" : "").">"; foreach ($this->tracks AS $title_utf8) $output .= "<div style='padding:2px 0;'>".$title_utf8['track']."</div>"; $output .= "</div><div class='lastplayed_bottom'></div> <div class='lastplayed_title'>".$trackColText."</div> \n"; return $output; } } // this is needed for those with a php version < 5 // the function is copied from the user comments @ php.net (http://nl3.php.net/stripos) if (!function_exists("stripos")) { function stripos($haystack, $needle, $offset=0) { return strpos(strtoupper($haystack), strtoupper($needle), $offset); } } ?> And the calling script outside the lastplayed.php: include "lastplayed.php"; $radio = new Radio($ip.":".$port); echo $radio->getHistoryTable("/played.html", "<b>Last played:</b>", "lastplayed_content");

    Read the article

  • Check on every page to ensure user has validated as being over 18

    - by liquilife
    Hi Guys and Girls. I'm working on a website (tobacco related) that requires all visitors to validate they are over 18 before they can view the site. I have a form in place that validates the age but I'm at a dead end. How can I use this to store a cookie that they've passed the test and do a check on all pages to see if this check has already been passed or not? Any suggestions and help would be hugely appreciated! Below is my validation form: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title>Validate</title> <script type="text/javascript" src="http://jqueryjs.googlecode.com/files/jquery-1.3.2.js"></script> <script language="javascript"> function checkAge() { var min_age = 18; var year = parseInt(document.forms["age_form"]["year"].value); var month = parseInt(document.forms["age_form"]["month"].value) - 1; var day = parseInt(document.forms["age_form"]["day"].value); var theirDate = new Date((year + min_age), month, day); var today = new Date; if ( (today.getTime() - theirDate.getTime()) < 0) { alert("You are too young to enter this site!"); return false; } else { return true; } } </script> </head> <body> <form action="index.html" name="age_form" method="get" id="age_form"> <select name="day" id="day"> <option value="0" selected>DAY</option> <option value="1">1</option> <option value="2">2</option> <option value="3">3</option> <option value="4">4</option> <option value="5">5</option> <option value="6">6</option> <option value="7">7</option> <option value="8">8</option> <option value="9">9</option> <option value="10">10</option> <option value="11">11</option> <option value="12">12</option> <option value="13">13</option> <option value="14">14</option> <option value="15">15</option> <option value="16">16</option> <option value="17">17</option> <option value="18">18</option> <option value="19">19</option> <option value="20">20</option> <option value="21">21</option> <option value="22">22</option> <option value="23">23</option> <option value="24">24</option> <option value="25">25</option> <option value="26">26</option> <option value="27">27</option> <option value="28">28</option> <option value="29">29</option> <option value="30">30</option> <option value="31">31</option> </select> <select name="month" id="month"> <option value="0" selected>MONTH</option> <option value="1">January</option> <option value="2">February</option> <option value="3">March</option> <option value="4">April</option> <option value="5">May</option> <option value="6">June</option> <option value="7">July</option> <option value="8">August</option> <option value="9">September</option> <option value="10">October</option> <option value="11">November</option> <option value="12">December</option> </select> <select name="year" id="year"> <option value="0" selected>YEAR</option> <option value="1920">1920</option> <option value="1921">1921</option> <option value="1922">1922</option> <option value="1923">1923</option> <option value="1924">1924</option> <option value="1925">1925</option> <option value="1926">1926</option> <option value="1927">1927</option> <option value="1928">1928</option> <option value="1929">1929</option> <option value="1930">1930</option> <option value="1931">1931</option> <option value="1932">1932</option> <option value="1933">1933</option> <option value="1934">1934</option> <option value="1935">1935</option> <option value="1936">1936</option> <option value="1937">1937</option> <option value="1938">1938</option> <option value="1939">1939</option> <option value="1940">1940</option> <option value="1941">1941</option> <option value="1942">1942</option> <option value="1943">1943</option> <option value="1944">1944</option> <option value="1945">1945</option> <option value="1946">1946</option> <option value="1947">1947</option> <option value="1948">1948</option> <option value="1949">1949</option> <option value="1950">1950</option> <option value="1951">1951</option> <option value="1952">1952</option> <option value="1953">1953</option> <option value="1954">1954</option> <option value="1955">1955</option> <option value="1956">1956</option> <option value="1957">1957</option> <option value="1958">1958</option> <option value="1959">1959</option> <option value="1960">1960</option> <option value="1961">1961</option> <option value="1962">1962</option> <option value="1963">1963</option> <option value="1964">1964</option> <option value="1965">1965</option> <option value="1966">1966</option> <option value="1967">1967</option> <option value="1968">1968</option> <option value="1969">1969</option> <option value="1970">1970</option> <option value="1971">1971</option> <option value="1972">1972</option> <option value="1973">1973</option> <option value="1974">1974</option> <option value="1975">1975</option> <option value="1976">1976</option> <option value="1977">1977</option> <option value="1978">1978</option> <option value="1979">1979</option> <option value="1980">1980</option> <option value="1981">1981</option> <option value="1982">1982</option> <option value="1983">1983</option> <option value="1984">1984</option> <option value="1985">1985</option> <option value="1986">1986</option> <option value="1987">1987</option> <option value="1988">1988</option> <option value="1989">1989</option> <option value="1990">1990</option> <option value="1991">1991</option> <option value="1992">1992</option> <option value="1993">1993</option> <option value="1994">1994</option> <option value="1995">1995</option> <option value="1996">1996</option> <option value="1997">1997</option> <option value="1998">1998</option> <option value="1999">1999</option> </select> </form> </body> </html>

    Read the article

  • Multiplying values using javascript

    - by DAFFODIL
    i have used js to multiply but only 1st row is getting multiplied other rows are nt getting multiplied. <?php $con = mysql_connect("localhost","root",""); if (!$con) { die('Could not connect: ' . mysql_error()); } mysql_select_db("form1", $con); error_reporting(E_ALL ^ E_NOTICE); $nam=$_REQUEST['select1']; $row=mysql_query("select * from inv where name='$nam'"); while($row1=mysql_fetch_array($row)) { $Name=$row1['Name']; $Address =$row1['Address']; $City=$row1['City']; $Pincode=$row1['Pincode']; $No=$row1['No']; $Date=$row1['Date']; $DCNo=$row1['DCNo']; $DcDate=$row1['DcDate']; $YourOrderNo=$row1['YourOrderNo']; $OrderDate=$row1['OrderDate']; $VendorCode=$row1['VendorCode']; $SNo=$row1['SNo']; $descofgoods=$row1['descofgoods']; $Qty=$row1['Qty']; $Rate=$row1['Rate']; $Amount=$row1['Amount']; } ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title>Untitled Document</title> <script type="text/javascript"> **function ram() { var q=document.getElementById('qty').value; var r=document.getElementById('rate').value; document.getElementById('amt').value=q*r; }** </script> </head> <body> <form id="form1" name="form1" method="post" action=""> <table width="1315" border="0"> <script type="text/javascript"> function g() { form1.submit(); } </script> <tr> <th>Name</th> <th align="left"><select name="select1" onchange="g();"> <option value="" selected="selected">select</option> <?php $row=mysql_query("select Name from inv "); while($row1=mysql_fetch_array($row)) { ?> <option value="<?php echo $row1['Name'];?>"><?php echo $row1['Name'];?></option> <?php } ?> </select></th> </tr> <tr> <th>Address</th> <th align="left"><textarea name="Address"><?php echo $Address;?></textarea></th> </tr> <tr> <th>City</th> <th align="left"><input type="text" name="City" value='<?php echo $City;?>' /></th> </tr> <tr> <th>Pincode</th> <th align="left"><input type="text" name="Pincode" value='<?php echo $Pincode;?>'></th> </tr> <tr> <th>No</th> <th align="left"><input type="text" name="No2" value='<?php echo $No;?>' readonly="" /></th> </tr> <tr> <th>Date</th> <th align="left"><input type="text" name="Date" value='<?php echo $Date;?>' readonly="" /></th> </tr> <tr> <th>DCNo</th> <th align="left"><input type="text" name="DCNo" value='<?php echo $DCNo;?>' readonly="" /></th> </tr> <tr> <th>DcDate:</th> <th align="left"><input type="text" name="DcDate" value='<?php echo $DcDate;?>' /></th> </tr> <tr> <th>YourOrderNo</th> <th align="left"><input type="text" name="YourOrderNo" value='<?php echo $YourOrderNo;?>' readonly="" /></th> </tr> <tr> <th>OrderDate</th> <th align="left"><input type="text" name="OrderDate" value='<?php echo $OrderDate;?>' readonly="" /></th> </tr> <tr> <th width="80">VendorCode</th> <th width="1225" align="left"><input type="text" name="VendorCode" value='<?php echo $VendorCode;?>' readonly="" /></th> </tr> </table> <table width="1313" border="0"> <tr> <td width="44">&nbsp;</td> <td width="71">SNO</td> <td width="527">DESCRIPTION</td> <td width="214">QUANTITY</td> <td width="214">RATE/UNIT</td> <td width="217">AMOUNT</td> </tr> <?php $i=1; $row=mysql_query("select * from inv where Name='$nam'"); while($row1=mysql_fetch_array($row)) { $descofgoods=$row1['descofgoods']; $Qty=$row1['Qty']; $Rate=$row1['Rate']; $Amount=$row1['Amount']; ?> <tr> <td><input type="checkbox" name="checkbox" value="checkbox" /></td> <td><input type="text" name="No" value='<?php echo $No;?>' readonly=""/></td> <td><input type="text" name="descofgoods" value='<?php echo $descofgoods;?>' /></td> <td><input type="text" name="qty" maxlength="50000000" id="qty"/></td> <td><input type="text" name="Rate" value='<?php echo $Rate;?>' id="rate" onclick="ram()";></td> <td><input type="text" name="Amount" id="amt"/></td> </tr> <?php $i++;} ?> <tr> <th colspan="2"><a href="pp.php?msg=<?php echo $nam;?>">Print</a></th> </tr> </table> <label></label> </form> </body> </html>

    Read the article

  • Help needed on an SQL configuration problem.

    - by user321048
    I have been banging my head with this one more the two weeks, and still don't know what the problem is ( I can't narrow it down). The problem is the following. I have a solution with 3 project in it all written in c# and I with LINQ. One project is the main web site, the other is the data layer (communication with the database) and the third one is a custom little CMS. The problem is the following: On a hosting provider when I publish the site it all works perfectly, but this site was needed to be hosted on the client server so I needed to do that. But the problem is that I also needed to configure the client server, because they don't have an Administrator employed (I know, I know ;) ). For the first time I some how managed, to set it up but a problem appear. My main web site is working just as it suppose to be - it reads (communicates with) the database, but My CMS is not. It shows the first log in page, but after that when I try to log in it throws the following error: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4846887 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4860189 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Data.Linq.SqlClient.SqlConnectionManager.UseConnection(IConnectionUser user) +44 System.Data.Linq.SqlClient.SqlProvider.get_IsSqlCe() +45 System.Data.Linq.SqlClient.SqlProvider.InitializeProviderMode() +20 System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) +57 System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute(Expression expression) +23 System.Linq.Queryable.Count(IQueryable`1 source) +240 CMS.Security.UserProfile.LoginUser() in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Classes\UserProfile.cs:132 CMS.Default.Login1_Authenticate(Object sender, AuthenticateEventArgs e) in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Default.aspx.cs:37 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +108 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 Maybe this is a dumb question, but I cannot find the root of the problem, let alone the solution. So far I have tried the following: -setting time out on connection string to a higher value -configuration and after that turning off server firewall -checking the connection string over and over again (they are the same for all three projects and are saved in web.config) Important notes: I have tried executing the project from VS2008 with a connection string to the same database and the results are the same. That's why I think the problem is the SQL Server 2005 and not the IIS7. Any bit of information is more then welcomed.

    Read the article

  • drop down and post data to data base

    - by DAFFODIL
    This is a form which retrieves data from db and displays them in table. At the beginning of each row there will be a check box. If there are 10 rows fetched, I ii check 5 rows and insert them in to diff db but here when, I click drop down box data is getting in to db automatically,bcoz I use onchange event. Any alternative to prevent this to happen. Data should be inserted only when, I click submit button. Any help will be appreciated <?php $con = mysql_connect("localhost","root",""); if (!$con) { die('Could not connect: ' . mysql_error()); } mysql_select_db("form1", $con); error_reporting(E_ALL ^ E_NOTICE); $nam=$_REQUEST['select1']; $row=mysql_query("select * from inv where name='$nam'"); while($row1=mysql_fetch_array($row)) { $Name=$row1['Name']; $Address =$row1['Address']; $City=$row1['City']; $Pincode=$row1['Pincode']; $No=$row1['No']; $Date=$row1['Date']; $DCNo=$row1['DCNo']; $DcDate=$row1['DcDate']; $YourOrderNo=$row1['YourOrderNo']; $OrderDate=$row1['OrderDate']; $VendorCode=$row1['VendorCode']; $SNo=$row1['SNo']; $descofgoods=$row1['descofgoods']; $Qty=$row1['Qty']; $Rate=$row1['Rate']; $Amount=$row1['Amount']; } ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title>Untitled Document</title> <script type="text/javascript"> function ram(id) { var q=document.getElementById('qty_'+id).value; var r=document.getElementById('rate_'+id).value; document.getElementById('amt_'+id).value=q*r; } </script> </head> <body> <form id="form1" name="form1" method="post" action=""> <table width="1315" border="0"> <script type="text/javascript"> function g() { form1.submit(); } </script> <tr> <th>Name</th> <th align="left"><select name="select1" onchange="g();"> <option value="" selected="selected">select</option> <?php $row=mysql_query("select Name from inv "); while($row1=mysql_fetch_array($row)) { ?> <option value="<?php echo $row1['Name'];?>"><?php echo $row1['Name'];?></option> <?php } ?> </select></th> </tr> <tr> <th>Address</th> <th align="left"><textarea name="Address"><?php echo $Address;?></textarea></th> </tr> <tr> <th>City</th> <th align="left"><input type="text" name="City" value='<?php echo $City;?>' /></th> </tr> <tr> <th>Pincode</th> <th align="left"><input type="text" name="Pincode" value='<?php echo $Pincode;?>'></th> </tr> <tr> <th>No</th> <th align="left"><input type="text" name="No2" value='<?php echo $No;?>' readonly="" /></th> </tr> <tr> <th>Date</th> <th align="left"><input type="text" name="Date" value='<?php echo $Date;?>' /></th> </tr> <tr> <th>DCNo</th> <th align="left"><input type="text" name="DCNo" value='<?php echo $DCNo;?>' readonly="" /></th> </tr> <tr> <th>DcDate:</th> <th align="left"><input type="text" name="DcDate" value='<?php echo $DcDate;?>' /></th> </tr> <tr> <th>YourOrderNo</th> <th align="left"><input type="text" name="YourOrderNo" value='<?php echo $YourOrderNo;?>' readonly="" /></th> </tr> <tr> <th>OrderDate</th> <th align="left"><input type="text" name="OrderDate" value='<?php echo $OrderDate;?>' /></th> </tr> <tr> <th width="80">VendorCode</th> <th width="1225" align="left"><input type="text" name="VendorCode" value='<?php echo $VendorCode;?>' readonly="" /></th> </tr> </table> <table width="1313" border="0"> <tr> <td width="44">&nbsp;</td> <td width="71">SNO</td> <td width="527">DESCRIPTION</td> <td width="214">QUANTITY</td> <td width="214">RATE/UNIT</td> <td width="217">AMOUNT</td> </tr> <?php $i=1; $row=mysql_query("select * from inv where Name='$nam'"); while($row1=mysql_fetch_array($row)) { $SNo=$row1['SNo']; $descofgoods=$row1['descofgoods']; $Qty=$row1['Qty']; $Rate=$row1['Rate']; $Amount=$row1['Amount']; ?> <tr> <td><input type="checkbox" name="checkbox" value="checkbox" checked="checked"/></td> <td><input type="text" name="No[<?php echo $i?>]" value='<?php echo $SNo;?>' readonly=""/></td> <td><input type="text" name="descofgoods[<?php echo $i?>]" value='<?php echo $descofgoods;?>' /></td> <td><input type="text" name="qty[<?php echo $i?>]" maxlength="50000000" id="qty_<?PHP echo($i) ?>"/></td> <td><input type="text" name="Rate[<?php echo $i?>]" value='<?php echo $Rate;?>' id="rate_<?PHP echo($i) ?>" onclick="ram('<?PHP echo($i) ?>')";></td> <td><input type="text" name="Amount[<?php echo $i?>]" id="amt_<?PHP echo($i) ?>"/></td> </tr> <?php $i++;} ?> <tr> <td><input type="submit" value="submit" header("location:values to be brought for print page.php");/></td> </tr> </table> <label></label> </form> </body> </html> <?php /*error_reporting(E_ALL ^ E_NOTICE); $con = mysql_connect("localhost","root",""); if (!$con) { die('Could not connect: ' . mysql_error()); } mysql_select_db("form1", $con); /*if(checked=checkbox) { mysql_query="INSERT INTO invo (Name, Address, City, Pincode, No, Date, DCNo, DcDate, YourOrderNo, OrderDate, VendorCode, SNo, descofgoods, Qty, Rate, Amount) VALUES ('$_POST[Name]','$_POST[Address]','$_POST[City]','$_POST[Pincode]','$_POST[No]','$_POST[Date]','$_POST[DCNo]','$_POST[DcDate]','$_POST[YourOrderNo]','$_POST[OrderDate]','$_POST[VendorCode]','$_POST[SNo]','$_POST[descofgoods]','$_POST[qty]','$_POST[Rate]','$_POST[Amount]')"; } else { header("location:values to be brought for print page.php"); }*/ header("ins.php"); ?>

    Read the article

  • (C++) Linking with namespaces causes duplicate symbol error

    - by user577072
    Hello. For the past few days, I have been trying to figure out how to link the files for a CLI gaming project I have been working on. There are two halves of the project, the Client and the Server code. The client needs two libraries I've made. The first is a general purpose game board. This is split between GameEngine.h and GameEngine.cpp. The header file looks something like this namespace gfdGaming { // struct sqr_size { // Index x; // Index y; // }; typedef struct { Index x, y; } sqr_size; const sqr_size sPos = {1, 1}; sqr_size sqr(Index x, Index y); sqr_size ePos; class board { // Prototypes / declarations for the class } } And the CPP file is just giving everything content #include "GameEngine.h" type gfdGaming::board::functions The client also has game-specific code (in this case, TicTacToe) split into declarations and definitions (TTT.h, Client.cpp). TTT.h is basically #include "GameEngine.h" #define TTTtar "localhost" #define TTTport 2886 using namespace gfdGaming; void* turnHandler(void*); namespace nsTicTacToe { GFDCON gfd; const char X = 'X'; const char O = 'O'; string MPhostname, mySID; board TTTboard; bool PlayerIsX = true, isMyTurn; char Player = X, Player2 = O; int recon(string* datHolder = NULL, bool force = false); void initMP(bool create = false, string hn = TTTtar); void init(); bool isTie(); int turnPlayer(Index loc, char lSym = Player); bool checkWin(char sym = Player); int mainloop(); int mainloopMP(); }; // NS I made the decision to put this in a namespace to group it instead of a class because there are some parts that would not work well in OOP, and it's much easier to implement later on. I have had trouble linking the client in the past, but this setup seems to work. My server is also split into two files, Server.h and Server.cpp. Server.h contains exactly: #include "../TicTacToe/TTT.h" // Server needs a full copy of TicTacToe code class TTTserv; struct TTTachievement_requirement { Index id; Index loc; bool inUse; }; struct TTTachievement_t { Index id; bool achieved; bool AND, inSameGame; bool inUse; bool (*lHandler)(TTTserv*); char mustBeSym; int mustBePlayer; string name, description; TTTachievement_requirement steps[safearray(8*8)]; }; class achievement_core_t : public GfdOogleTech { public: // May be shifted to private TTTachievement_t list[safearray(8*8)]; public: achievement_core_t(); int insert(string name, string d, bool samegame, bool lAnd, int lSteps[8*8], int mbP=0, char mbS=0); }; struct TTTplayer_t { Index id; bool inUse; string ip, sessionID; char sym; int desc; TTTachievement_t Ding[8*8]; }; struct TTTgame_t { TTTplayer_t Player[safearray(2)]; TTTplayer_t Spectator; achievement_core_t achievement_core; Index cTurn, players; port_t roomLoc; bool inGame, Xused, Oused, newEvent; }; class TTTserv : public gSserver { TTTgame_t Game; TTTplayer_t *cPlayer; port_t conPort; public: achievement_core_t *achiev; thread threads[8]; int parseit(string tDat, string tsIP); Index conCount; int parseit(string tDat, int tlUser, TTTplayer_t** retval); private: int parseProto(string dat, string sIP); int parseProto(string dat, int lUser); int cycleTurn(); void setup(port_t lPort = 0, bool complete = false); public: int newEvent; TTTserv(port_t tlPort = TTTport, bool tcomplete = true); TTTplayer_t* userDC(Index id, Index force = false); int sendToPlayers(string dat, bool asMSG = false); int mainLoop(volatile bool *play); }; // Other void* userHandler(void*); void* handleUser(void*); And in the CPP file I include Server.h and provide main() and the contents of all functions previously declared. Now to the problem at hand I am having issues when linking my server. More specifically, I get a duplicate symbol error for every variable in nsTicTacToe (and possibly in gfdGaming as well). Since I need the TicTacToe functions, I link Client.cpp ( without main() ) when building the server ld: duplicate symbol nsTicTacToe::PlayerIsX in Client.o and Server.o collect2: ld returned 1 exit status Command /Developer/usr/bin/g++-4.2 failed with exit code 1 It stops once a problem is encountered, but if PlayerIsX is removed / changed temporarily than another variable causes an error Essentially, I am looking for any advice on how to better organize my code to hopefully fix these errors. Disclaimers: -I apologize in advance if I provided too much or too little information, as it is my first time posting -I have tried using static and extern to fix these problems, but apparently those are not what I need Thank you to anyone who takes the time to read all of this and respond =)

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • PHP self form validation

    - by Jordan Pagaduan
    <?php function VerifyForm(&$values, &$errors) { if (strlen($values['fname']) == 0) $errors['fname'] = 'Enter First Name'; if (strlen($values['lname']) == 0) $errors['lname'] = 'Enter Last Name'; if (strlen($values['mname']) == 0) $errors['mname'] = 'Enter Middle Name'; if (strlen($values['address']) == 0) $errors['address'] = 'Enter Address'; if (strlen($values['terms']) == 0) $errors['terms'] = 'Please Read Terms and Agreement and Check the box.'; if (!ereg('.*@.*\..{2,4}', $values['email'])) $errors['email'] = 'Email address invalid'; else if (strlen($values['email']) < 0) $errors['email'] = 'Enter Email Address'; return (count($errors) == 0); } function DisplayForm($values, $errors) { ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>GIA Soap » Products » Customer Informations</title> <link href="stylesheet/style.css" rel="stylesheet" type="text/css" /> <script type="text/javascript" src="js_files/jquery.js"></script> <script type="text/javascript" src="js_files/sliding_effect.js"></script> <script type="text/javascript" src="js_files/slideshow.js"></script> </head> <body> <div class="bg_top"> <div class="bg_bottom"> <div class="wrapper"> <div class="header"> <div class="logo"> </div> <div class="logo_text"> <div class="logo_head_text">Gia Soap Making</div> <div class="logo_sub_text">Sub text here</div> </div> </div> <div class="h_nav"> <div class="h_nav_dash"> </div> </div> <div class="container"> <div class="content_term"> <div class="content_terms"> <br /> <h1><p>Customer Information</p></h1><br /> <p>Please the following correctly.</p> <div class="customer_info"> <?php if (count($errors) > 0) echo "<p>There were some errors in your submitted form, please correct them and try again.</p>"; ?> <form method="post" action="<?= $_SERVER['PHP_SELF'] ?>"> <!-- hidden values --> <input type="hidden" value="<?php echo $papaya; ?>" name="papaya" /> <input type="hidden" value="<?php echo $carrot; ?>" name="carrot" /> <input type="hidden" value="<?php echo $guava; ?>" name="guava" /> <label for="customer_fname">First Name (<i>Required</i>)</label> <input type="text" class="textbox" id="customer_fname" name="customer_fname" value="<?= htmlentities($values['fname']) ?>" /> <span class="error_msg"><?= $errors['fname'] ?></span> <label for="customer_lname">Last Name (<i>Required</i>)</label> <input type="text" class="textbox" id="customer_fname" name="customer_fname" value="<?= htmlentities($values['lname']) ?>" /> <span class="error_msg"><?= $errors['lname'] ?></span> <label for="customer_mname">Middle Name (<i>Required</i>)</label> <input type="text" class="textbox" id="customer_fname" name="customer_fname" value="<?= htmlentities($values['mname']) ?>" /> <span class="error_msg"><?= $errors['mname'] ?></span> <label for="customer_add">Address (<i>Required : Complete Address Please</i>)</label> <input type="text" class="textbox" id="customer_add" name="customer_add1" value="<?= htmlentities($values['address']) ?>" /><br /> <input type="text" class="textbox" id="customer_add" name="customer_add2" /><br /> <input type="text" class="textbox" id="customer_add" name="customer_add3" /> <span class="error_msg"><?= $errors['address'] ?></span> <label for="customer_email">Email Address (<i>Required</i>)</label> <input type="text" class="textbox" id="customer_email" name="customer_email" value="<?= htmlentities($values['email']) ?>" /> <span class="error_msg"><?= $errors['email'] ?></span> <label for="customer_phone">Phone Number </label> <input type="text" class="textbox" id="customer_phone" name="customer_phone" /> <label for="customer_mobile">Mobile Number </label> <input type="text" class="textbox" id="customer_mobile" name="customer_mobile" /> <br /><br /> <div class="terms"> <center> <h1>Terms and Agreement</h1><br /> <p>Please read the following.</p><br /> </div> <br /> <input type="checkbox" name="terms" value="<?= htmlentities($values['terms']) ?>" /> I Read the Terms and Agreement<br /><br /> <span class="error_msg"><?= $errors['terms'] ?></span> <input type="submit" value="Send Order" class="prod_subbtn" /> </center> </form> </div> </div> </div> <div class="clear"></div> </div> <?php include ('includes/footer.php'); ?> </div> </div> </div> </body> </html> <?php } function ProcessForm($values) { $papaya = $_POST['papaya']; $carrot = $_POST['carrot']; $guava = $_POST['guava']; $fname = $_POST['fname']; $lname = $_POST['lname']; $mname = $_POST['mname']; $address = $_POST['address']; } if ($_SERVER['REQUEST_METHOD'] == 'POST') { $formValues = $_POST; $formErrors = array(); if (!VerifyForm($formValues, $formErrors)) DisplayForm($formValues, $formErrors); else ProcessForm($formValues); } else DisplayForm(null, null); ?> The output is: [link text]1 Problem the value that I put is can be seen by users.

    Read the article

  • WPF Some styles not applied on DataTemplate controls

    - by Martin
    Hi, I am trying to learn something about WPF and I am quite amazed by its flexibility. However, I have hit a problem with Styles and DataTemplates, which is little bit confusing. I have defined below test page to play around a bit with styles etc and found that the Styles defined in <Page.Resources> for Border and TextBlock are not applied in the DataTemplate, but Style for ProgressBar defined in exactly the same way is applied. Source code (I just use Kaxaml and XamlPadX to view the result) <Page xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"> <Page.Resources> <Style TargetType="{x:Type Border}"> <Setter Property="Background" Value="SkyBlue"/> <Setter Property="BorderBrush" Value="Black"/> <Setter Property="BorderThickness" Value="2"/> <Setter Property="CornerRadius" Value="5"/> </Style> <Style TargetType="{x:Type TextBlock}"> <Setter Property="FontWeight" Value="Bold"/> </Style> <Style TargetType="{x:Type ProgressBar}"> <Setter Property="Height" Value="10"/> <Setter Property="Width" Value="100"/> <Setter Property="Foreground" Value="Red"/> </Style> <XmlDataProvider x:Key="TestData" XPath="/TestData"> <x:XData> <TestData xmlns=""> <TestElement> <Name>Item 1</Name> <Value>25</Value> </TestElement> <TestElement> <Name>Item 2</Name> <Value>50</Value> </TestElement> </TestData> </x:XData> </XmlDataProvider> <HierarchicalDataTemplate DataType="TestElement"> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" Margin="5,5" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="{Binding XPath=Name}"/> <ProgressBar Value="{Binding XPath=Value}"/> </StackPanel> </Border> </HierarchicalDataTemplate> </Page.Resources> <StackPanel Orientation="Horizontal" HorizontalAlignment="Center" VerticalAlignment="Center"> <StackPanel Orientation="Vertical" VerticalAlignment="Center"> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="Item 1"/> <ProgressBar Value="25"/> </StackPanel> </Border> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="Item 2"/> <ProgressBar Value="50"/> </StackPanel> </Border> </StackPanel> <ListBox Margin="10,10" Width="140" ItemsSource="{Binding Source={StaticResource TestData}, XPath=TestElement}"/> </StackPanel> </Page> I suspect it has something to do with default styles etc, but more puzzling is why some Styles are applied and some not. I cannot find an easy explanation for above anywhere and thus would like to ask if someone would be kind enough to explain this behaviour in lamens' terms with possible links to technical description, i.e. to MSDN or so. Thanks in advance for you support!

    Read the article

  • CoreData: Same predicate (IN) returns different fetched results after a Save operation

    - by Jason Lee
    I have code below: NSArray *existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; [context save:&error]; existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; NSArray *allTasks = [[TaskBizDB sharedInstance] fetchTasksOfProject:projectId]; First line returns two objects; Second line save the context; Third line returns just one object, which is contained in the 'two objects' above; And the last line returns 6 objects, containing the 'two objects' returned at the first line. The fetch interface works like below: WXModel *model = [WXModel modelWithEntity:NSStringFromClass([WQPKTeamTask class])]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(%@ IN personWatchers) AND (projectId == %d)", currentLoginUser, projectId]; [model setPredicate:predicate]; NSArray *fetchedTasks = [model fetch]; if (fetchedTasks.count == 0) return nil; return fetchedTasks; What confused me is that, with the same fetch request, why return different results just after a save? Here comes more detail: The 'two objects' returned at the first line are: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } And the only one object returned at third line is: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } Printing description of allTasks: <_PFArray 0xf30b9a0>( <WQPKTeamTask: 0xf3ab9d0> (entity: WQPKTeamTask; id: 0xf3cda40 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p6> ; data: <fault>), <WQPKTeamTask: 0xf315720> (entity: WQPKTeamTask; id: 0xf3c23a0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p7> ; data: <fault>), <WQPKTeamTask: 0xf3a1ed0> (entity: WQPKTeamTask; id: 0xf3cda30 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p8> ; data: <fault>), <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }), <WQPKTeamTask: 0xf325e50> (entity: WQPKTeamTask; id: 0xf343820 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p10> ; data: <fault>), <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }) ) UPDATE 1 If I call the same interface fetchTasksWatchedByMeOfProject: in: #pragma mark - NSFetchedResultsController Delegate - (void)controllerDidChangeContent:(NSFetchedResultsController *)controller { I will get 'two objects' as well. UPDATE 2 I've tried: NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers == %@) AND (projectId == %d)", currentLoginUser, projectId]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers.personId == %@) AND (projectId == %d)", currentLoginUserId, projectId]; Still the same result. UPDATE 3 I've checked the save:&error, error is nil.

    Read the article

  • C++ run error: pointer being freed was not allocated

    - by Dale Reves
    I'm learning c++ and am working on a program that keeps giving me a 'pointer being freed was not allocated' error. It's a grocery store program that inputs data from a txt file, then user can enter item# & qty. I've read through similar questions but what's throwing me off is the 'pointer' issue. I would appreciate if someone could take a look and help me out. I'm using Netbeans IDE 7.2 on a Mac. I'll just post the whole piece I have so far. Thx. #include <iostream> #include <fstream> #include <string> #include <vector> using namespace std; class Product { public: // PLU Code int getiPluCode() { return iPluCode; } void setiPluCode( int iTempPluCode) { iPluCode = iTempPluCode; } // Description string getsDescription() { return sDescription; } void setsDescription( string sTempDescription) { sDescription = sTempDescription; } // Price double getdPrice() { return dPrice; } void setdPrice( double dTempPrice) { dPrice = dTempPrice; } // Type..weight or unit int getiType() { return iType; } void setiType( int iTempType) { iType = iTempType; } // Inventory quantity double getdInventory() { return dInventory; } void setdInventory( double dTempInventory) { dInventory = dTempInventory; } private: int iPluCode; string sDescription; double dPrice; int iType; double dInventory; }; int main () { Product paInventory[21]; // Create inventory array Product paPurchase[21]; // Create customer purchase array // Constructor to open inventory input file ifstream InputInventory ("inventory.txt", ios::in); //If ifstream could not open the file if (!InputInventory) { cerr << "File could not be opened" << endl; exit (1); }//end if int x = 0; while (!InputInventory.eof () ) { int iTempPluCode; string sTempDescription; double dTempPrice; int iTempType; double dTempInventory; InputInventory >> iTempPluCode >> sTempDescription >> dTempPrice >> iTempType >> dTempInventory; paInventory[x].setiPluCode(iTempPluCode); paInventory[x].setsDescription(sTempDescription); paInventory[x].setdPrice(dTempPrice); paInventory[x].setiType(iTempType); paInventory[x].setdInventory(dTempInventory); x++; } bool bQuit = false; //CREATE MY TOTAL VARIABLE HERE! int iUserItemCount; do { int iUserPLUCode; double dUserAmount; double dAmountAvailable; int iProductIndex = -1; //CREATE MY SUBTOTAL VARIABLE HERE! while(iProductIndex == -1) { cout<<"Please enter the PLU Code of the product."<< endl; cin>>iUserPLUCode; for(int i = 0; i < 21; i++) { if(iUserPLUCode == paInventory[i].getiPluCode()) { dAmountAvailable = paInventory[i].getdInventory(); iProductIndex = i; } } //PLU code entry validation if(iProductIndex == -1) { cout << "You have entered an invalid PLU Code."; } } cout<<"Enter the quantity to buy.\n"<< "There are "<< dAmountAvailable << "available.\n"; cin>> dUserAmount; while(dUserAmount > dAmountAvailable) { cout<<"That's too many, please try again"; cin>>dUserAmount; } paPurchase[iUserItemCount].setiPluCode(iUserPLUCode);// Array of objects function calls paPurchase[iUserItemCount].setdInventory(dUserAmount); paPurchase[iUserItemCount].setdPrice(paInventory[iProductIndex].getdPrice()); paInventory[iProductIndex].setdInventory( paInventory[iProductIndex].getdInventory() - dUserAmount ); iUserItemCount++; cout <<"Are you done purchasing items? Enter 1 for yes and 0 for no.\n"; cin >> bQuit; //NOTE: Put Amount * quantity for subtotal //NOTE: Put code to update subtotal (total += subtotal) // NOTE: Need to create the output txt file! }while(!bQuit); return 0; }

    Read the article

  • c++ to vb.net , problem with callback function

    - by johan
    I'm having a hard time here trying to find a solution for my problem. I'm trying to convert a client API funktion from C++ to VB.NET, and i think have some problems with the callback function. parts of the C++ code: typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_nImgFormat; // =0 cif ; = 1 qcif char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; }CLIENT_VIDEOINFO, *PCLIENT_VIDEOINFO; CPLAYER_API LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo,void(CALLBACK *ReadDataCallBack)(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize)); void CALLBACK ReadDataCallBack(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize) { TRACE("%d\n",nPacketSize); } ..... aa5.m_sUserName = "123"; aa5.m_sUserPassword="w"; aa5.m_bUserCheck = TRUE; MP4_ClientSetTTL(64); nn1 = MP4_ClientStart(&aa5,ReadDataCallBack); if (nn1 == -1) { MessageBox("error"); return; } SDK description: MP4_ClientStart This function starts a connection. The format of the call is: LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo, void(*ReadDataCallBack)(DWORD nChannel,UCHAR *pPacketBuffer,DWORD nPacketSize)) Parameters pClientinfo holds the information. of this connection. nChannel holds the channel of card. pPacketBuffer holds the pointer to the receive buffer. nPacketSize holds the length of the receive buffer. Return Values If the function succeeds the return value is the context of this connection. If the function fails the return value is -1. Remarks typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_bImgFormat; char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; } CLIENT_VIDEOINFO, * PCLIENT_VIDEOINFO; m_bRemoteChannel holds the channel which the client wants to connect to. m_bSendMode holds the network mode of the connection. m_bImgFormat : Image format, 0 is main channel video, 1 is sub channel video m_sIPAddress holds the IP address of the server. m_sUserName holds the user’s name. m_sUserPassword holds the user’s password. m_bUserCheck holds the value whether sends the user’s name and password or not. m_hShowVideo holds Handle for this video window. If m_hShowVideo holds NULL, the client can be record only without decoder. If m_bUserCheck is FALSE, we will send m_sUserName and m_sUserPassword as NULL, else we will send each 50 bytes. The length of m_sIPAddress and m_sUserName must be more than 50 bytes. ReadDataCallBack: When the library receives a packet from a server, this callback is called. My VB.Net code: Imports System.Runtime.InteropServices Public Class Form1 Const WM_USER = &H400 Public Structure CLIENT_VIDEOINFO Public m_bRemoteChannel As Byte Public m_bSendMode As Byte Public m_bImgFormat As Byte Public m_sIPAddress As String Public m_sUserName As String Public m_sUserPassword As String Public m_bUserCheck As Boolean Public m_hShowVideo As Long 'hWnd End Structure Public Declare Function MP4_ClientSetNetPort Lib "hikclient.dll" (ByVal dServerPort As Integer, ByVal dClientPort As Integer) As Boolean Public Declare Function MP4_ClientStartup Lib "hikclient.dll" (ByVal nMessage As UInteger, ByVal hWnd As System.IntPtr) As Boolean <DllImport("hikclient.dll")> Public Shared Function MP4_ClientStart(ByVal Clientinfo As CLIENT_VIDEOINFO, ByRef ReadDataCallBack As CALLBACKdel) As Long End Function Public Delegate Sub CALLBACKdel(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) Public Sub CALLBACK(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) End Sub Public mydel As New CALLBACKdel(AddressOf CALLBACK) Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load Dim Clientinfo As New CLIENT_VIDEOINFO() Clientinfo.m_bRemoteChannel = 0 Clientinfo.m_bSendMode = 0 Clientinfo.m_bImgFormat = 0 Clientinfo.m_sIPAddress = "193.168.1.100" Clientinfo.m_sUserName = "1" Clientinfo.m_sUserPassword = "a" Clientinfo.m_bUserCheck = False Clientinfo.m_hShowVideo = Me.Handle 'Nothing MP4_ClientSetNetPort(850, 850) MP4_ClientStartup(WM_USER + 1, Me.Handle) MP4_ClientStart(Clientinfo, mydel) End Sub End Class here is some other examples of the code in: C# http://blog.csdn.net/nenith1981/archive/2007/09/17/1787692.aspx VB ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/hikclient.bas__.htm ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/Form1.frm__.htm Delphi ://read.pudn.com/downloads91/sourcecode/multimedia/streaming/349759/Delphi_client/Unit1.pas__.htm

    Read the article

  • HTML: Nesting DIVs problem

    - by mawg
    I am coding a form generator. So far, so good, then I decided to give it a real test. I made a form with some nested each holding a few controls. I will post the HTML at the end. If you load it into a browser, it renders, but is obviously wrong. I had previously tested using the W3C validator and things were fine, but that was for non nested. When I validate a form with nested I get errors: Error Line 13, Column 117: document type does not allow element "DIV" here …style="position: absolute; top:88px; left: 256px; width: 145px; height: 21px;"> So, how do I correct that? What do I do with nested FIELDSETs? Here's the complete HTML <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01//EN""http://www.w3.org/TR/html4/strict.dtd"> <html> <head> <title></title> <meta http-equiv="Content-type" content="text/html;charset=UTF-8"> </head> <body> <form action="C:\temp\an_elogger_test.php" method="get"><div class="TGroupBox" id="GroupBox1"> <fieldset style="position: absolute; top:24px; left:24px; width: 449px; height: 473px;"> <legend>GroupBox1</legend> <div class="TPanel" id="Panel1"> <fieldset style="position: absolute; top:64px; left:64px; width: 361px; height: 217px;"> <div class="TComboBox" id="ComboBox1" style="position: absolute; top:88px; left: 256px; width: 145px; height: 21px;"> <select name="ComboBox1"> </select> </div> <div class="TGroupBox" id="GroupBox2"> <fieldset style="position: absolute; top:80px; left:88px; width: 145px; height: 177px;"> <legend>GroupBox2</legend> <div class="TCheckBox" id="CheckBox1" style="position: absolute; top:112px; left: 104px; width: 97px; height: 17px;">CheckBox1<input type="checkbox" name="CheckBox1" value="CheckBox1Checked"></div> <div class="TCheckBox" id="CheckBox2" style="position: absolute; top:152px; left: 112px; width: 97px; height: 17px;">CheckBox2<input type="checkbox" name="CheckBox2" value="CheckBox2Checked"checked="checked"></div> </fieldset> </div> <div class="TRadioGroup" id="RadioGroup2"> <fieldset style="position: absolute; top:128px; left: 264px; width: 145px; height: 137px;"><legend>RadioGroup2</legend> eins: <input type="radio" name="RadioGroup2" value="eins" checked><br> zwei: <input type="radio" name="RadioGroup2" value="zwei"><br> drei: <input type="radio" name="RadioGroup2" value="drei"><br> </fieldset> </div> </fieldset> </div> <div class="TMemo" id="Memo1"><textarea name="Memo1" rows="8" cols="13" style="position: absolute; top:320px; left: 88px; width: 185px; height: 89px;"> </textarea> </div> <div class="TComboBox" id="ComboBox2" style="position: absolute; top:328px; left: 296px; width: 145px; height: 21px;"> <select name="ComboBox2"> <option value="a">a</option> <option value="b">b</option> <option value="c">c</option> <option value="d" selected="selected">d</option> <option value="e">e</option> </select> </div> </fieldset> </div> <div class="TPanel" id="Panel2"> <fieldset style="position: absolute; top:32px; left:520px; width: 425px; height: 449px;"> <div class="TPanel" id="Panel3"> <fieldset style="position: absolute; top:64px; left:552px; width: 345px; height: 185px;"> <div class="TMemo" id="Memo2"><textarea name="Memo2" rows="8" cols="13" style="position: absolute; top:88px; left: 584px; width: 185px; height: 89px;"> You may wish to leave this memo emptyOr perpahaps give instructions aboout what should be written here</textarea> </div> <div class="TEdit" id="Edit1" style="position: absolute; top:200px; left: 600px; width: 121px; height: 21px;"><input type="text" name="Edit1"value="Insert text here"></div> </fieldset> </div> <div class="TGroupBox" id="GroupBox3"> <fieldset style="position: absolute; top:272px; left:552px; width: 345px; height: 185px;"> <legend>GroupBox3</legend> <div class="TPanel" id="Panel4"> <fieldset style="position: absolute; top:304px; left:584px; width: 177px; height: 137px;"> <div class="TRadioGroup" id="RadioGroup1"> <fieldset style="position: absolute; top:312px; left: 600px; width: 97px; height: 105px;"><legend>RadioGroup1</legend> one: <input type="radio" name="RadioGroup1" value="one"><br> two: <input type="radio" name="RadioGroup1" value="two" checked><br> three: <input type="radio" name="RadioGroup1" value="three"><br> </fieldset> </div> </fieldset> </div> <div class="TEdit" id="Edit2" style="position: absolute; top:320px; left: 776px; width: 105px; height: 21px;"><input type="text" name="Edit2"></div> </fieldset> </div> </fieldset> </div> <div align="center" style="margin: auto"><input type="submit" name="submitButton" value="Submit" style="position:absolute;top:522px;"></div> </form> </body> </html>

    Read the article

  • Help Writing Input Data to Database With Wordpress Plugin

    - by HollerTrain
    Hi I am making a wordpress plugin where I need the Admin to enter data into a database table. I am able to install the db table when the Plugin is activated, however I can't figure out how to save the user input. I've asked on the WP forums but they're dead... Any experienced guru who can lend some guidance would be greatly appreciated. <?php /******************************************************************* * INSTALL DB TABLE - ONLY AT RUN TIME * *******************************************************************/ function ed_xml_install() { global $wpdb; $ed_xml_data = $wpdb->prefix . "ed_xml_data"; if($wpdb->get_var("SHOW TABLES LIKE '$ed_xml_data'") != $ed_xml_data) { $sql = "CREATE TABLE " . ed_xml_data . " ( id mediumint(9) NOT NULL AUTO_INCREMENT, name tinytext NOT NULL, address text NOT NULL, url VARCHAR(55) NOT NULL, phone bigint(11) DEFAULT '0' NOT NULL, UNIQUE KEY id (id) );"; require_once(ABSPATH . 'wp-admin/includes/upgrade.php'); dbDelta($sql); $name = "Example Business Name"; $address = "1234 Example Street"; $url = "http://www.google.com"; $phone = "523-3232-323232"; $insert = "INSERT INTO " . ed_xml_data . " (phone, name, address, url) " . "VALUES ('" . phone() . "','" . $wpdb->escape($name) . "','" . $wpdb->escape($address) . "', '" . $wpdb->escape($url) . "')"; $results = $wpdb->query( $insert ); } } //call the install hook register_activation_hook(__FILE__,'ed_xml_install'); /******************************************************************* * CREATE MENU, CREATE MENU CONTENT * *******************************************************************/ if ( is_admin() ){ /* place it under the ED menu */ //TODO $allowed_group = ''; /* Call the html code */ add_action('admin_menu', 'ed_xmlcreator_admin_menu'); function ed_xmlcreator_admin_menu() { add_options_page('ED XML Creator', 'ED XML Creator', 'administrator', 'ed_xml_creator', 'ed_xmlcreator_html_page'); } } /******************************************************************* * CONTENT OF MENU CONTENT * *******************************************************************/ function ed_xmlcreator_html_page() { <div> <h2>Editors Deal XML Options</h2> <p>Fill in the below information which will get passed to the .XML file.</p> <p>[<a href="" title="view XML file">view XML file</a>]</p> <form method="post" action="options.php"> <?php wp_nonce_field('update-options'); ?> <table width="510"> <!-- title --> <tr valign="top"> <th width="92" scope="row">Deal URL</th> <td width="406"> <input name="url" type="text" id="url" value="<?php echo get_option('url'); ?>" /> </td> </tr> <!-- description --> <tr valign="top"> <th width="92" scope="row">Deal Address</th> <td width="406"> <input name="address" type="text" id="address" value="<?php echo get_option('address'); ?>" /> </td> </tr> <!-- business name --> <tr valign="top"> <th width="92" scope="row">Business Phone</th> <td width="406"> <input name="phone" type="text" id="phone" value="<?php echo get_option('phone'); ?>" /> </td> </tr> <!-- address --> <tr valign="top"> <th width="92" scope="row">Business Name</th> <td width="406"> <input name="name" type="text" id="name" value="<?php echo get_option('name'); ?>" /> </td> </tr> </table> <input type="hidden" name="action" value="update" /> <input type="hidden" name="page_options" value="hello_world_data" /> <p> <input type="submit" value="<?php _e('Save Changes') ?>" /> </p> </form> </div> ?>

    Read the article

  • jQuery .closest returns undefined

    - by Andy Holmes
    I've got the code below which works fine, however the jquery to add the items doesnt find the data-parent-room value and just returns undefined. This is the only thing not working :( HTML: <div id="inventoryRooms"> <!--BOX SHART--> <div class="widget box formHolder" data-parent-room="1"> <!--ROOM NAME--> <form class="widget-header rooms"> <input type="text" placeholder="Type Room name" name="roomName[]" class="form-input add-room-input input-width-xxlarge"> <input type="hidden" class="roomId" name="roomId[]"> <input type="hidden" class="inventoryId" name="inventoryId[]" value="<?=$_GET['inventory_id']?>"> <div class="toolbar no-padding"> <div class="btn-group"> <span class="btn saveRoom"><i class="icon-ok"></i> Save Room</span> </div> </div> </form> <!--/END--> <!--GENERIC ROW TITLES--> <div class="widget-header header-margin hide"> <div class="row row-title"> <div class="col-md-3"><h5>ITEM</h5></div> <div class="col-md-3"><h5>DESCRIPTION</h5></div> <div class="col-md-3"><h5>CONDITION</h5></div> <div class="col-md-2"><h5>PHOTOGRAPH</h5></div> <div class="col-md-1 align-center"><h5><i class="icon-cog"> </i></h5></div> </div> </div> <!--/END--> <!--ADD ITEM--> <div class="items"> </div> <!--/END--> <div class="toolbar-small"> <div class="btn-group"> <span class="btn addItem"><i class="icon-plus"></i> Add Item</span> <span data-toggle="dropdown" class="btn dropdown-toggle"><i class="icon-gear"></i> Options<span class="button-space"></span><i class="icon-angle-down"></i></span> <ul class="dropdown-menu pull-right"> <li><a href="#"><i class="icon-trash"></i> Delete Room</a></li> </ul> </div> </div> </div> </div> jQuery: $(document).on('click','.addItem', function(){ $('<!--ROW START-->\ <form class="widget-content item">\ <div class="row">\ <div class="col-md-3"><input type="text" class="form-control" name="itemName[]"></div>\ <div class="col-md-3"><textarea class="auto form-control" name="itemDescription[]" cols="20" rows="1" style="word-wrap: break-word; resize: vertical;"></textarea></div>\ <div class="col-md-3"><textarea class="auto form-control" name="itemCondition[]" cols="20" rows="1" style="word-wrap: break-word; resize: vertical;"></textarea></div>\ <input type="hidden" class="itemId" name="itemId[]" value="">\ <input type="hidden" name="itemInventoryId[]" value="<?=$_GET["inventory_id"]?>">\ <input type="hidden" name="itemParent[]" value="'+$(this).closest().attr('data-parent-room')+'">\ <div class="col-md-2">\ <div class="fileinput-holder input-group">\ <input id="fileupload" type="file" name="files[]" data-url="uploads/">\ </div>\ </div>\ <div class="col-md-1 align-center"><i class="save icon-ok large"> </i>&nbsp;&nbsp;&nbsp;<i class="delete icon-trash large"> </i></div>\ </div>\ </form>\ <!--/ROW END-->').fadeIn(500).appendTo($(this).parents().siblings('.items')); $(this).parent().parent().siblings('.widget-header, .header-margin, .hide').removeClass('hide').fadeIn(); }); Like i say, it all works fine apart from that damn data-parent-room value. Any help is appreciated! using jQuery 1.10.1

    Read the article

  • how can i update view when fragment change?

    - by user1524393
    i have a activity that have 2 sherlockfragment in this The first two pages display fragments with custom list views which are built from xml from server using AsyncTask. However, when the app runs, only one list view is displayed, the other page is just blank public class VpiAbsTestActivity extends SherlockFragmentActivity { private static final String[] CONTENT = new String[] { "1","2"}; TestFragmentAdapter mAdapter; ViewPager mPager; PageIndicator mIndicator; protected void onCreate(Bundle savedInstanceState) { setRequestedOrientation(ActivityInfo.SCREEN_ORIENTATION_PORTRAIT); super.onCreate(savedInstanceState); setContentView(R.layout.simple_tabs); mAdapter = new TestFragmentAdapter(getSupportFragmentManager()); mPager = (ViewPager)findViewById(R.id.pager); mPager.setAdapter(mAdapter); mIndicator = (TabPageIndicator)findViewById(R.id.indicator); mIndicator.setViewPager(mPager); mIndicator.notifyDataSetChanged(); } class TestFragmentAdapter extends FragmentPagerAdapter { private int mCount = CONTENT.length; public TestFragmentAdapter(FragmentManager fm) { super(fm); } @Override public Fragment getItem(int position) { switch(position) { case 0: return new customlist(); case 1: return new customlistnotuser(); default: return null; } } @Override public int getCount() { return mCount; } public CharSequence getPageTitle(int position) { return VpiAbsTestActivity.CONTENT[position % VpiAbsTestActivity.CONTENT.length].toUpperCase(); } @Override public void destroyItem(View collection, int position, Object view) { ((ViewPager) collection).removeView((View) view); } } } what can i update viewpager when change pages ? the customlistnotuser page likes customlist page but not show public class customlistnotuser extends SherlockFragment { // All static variables static final String URL = "url"; // XML node keys static final String KEY_TEST = "test"; // parent node static final String KEY_ID = "id"; static final String KEY_TITLE = "title"; static final String KEY_Description = "description"; static final String KEY_DURATION = "duration"; static final String KEY_THUMB_URL = "thumb_url"; static final String KEY_PRICE = "price"; static final String KEY_URL = "url"; private ProgressDialog pDialog; ListView list; LazyAdapterbeth adapter; XMLParser parser = new XMLParser(); public void onActivityCreated(Bundle savedInstanceState) { super.onActivityCreated(savedInstanceState); } public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); new getFeed().execute(); } public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { View thisfragment = inflater.inflate(R.layout.dovomi, container, false); return thisfragment; } private class getFeed extends AsyncTask<Void, Void, Document> { } protected Document doInBackground(Void... params) { XMLParser parser = new XMLParser(); String xml = parser.getXmlFromUrl(URL); // getting XML from URL Document doc = parser.getDomElement(xml); // getting DOM element return doc; } protected void onPostExecute(Document doc) { ArrayList<HashMap<String, String>> songsList = new ArrayList<HashMap<String, String>>(); NodeList nl = doc.getElementsByTagName(KEY_TEST); // looping through all song nodes <song> for (int i = 0; i < nl.getLength(); i++) { // creating new HashMap HashMap<String, String> map = new HashMap<String, String>(); Element e = (Element) nl.item(i); // adding each child node to HashMap key => value map.put(KEY_ID, parser.getValue(e, KEY_ID)); map.put(KEY_TITLE, parser.getValue(e, KEY_TITLE)); map.put(KEY_Description, parser.getValue(e, KEY_Description)); map.put(KEY_DURATION, parser.getValue(e, KEY_DURATION)); map.put(KEY_THUMB_URL, parser.getValue(e, KEY_THUMB_URL)); map.put(KEY_PRICE, parser.getValue(e, KEY_PRICE)); map.put(KEY_URL, parser.getValue(e, KEY_URL)); // adding HashList to ArrayList songsList.add(map); pDialog.dismiss(); } list=(ListView)getActivity().findViewById(R.id.list); // Getting adapter by passing xml data ArrayList adapter=new LazyAdapterbeth(getActivity(), songsList); list.setAdapter(adapter); // Click event for single list row list.setOnItemClickListener(new OnItemClickListener() {

    Read the article

< Previous Page | 342 343 344 345 346 347 348 349 350 351 352 353  | Next Page >