Search Results

Search found 9016 results on 361 pages for 'regex libraries'.

Page 347/361 | < Previous Page | 343 344 345 346 347 348 349 350 351 352 353 354  | Next Page >

• Maven webapp with maven-eclipse-plugin doesn't generate <dependent-module>

  - by codevourer

  I use the eclipse:eclipse goal to generate an Eclipse Project environment. The deployment works fine. The goal creates the var classpath entries for all needed dependencies. With m2eclipse there was the Maven Container which defines an export folder which was WEB-INF/lib for me. But i don't want to rely on m2eclipse so i don't use it anymore. the class path entries which are generated by eclipse:eclipse goal don't have such a export folder. While booting the servlet container with WTP it publishes all resources and classes except the libraries to the context. Whats missing to publish the needed libs, or isn't that possible without m2eclipse integration? Enviroment Eclipse 3.5 JEE Galileo Apache Maven 2.2.1 (r801777; 2009-08-06 21:16:01+0200) Java version: 1.6.0_14 m2eclipse The maven-eclipse-plugin configuration <plugin> <groupId>org.apache.maven.plugins</groupId> <artifactId>maven-eclipse-plugin</artifactId> <version>2.8</version> <configuration> <projectNameTemplate>someproject-[artifactId]</projectNameTemplate> <useProjectReferences>false</useProjectReferences> <downloadSources>false</downloadSources> <downloadJavadocs>false</downloadJavadocs> <wtpmanifest>true</wtpmanifest> <wtpversion>2.0</wtpversion> <wtpapplicationxml>true</wtpapplicationxml> <wtpContextName>someproject-[artifactId]</wtpContextName> <additionalProjectFacets> <jst.web>2.3</jst.web> </additionalProjectFacets> </configuration> </plugin> The generated files After executing the eclipse:eclipse goal, the dependent-module is not listed in my generated .settings/org.eclipse.wst.common.component, so on server booting i miss the depdencies. This is what i get: <?xml version="1.0" encoding="UTF-8"?> <project-modules id="moduleCoreId" project-version="1.5.0"> <wb-module deploy-name="someproject-core"> <wb-resource deploy-path="/" source-path="src/main/java"/> <wb-resource deploy-path="/" source-path="src/main/webapp"/> <wb-resource deploy-path="/" source-path="src/main/resources"/> </wb-module> </project-modules> Update for upcoming readers The problem here was the deviant packaging-type, if u use maven-eclipse-plugin please validate the use of <packaging>war</packaging> or ear. The following problems are marked of the situations that i have two build-lifecycles in one maven pom.

  Read the article

• Web service using Data Dynamics ActiveReports occasionally slows down

  - by Swoop

  My company is running into a problem with a web service that is written in C#/ASP.Net. The service receives an identity key for data in SQL Server and a path to generate and save a PDF report for this data. In most cases, this web service returns results to the calling web pages very quickly, usually within a few seconds max. However, it seems to occasionally hit a significant slowdown. The web application calling the web service will generate a timeout error when this slowdown occurs. We have checked and the PDF does get created and saved to the server, so it looks like the web service eventually finishes executing. It seems to take about 1 to 2 minutes for processing to have completed. The PDF is generated using ActiveReports from Data Dynamics. Wwhen this problem occurs, making a small change to the web service's config file (ie, adding a blank space to a connection string line) seems to restart the web service and everything is perfectly ok for a period of time afterwards. Other web applications that are running on the same web server do not seem to experience this type of behavior, only this particular web service. I have added the code for the web service below. It is basic calls to 3rd party libraries. We are not able to recreate this problem in test. I am wondering what might be causing this issue? [WebMethod] public string Publish(int identity, string transactionType, string directory, string filename) { try { AdpConnection Conn = new AdpConnection(ConfigurationManager.AppSettings["myDBConnString"]); AdpCommand Cmd = new AdpCommand("storedproc_GetData", oConn); AdpParameter Param; Cmd.CommandType = CommandType.StoredProcedure; Param = Cmd.CreateParameter("@Identity", DbType.Int32); Param.Value = identity; Cmd.Parameters.Add(oParam); Conn.Open(); string aResponse = Cmd.ExecuteScalar().ToString(); Conn.Close(); if (transactionType == "typeA") { //Parse response DataSet dsResponse = ParseDataResponse(aResponse); //dsResponse.WriteXml(@ConfigurationManager.AppSettings["DocsDir"] + identity.ToString() + ".xml"); DataDynamics.ActiveReports.ActiveReport3 rpt = new DataDynamics.ActiveReports.ActiveReport3(); rpt.LoadLayout(@ConfigurationManager.AppSettings["myReportPath"] + "TypeA.rpx"); rpt.AddNamedItem("ReportPath", @ConfigurationManager.AppSettings["myReportPath"]); rpt.AddNamedItem("XMLSTRING", FormatXML(dsResponse.GetXml())); DataDynamics.ActiveReports.DataSources.XMLDataSource xmlds = new DataDynamics.ActiveReports.DataSources.XMLDataSource(); xmlds.FileURL = null; xmlds.RecordsetPattern = "//DataPatternA"; xmlds.LoadXML(FormatXML(dsResponse.GetXml())); if (!System.IO.Directory.Exists(@ConfigurationManager.AppSettings["DocsDir"] + directory + @"\")) { System.IO.Directory.CreateDirectory(@ConfigurationManager.AppSettings["DocsDir"] + directory + @"\"); } string sXML = FormatXML(dsResponse.GetXml()); StreamWriter sw = new StreamWriter(@ConfigurationManager.AppSettings["DocsDir"] + directory + @"\" + filename + ".xml", false); sw.Write(sXML); sw.Close(); rpt.DataSource = xmlds; rpt.Run(true); DataDynamics.ActiveReports.Export.Pdf.PdfExport xPdf = new DataDynamics.ActiveReports.Export.Pdf.PdfExport(); xPdf.Export(rpt.Document, @ConfigurationManager.AppSettings["DocsDir"] + directory + @"\" + filename + ".pdf"); } } catch(Exception ex) { return "Error: " + ex.ToString(); } return @ConfigurationManager.AppSettings["DocsDir"] + directory + @"\" + filename + ".pdf"; }

  Read the article

• How to use pthread_atfork() and pthread_once() to reinitialize mutexes in child processes

  - by Blair Zajac

  We have a C++ shared library that uses ZeroC's Ice library for RPC and unless we shut down Ice's runtime, we've observed child processes hanging on random mutexes. The Ice runtime starts threads, has many internal mutexes and keeps open file descriptors to servers. Additionally, we have a few of mutexes of our own to protect our internal state. Our shared library is used by hundreds of internal applications so we don't have control over when the process calls fork(), so we need a way to safely shutdown Ice and lock our mutexes while the process forks. Reading the POSIX standard on pthread_atfork() on handling mutexes and internal state: Alternatively, some libraries might have been able to supply just a child routine that reinitializes the mutexes in the library and all associated states to some known value (for example, what it was when the image was originally executed). This approach is not possible, though, because implementations are allowed to fail *_init() and *_destroy() calls for mutexes and locks if the mutex or lock is still locked. In this case, the child routine is not able to reinitialize the mutexes and locks. On Linux, the this test C program returns EPERM from pthread_mutex_unlock() in the child pthread_atfork() handler. Linux requires adding _NP to the PTHREAD_MUTEX_ERRORCHECK macro for it to compile. This program is linked from this good thread. Given that it's technically not safe or legal to unlock or destroy a mutex in the child, I'm thinking it's better to have pointers to mutexes and then have the child make new pthread_mutex_t on the heap and leave the parent's mutexes alone, thereby having a small memory leak. The only issue is how to reinitialize the state of the library and I'm thinking of reseting a pthread_once_t. Maybe because POSIX has an initializer for pthread_once_t that it can be reset to its initial state. #include <pthread.h> #include <stdlib.h> #include <string.h> static pthread_once_t once_control = PTHREAD_ONCE_INIT; static pthread_mutex_t *mutex_ptr = 0; static void setup_new_mutex() { mutex_ptr = malloc(sizeof(*mutex_ptr)); pthread_mutex_init(mutex_ptr, 0); } static void prepare() { pthread_mutex_lock(mutex_ptr); } static void parent() { pthread_mutex_unlock(mutex_ptr); } static void child() { // Reset the once control. pthread_once_t once = PTHREAD_ONCE_INIT; memcpy(&once_control, &once, sizeof(once_control)); setup_new_mutex(); } static void init() { setup_new_mutex(); pthread_atfork(&prepare, &parent, &child); } int my_library_call(int arg) { pthread_once(&once_control, &init); pthread_mutex_lock(mutex_ptr); // Do something here that requires the lock. int result = 2*arg; pthread_mutex_unlock(mutex_ptr); return result; } In the above sample in the child() I only reset the pthread_once_t by making a copy of a fresh pthread_once_t initialized with PTHREAD_ONCE_INIT. A new pthread_mutex_t is only created when the library function is invoked in the child process. This is hacky but maybe the best way of dealing with this skirting the standards. If the pthread_once_t contains a mutex then the system must have a way of initializing it from its PTHREAD_ONCE_INIT state. If it contains a pointer to a mutex allocated on the heap than it'll be forced to allocate a new one and set the address in the pthread_once_t. I'm hoping it doesn't use the address of the pthread_once_t for anything special which would defeat this. Searching comp.programming.threads group for pthread_atfork() shows a lot of good discussion and how little the POSIX standards really provides to solve this problem. There's also the issue that one should only call async-signal-safe functions from pthread_atfork() handlers, and it appears the most important one is the child handler, where only a memcpy() is done. Does this work? Is there a better way of dealing with the requirements of our shared library?

  Read the article

• Trouble recovering MySQL InnoDB database after server crash

  - by Andy Shinn

  I had a server crash due to a broken iSCSI link (the filesystem went into read-only mode). After repairing the link and rebooting the machine (CentOS 5 / MySQL 5.1), the MySQL server would not start and gave the following error: 100603 19:11:46 mysqld_safe Starting mysqld daemon with databases from /var/lib/mysql InnoDB: The log sequence number in ibdata files does not match InnoDB: the log sequence number in the ib_logfiles! 100603 19:11:46 InnoDB: Database was not shut down normally! InnoDB: Starting crash recovery. InnoDB: Reading tablespace information from the .ibd files... InnoDB: Restoring possible half-written data pages from the doublewrite InnoDB: buffer... InnoDB: Warning: database page corruption or a failed InnoDB: file read of page 112541. InnoDB: Trying to recover it from the doublewrite buffer. InnoDB: Dump of the page: 100603 19:11:46 InnoDB: Page dump in ascii and hex (16384 bytes): lots of binary data 100603 19:11:46 InnoDB: Page checksum 953720272, prior-to-4.0.14-form checksum 2641912043 InnoDB: stored checksum 617821918, prior-to-4.0.14-form stored checksum 2080617765 InnoDB: Page lsn 115 2632899642, low 4 bytes of lsn at page end 2641594600 InnoDB: Page number (if stored to page already) 112541, InnoDB: space id (if created with = MySQL-4.1.1 and stored already) 0 InnoDB: Page may be an index page where index id is 0 616 InnoDB: Dump of corresponding page in doublewrite buffer: 100603 19:11:46 InnoDB: Page dump in ascii and hex (16384 bytes): more binary data 100603 19:11:46 InnoDB: Page checksum 908374788, prior-to-4.0.14-form checksum 824841363 InnoDB: stored checksum 912869634, prior-to-4.0.14-form stored checksum 2210927931 InnoDB: Page lsn 115 2635312169, low 4 bytes of lsn at page end 2633173354 InnoDB: Page number (if stored to page already) 112541, InnoDB: space id (if created with = MySQL-4.1.1 and stored already) 0 InnoDB: Page may be an index page where index id is 0 616 InnoDB: Also the page in the doublewrite buffer is corrupt. InnoDB: Cannot continue operation. InnoDB: You can try to recover the database with the my.cnf InnoDB: option: InnoDB: innodb_force_recovery=6 100603 19:11:46 mysqld_safe mysqld from pid file /var/run/mysqld/mysqld.pid ended Per the error message, I have tried setting set-variable=innodb_force_recovery=6 in the my.cnf to get to the data. This allows the MySQL server to start. But when I try to do a mysqldump of the database or a SELECT * INTO OUTFILE "filename" FROM broken_table; it seems to endlessly just export the same line over and over again. I have also tried http://code.google.com/p/innodb-tools/. But this tool fails with an error that 'blob' type is not supported. If I try to access the data using the PHP application it crashes MySQL: `100603 19:19:19 - mysqld got signal 11 ; This could be because you hit a bug. It is also possible that this binary or one of the libraries it was linked against is corrupt, improperly built, or misconfigured. This error can also be caused by malfunctioning hardware. We will try our best to scrape up some info that will hopefully help diagnose the problem, but since we have already crashed, something is definitely wrong and this may fail. key_buffer_size=8384512 read_buffer_size=131072 max_used_connections=2 max_threads=151 threads_connected=2 It is possible that mysqld could use up to key_buffer_size + (read_buffer_size + sort_buffer_size)*max_threads = 338317 K bytes of memory Hope that's ok; if not, decrease some variables in the equation. thd: 0x15d33f0 Attempting backtrace. You can use the following information to find out where mysqld died. If you see no messages after this, something went terribly wrong... stack_bottom = 0x453aff00 thread_stack 0x40000 /usr/libexec/mysqld(my_print_stacktrace+0x24) [0x874364] /usr/libexec/mysqld(handle_segfault+0x346) [0x5c9166] /lib64/libpthread.so.0 [0x3a6e40eb10] /usr/libexec/mysqld(rec_get_offsets_func+0x30) [0x7cc310] /usr/libexec/mysqld [0x7674d8] /usr/libexec/mysqld(btr_search_info_update_slow+0x638) [0x768d48] /usr/libexec/mysqld(btr_cur_search_to_nth_level+0xc7d) [0x75f86d] /usr/libexec/mysqld [0x7dd1c1] /usr/libexec/mysqld(row_search_for_mysql+0x18b0) [0x7e03d0] /usr/libexec/mysqld(ha_innobase::general_fetch(unsigned char*, unsigned int, unsigned int)+0x7c) [0x7526fc] /usr/libexec/mysqld(handler::read_multi_range_next(st_key_multi_range**)+0x29) [0x6aed09] /usr/libexec/mysqld(QUICK_RANGE_SELECT::get_next()+0x194) [0x69a964] /usr/libexec/mysqld [0x6aafe9] /usr/libexec/mysqld(sub_select(JOIN*, st_join_table*, bool)+0x56) [0x635196] /usr/libexec/mysqld [0x63f9cd] /usr/libexec/mysqld(JOIN::exec()+0x950) [0x6497c0] /usr/libexec/mysqld(mysql_select(THD*, Item*, TABLE_LIST*, unsigned int, List&, Item*, unsigned int, st_order*, st_order*, Item*, st_order*, unsign ed long long, select_result*, st_select_lex_unit*, st_select_lex*)+0x17b) [0x64b34b] /usr/libexec/mysqld(handle_select(THD*, st_lex*, select_result*, unsigned long)+0x169) [0x64bc79] /usr/libexec/mysqld [0x5d34b6] /usr/libexec/mysqld(mysql_execute_command(THD*)+0x4e5) [0x5d6b45] /usr/libexec/mysqld(mysql_parse(THD*, char const*, unsigned int, char const)+0x211) [0x5dc321] /usr/libexec/mysqld(dispatch_command(enum_server_command, THD*, char*, unsigned int)+0x10b8) [0x5dd3f8] /usr/libexec/mysqld(do_command(THD*)+0xe6) [0x5dd9e6] /usr/libexec/mysqld(handle_one_connection+0x73d) [0x5d036d] /lib64/libpthread.so.0 [0x3a6e40673d] /lib64/libc.so.6(clone+0x6d) [0x3a6d4d3d1d] Trying to get some variables. Some pointers may be invalid and cause the dump to abort... thd-query at 0x15de5e0 = SELECT DISTINCT count(DISTINCT i.itemid) as rowscount,i.hostid FROM items i WHERE ((i.itemid BETWEEN 000000000000000 AND 0999999 99999999)) AND i.type<9 AND (i.hostid IN (10017,10047,10050,10054,10056,10059,10062,10063,10064,10065,10066,10067,10068,10069,10070,10071,10072,10073,100 74,10075,10076,10077,10078,10079,10080,10081,10082,10084,10088,10089,10090,10091,10092,10093,10094,10095,10096,10097,10098,10099,10100,10101,10102,10103,10 104,10105,10106,10107,10108,10109)) GROUP BY i.hostid thd-thread_id=3 thd-killed=NOT_KILLED The manual page at contains information that should help you find out what is causing the crash. 100603 19:19:19 mysqld_safe Number of processes running now: 0 100603 19:19:19 mysqld_safe mysqld restarted` Before recovering form an older backup as a last resort I am looking for anymore suggestions. Thanks!

  Read the article

• HP-UX: libstd_v2 in stack trace of JNI code compiled with g++

  - by Miguel Rentes

  Hello, uname -mr: B.11.23 ia64 g++ --version: g++ (GCC) 4.4.0 java -version: Java(TM) SE Runtime Environment (build 1.6.0.06-jinteg_20_jan_2010_05_50-b00) Java HotSpot(TM) Server VM (build 14.3-b01-jre1.6.0.06-rc1, mixed mode) I'm trying to run a Java application that uses JNI. It is crashing inside the JNI code with the following (abbreviated) stack trace: (0) 0xc0000000249353e0 VMError::report_and_die{_ZN7VMError14report_and_dieEv} + 0x440 at /CLO/Components/JAVA_HOTSPOT/Src/src/share/vm/utilities/vmError.cpp:738 [/opt/java6/jre/lib/IA64W/server/libjvm.so] (1) 0xc000000024559240 os::Hpux::JVM_handle_hpux_signal{_ZN2os4Hpux22JVM_handle_hpux_signalEiP9 __siginfoPvi} + 0x760 at /CLO/Components/JAVA_HOTSPOT/Src/src/os_cpu/hp-ux_ia64/vm/os_hp-ux_ia64.cpp:1051 [/opt/java6/jre/lib/IA64W/server/libjvm.so] (2) 0xc0000000245331c0 os::Hpux::signalHandler{_ZN2os4Hpux13signalHandlerEiP9__siginfoPv} + 0x80 at /CLO/Components/JAVA_HOTSPOT/Src/src/os/hp-ux/vm/os_hp-ux.cpp:4295 [/opt/java6/jre/lib/IA64W/server/libjvm.so] (3) 0xe00000010e002620 ---- Signal 11 (SIGSEGV) delivered ---- (4) 0xc0000000000d2d20 __pthread_mutex_lock + 0x400 at /ux/core/libs/threadslibs/src/common/pthreads/mutex.c:3895 [/usr/lib/hpux64/libpthread.so.1] (5) 0xc000000000342e90 __thread_mutex_lock + 0xb0 at ../../../../../core/libs/libc/shared_em_64/../core/threads/wrappers1.c:273 [/usr/lib/hpux64/libc.so.1] (6) 0xc00000000177dff0 _HPMutexWrapper::lock{_ZN15_HPMutexWrapper4lockEPv} + 0x90 [/usr/lib/hpux64/libstd_v2.so.1] (7) 0xc0000000017e9960 std::basic_string,std::allocator{_ZNSsC1ERKSs} + 0x80 [/usr/lib/hpux64/libstd_v2.so.1] (8) 0xc000000008fd9fe0 JniString::str{_ZNK9JniString3strEv} + 0x50 at eg_handler_jni.cxx:50 [/soft/bus-7_0/lib/libbus_registry_jni.so.7.0.0] (9) 0xc000000008fd7060 pt_efacec_se_aut_frk_cmp_registry_REGHandler::getKey{_ZN44pt_efacec_se_aut_frk_cmp_registry_REGHandler6getKeyEP8_jstringi} + 0xa0 [/soft/bus-7_0/lib/libbus_registry_jni.so.7.0.0] (10) 0xc000000008fd17f0 Java_pt_efacec_se_aut_frk_cmp_registry_REGHandler_getKey__Ljava_lang_String_2I + 0xa0 [/soft/bus-7_0/lib/libbus_registry_jni.so.7.0.0] (11) 0x9fffffffdf400ed0 Internal error (-3) while unwinding stack [/CLO/Components/JAVA_HOTSPOT/Src/src/os_cpu/hp-ux_ia64/vm/thread_hp-ux_ia64.cpp:142] This JNI code and dependencies are being compiled using g++, are multithreaded and 64 bit (-pthread -mlp64 -shared -fPIC). The LD_LIBRARY_PATH environment variable is set the dependencies location, and running ldd on the JNI shared libraries finds them all: ldd libbus_registry_jni.so: libefa-d.so.7 = /soft/bus-7_0/lib/libefa-d.so.7 libbus_registry-d.so.7 = /soft/bus-7_0/lib/libbus_registry-d.so.7 libboost_thread-gcc44-mt-d-1_41.so = /usr/local/lib/libboost_thread-gcc44-mt-d-1_41.so libboost_system-gcc44-mt-d-1_41.so = /usr/local/lib/libboost_system-gcc44-mt-d-1_41.so libboost_regex-gcc44-mt-d-1_41.so = /usr/local/lib/libboost_regex-gcc44-mt-d-1_41.so librt.so.1 = /usr/lib/hpux64/librt.so.1 libstdc++.so.6 = /opt/hp-gcc-4.4.0/lib/gcc/ia64-hp-hpux11.23/4.4.0/../../../hpux64/libstdc++.so.6 libm.so.1 = /usr/lib/hpux64/libm.so.1 libgcc_s.so.0 = /opt/hp-gcc-4.4.0/lib/gcc/ia64-hp-hpux11.23/4.4.0/../../../hpux64/libgcc_s.so.0 libunwind.so.1 = /usr/lib/hpux64/libunwind.so.1 librt.so.1 = /usr/lib/hpux64/librt.so.1 libm.so.1 = /usr/lib/hpux64/libm.so.1 libunwind.so.1 = /usr/lib/hpux64/libunwind.so.1 libdl.so.1 = /usr/lib/hpux64/libdl.so.1 libunwind.so.1 = /usr/lib/hpux64/libunwind.so.1 libc.so.1 = /usr/lib/hpux64/libc.so.1 libuca.so.1 = /usr/lib/hpux64/libuca.so.1 Looking at the stack trace, it seams odd that, although ldd list g++'s libstdc++ is being used, the std:string copy c'tor being reported as used is the one in libstd_v2, the implementation provided by aCC. The crash happens in the following code, when method str() returns: class JniString { std::string m_utf8; public: JniString(JNIEnv* env, jstring instance) { const char* utf8Chars = env-GetStringUTFChars(instance, 0); if (utf8Chars == 0) { env-ExceptionClear(); // RPF throw std::runtime_error("GetStringUTFChars returned 0"); } m_utf8.assign(utf8Chars); env-ReleaseStringUTFChars(instance, utf8Chars); } std::string str() const { return m_utf8; } }; Simultaneous usage of the two C++ implementations could likely be a reason for the crash, but that should not be happening. Any ideas?

  Read the article

• Why does ffmpeg stop randomly in the middle of a process?

  - by acidzombie24

  ffmpeg feels like its taking a long time. I then look at my output file and i see it stops between 6 and 8mbs. A fully encoded file is about 14mb. Why does ffmpeg stop? My code locks up on StandardOutput.ReadToEnd();. I had to kill the process (after seeing it not move for more then 10 seconds when i see it update every second previously) then i get the results of stdout and err. stdout is "" stderr is below. The output msg shows the filesize ended. I also see a drop in my CPU usage when it stops. I copyed the argument from visual studios. CD to the same working directory and ran the cmd (bin/ffmpeg) and pasted the argument. It was able to complete. int soundProcess(string infn, string outfn) { string aa, aa2; aa = aa2 = "DEAD"; var app = new Process(); app.StartInfo.UseShellExecute = false; app.StartInfo.RedirectStandardOutput = true; app.StartInfo.RedirectStandardError = true; //*/ app.StartInfo.FileName = @"bin\ffmpeg.exe"; app.StartInfo.Arguments = string.Format(@"-i ""{0}"" -ab 192k -y {2} ""{1}""", infn, outfn, param); app.Start(); try { app.PriorityClass = ProcessPriorityClass.BelowNormal; } catch (Exception ex) { if (!Regex.IsMatch(ex.Message, @"Cannot process request because the process .*has exited")) throw ex; } aa = app.StandardOutput.ReadToEnd(); aa2 = app.StandardError.ReadToEnd(); app.WaitForExit(); if (aa2.IndexOf("could not find codec parameters") != -1) return 1; else if (aa == "DEAD" || aa2 == "DEAD") return -1; else if (aa2.Length != 0) return -2; else return 0; } The output of stderr. stdout is empty. FFmpeg version SVN-r15815, Copyright (c) 2000-2008 Fabrice Bellard, et al. configuration: --enable-memalign-hack --enable-postproc --enable-swscale --enable-gpl --enable-libfaac --enable-libfaad --enable-libgsm --enable-libmp3lame --enable-libvorbis --enable-libtheora --enable-libx264 --enable-libxvid --disable-ffserver --disable-vhook --enable-avisynth --enable-pthreads libavutil 49.12. 0 / 49.12. 0 libavcodec 52. 3. 0 / 52. 3. 0 libavformat 52.23. 1 / 52.23. 1 libavdevice 52. 1. 0 / 52. 1. 0 libswscale 0. 6. 1 / 0. 6. 1 libpostproc 51. 2. 0 / 51. 2. 0 built on Nov 13 2008 10:28:29, gcc: 4.2.4 (TDM-1 for MinGW) Input #0, mov,mp4,m4a,3gp,3g2,mj2, from 'C:\dev\src\trunk\prjname\prjname\App_Data/temp/m/o/6304266424778814852': Duration: 00:12:53.36, start: 0.000000, bitrate: 154 kb/s Stream #0.0(und): Audio: aac, 44100 Hz, stereo, s16 Output #0, ipod, to 'C:\dev\src\trunk\prjname\prjname\App_Data\temp\m\o\2.m4a': Stream #0.0(und): Audio: libfaac, 44100 Hz, stereo, s16, 192 kb/s Stream mapping: Stream #0.0 -> #0.0 Press [q] to stop encoding size= 87kB time=4.74 bitrate= 150.7kbits/s size= 168kB time=9.06 bitrate= 151.9kbits/s size= 265kB time=14.28 bitrate= 151.8kbits/s size= 377kB time=20.29 bitrate= 152.1kbits/s size= 487kB time=26.22 bitrate= 152.1kbits/s size= 594kB time=32.02 bitrate= 152.1kbits/s size= 699kB time=37.64 bitrate= 152.1kbits/s size= 808kB time=43.54 bitrate= 152.0kbits/s size= 930kB time=50.09 bitrate= 152.2kbits/s size= 1058kB time=57.05 bitrate= 152.0kbits/s size= 1193kB time=64.23 bitrate= 152.1kbits/s size= 1329kB time=71.63 bitrate= 152.0kbits/s size= 1450kB time=78.16 bitrate= 152.0kbits/s size= 1578kB time=85.05 bitrate= 152.0kbits/s size= 1706kB time=92.00 bitrate= 152.0kbits/s size= 1836kB time=98.94 bitrate= 152.0kbits/s size= 1971kB time=106.25 bitrate= 151.9kbits/s size= 2107kB time=113.57 bitrate= 152.0kbits/s size= 2214kB time=119.33 bitrate= 152.0kbits/s size= 2345kB time=126.39 bitrate= 152.0kbits/s size= 2479kB time=133.56 bitrate= 152.0kbits/s size= 2611kB time=140.76 bitrate= 152.0kbits/s size= 2745kB time=147.91 bitrate= 152.1kbits/s size= 2880kB time=155.20 bitrate= 152.0kbits/s size= 3013kB time=162.40 bitrate= 152.0kbits/s size= 3146kB time=169.58 bitrate= 152.0kbits/s size= 3277kB time=176.61 bitrate= 152.0kbits/s size= 3412kB time=183.90 bitrate= 152.0kbits/s size= 3540kB time=190.80 bitrate= 152.0kbits/s size= 3670kB time=197.81 bitrate= 152.0kbits/s size= 3805kB time=205.08 bitrate= 152.0kbits/s size= 3932kB time=211.93 bitrate= 152.0kbits/s size= 4052kB time=218.38 bitrate= 152.0kbits/s size= 4171kB time=224.82 bitrate= 152.0kbits/s size= 4277kB time=230.55 bitrate= 152.0kbits/s size= 4378kB time=235.96 bitrate= 152.0kbits/s size= 4486kB time=241.79 bitrate= 152.0kbits/s size= 4592kB time=247.50 bitrate= 152.0kbits/s size= 4698kB time=253.21 bitrate= 152.0kbits/s size= 4804kB time=258.95 bitrate= 152.0kbits/s size= 4906kB time=264.41 bitrate= 152.0kbits/s size= 5012kB time=270.09 bitrate= 152.0kbits/s size= 5118kB time=275.85 bitrate= 152.0kbits/s size= 5234kB time=282.10 bitrate= 152.0kbits/s size= 5331kB time=287.39 bitrate= 151.9kbits/s size= 5445kB time=293.55 bitrate= 152.0kbits/s size= 5555kB time=299.40 bitrate= 152.0kbits/s size= 5665kB time=305.37 bitrate= 152.0kbits/s size= 5766kB time=310.80 bitrate= 152.0kbits/s size= 5876kB time=316.70 bitrate= 152.0kbits/s size= 5984kB time=322.50 bitrate= 152.0kbits/s size= 6094kB time=328.49 bitrate= 152.0kbits/s size= 6212kB time=334.76 bitrate= 152.0kbits/s size= 6327kB time=340.99 bitrate= 152.0kbits/s

  Read the article

• Can't log in via SSH to any accounts set to use /bin/bash as a default shell

  - by Gui Ambros

  I'm trying to install bash as the default shell on a ARM Linux running on an embedded device (Synology DS212+ NAS). But there's something really wrong, and I can't figure out what it is. Symptoms: 1) Root has /bin/bash as default shell, and can log in normally via SSH: $ grep root /etc/passwd root:x:0:0:root:/root:/bin/bash $ ssh root@NAS root@NAS's password: Last login: Sun Dec 16 14:06:56 2012 from desktop # 2) joeuser has /bin/bash as default shell, and receives "Permission denied" when trying to log in via SSH: $ grep joeuser /etc/passwd joeuser:x:1029:100:Joe User:/home/joeuser:/bin/bash $ ssh joeuser@localhost joeuser@NAS's password: Last login: Sun Dec 16 14:07:22 2012 from desktop Permission denied, please try again. Connection to localhost closed. 3) changing joeuser's shell back to /bin/sh: $ grep joeuser /etc/passwd joeuser:x:1029:100:Joe User:/home/joeuser:/bin/sh $ ssh joeuser@localhost Last login: Sun Dec 16 15:50:52 2012 from localhost $ To make things even more strange, I can log in as joeuser using /bin/bash using the serial console (!). Also a su - joeuser as root works fine, so the bash binary itself is working fine. In an act of despair, I changed joeuser's uid to 0 on /etc/passwd, but also didn't work, so it doesn't seem to be anything permission related. Seems that bash is doing some extra checking that sshd didn't like, and blocking the connections for non-root users. Maybe some sort of sanity checking - or terminal emulation - that is triggering the SIGCHLD, but only when called via ssh. I already went through every single item on sshd_config, and also put SSHD in debug mode, but didn't find anything strange. Here's my /etc/ssh/sshd_config: LogLevel DEBUG LoginGraceTime 2m PermitRootLogin yes RSAAuthentication yes PubkeyAuthentication yes AuthorizedKeysFile %h/.ssh/authorized_keys ChallengeResponseAuthentication no UsePAM yes AllowTcpForwarding no ChrootDirectory none Subsystem sftp internal-sftp -f DAEMON -u 000 And here's the output from /usr/syno/sbin/sshd -d, showing the failed attempt of joeuser trying to log in, with /bin/bash as the shell: debug1: Config token is loglevel debug1: Config token is logingracetime debug1: Config token is permitrootlogin debug1: Config token is rsaauthentication debug1: Config token is pubkeyauthentication debug1: Config token is authorizedkeysfile debug1: Config token is challengeresponseauthentication debug1: Config token is usepam debug1: Config token is allowtcpforwarding debug1: Config token is chrootdirectory debug1: Config token is subsystem debug1: HPN Buffer Size: 87380 debug1: sshd version OpenSSH_5.8p1-hpn13v11 debug1: read PEM private key done: type RSA debug1: private host key: #0 type 1 RSA debug1: read PEM private key done: type DSA debug1: private host key: #1 type 2 DSA debug1: read PEM private key done: type ECDSA debug1: private host key: #2 type 3 ECDSA debug1: rexec_argv[0]='/usr/syno/sbin/sshd' debug1: rexec_argv[1]='-d' Set /proc/self/oom_adj from 0 to -17 debug1: Bind to port 22 on ::. debug1: Server TCP RWIN socket size: 87380 debug1: HPN Buffer Size: 87380 Server listening on :: port 22. debug1: Bind to port 22 on 0.0.0.0. debug1: Server TCP RWIN socket size: 87380 debug1: HPN Buffer Size: 87380 Server listening on 0.0.0.0 port 22. debug1: Server will not fork when running in debugging mode. debug1: rexec start in 6 out 6 newsock 6 pipe -1 sock 9 debug1: inetd sockets after dupping: 4, 4 Connection from 127.0.0.1 port 52212 debug1: HPN Disabled: 0, HPN Buffer Size: 87380 debug1: Client protocol version 2.0; client software version OpenSSH_5.8p1-hpn13v11 SSH: Server;Ltype: Version;Remote: 127.0.0.1-52212;Protocol: 2.0;Client: OpenSSH_5.8p1-hpn13v11 debug1: match: OpenSSH_5.8p1-hpn13v11 pat OpenSSH* debug1: Enabling compatibility mode for protocol 2.0 debug1: Local version string SSH-2.0-OpenSSH_5.8p1-hpn13v11 debug1: permanently_set_uid: 1024/100 debug1: MYFLAG IS 1 debug1: list_hostkey_types: ssh-rsa,ssh-dss,ecdsa-sha2-nistp256 debug1: SSH2_MSG_KEXINIT sent debug1: SSH2_MSG_KEXINIT received debug1: AUTH STATE IS 0 debug1: REQUESTED ENC.NAME is 'aes128-ctr' debug1: kex: client->server aes128-ctr hmac-md5 none SSH: Server;Ltype: Kex;Remote: 127.0.0.1-52212;Enc: aes128-ctr;MAC: hmac-md5;Comp: none debug1: REQUESTED ENC.NAME is 'aes128-ctr' debug1: kex: server->client aes128-ctr hmac-md5 none debug1: expecting SSH2_MSG_KEX_ECDH_INIT debug1: SSH2_MSG_NEWKEYS sent debug1: expecting SSH2_MSG_NEWKEYS debug1: SSH2_MSG_NEWKEYS received debug1: KEX done debug1: userauth-request for user joeuser service ssh-connection method none SSH: Server;Ltype: Authname;Remote: 127.0.0.1-52212;Name: joeuser debug1: attempt 0 failures 0 debug1: Config token is loglevel debug1: Config token is logingracetime debug1: Config token is permitrootlogin debug1: Config token is rsaauthentication debug1: Config token is pubkeyauthentication debug1: Config token is authorizedkeysfile debug1: Config token is challengeresponseauthentication debug1: Config token is usepam debug1: Config token is allowtcpforwarding debug1: Config token is chrootdirectory debug1: Config token is subsystem debug1: PAM: initializing for "joeuser" debug1: PAM: setting PAM_RHOST to "localhost" debug1: PAM: setting PAM_TTY to "ssh" debug1: userauth-request for user joeuser service ssh-connection method password debug1: attempt 1 failures 0 debug1: do_pam_account: called Accepted password for joeuser from 127.0.0.1 port 52212 ssh2 debug1: monitor_child_preauth: joeuser has been authenticated by privileged process debug1: PAM: establishing credentials User child is on pid 9129 debug1: Entering interactive session for SSH2. debug1: server_init_dispatch_20 debug1: server_input_channel_open: ctype session rchan 0 win 65536 max 16384 debug1: input_session_request debug1: channel 0: new [server-session] debug1: session_new: session 0 debug1: session_open: channel 0 debug1: session_open: session 0: link with channel 0 debug1: server_input_channel_open: confirm session debug1: server_input_global_request: rtype [email protected] want_reply 0 debug1: server_input_channel_req: channel 0 request pty-req reply 1 debug1: session_by_channel: session 0 channel 0 debug1: session_input_channel_req: session 0 req pty-req debug1: Allocating pty. debug1: session_new: session 0 debug1: session_pty_req: session 0 alloc /dev/pts/1 debug1: server_input_channel_req: channel 0 request shell reply 1 debug1: session_by_channel: session 0 channel 0 debug1: session_input_channel_req: session 0 req shell debug1: Setting controlling tty using TIOCSCTTY. debug1: Received SIGCHLD. debug1: session_by_pid: pid 9130 debug1: session_exit_message: session 0 channel 0 pid 9130 debug1: session_exit_message: release channel 0 debug1: session_by_tty: session 0 tty /dev/pts/1 debug1: session_pty_cleanup: session 0 release /dev/pts/1 Received disconnect from 127.0.0.1: 11: disconnected by user debug1: do_cleanup debug1: do_cleanup debug1: PAM: cleanup debug1: PAM: closing session debug1: PAM: deleting credentials Here you have the full output of sshd -dd, together with ssh -vv. Bash: # bash --version GNU bash, version 3.2.49(1)-release (arm-none-linux-gnueabi) Copyright (C) 2007 Free Software Foundation, Inc. The bash binary was cross compiled from source. I also tried using a pre-compiled binary from the Optware distribution, but had the exact same problem. I checked for missing shared libraries using objdump -x, but they're all there. Any ideas what could be causing this "Permission denied, please try again."? I'm almost diving in the bash source code to investigate, but trying to avoid hours chasing something that may be silly.

  Read the article

• Django ImageField issue with JPEG's

  - by Kieran Lynn

  I am having a major issue with PIL (Python Image Library) in Django and have jumpped through a lot of hoops and have thus far not been able to figure out what the root of the issue is. The problem essentially breaks down to not being able to upload JPEG images through the ImageField in the Django admin. But the issue is not as simple as installing libjpeg. First, I installed PIL (through Buildout) and realized once it was installed that I had not installed libjpeg because JPEG support was not available. Having not setup the server myself, I just assumed that it was not installed and I compiled libjpeg 8 from the source. This ended up in my /usr/local/lib/ directory. I cleared out my Buildout files and rebuilt everything. This time when PIL compiled I had JPEG support. But I went to the Django Admin and tried to upload a JPEG though an ImageField with no luck. I got the "Upload a valid image. The file you uploaded was either not an image or a corrupted image" error. Just as a test I opened up a the Djano shell and ran the following: > import Image > i = Image.open( "/absolute_path/file.jpg" ) > print i <JpegImagePlugin.JpegImageFile image mode=RGB size=940x375 at 0x7F908C529BD8> This runs with no errors and shows that PIL is able to open JPEG's. After doing some reading, I come across this thread: Is it possible to control which libraries apache uses? Looks like PHP also uses libjpeg and is loading before Django, and therefor loading libjpeg 6.2 before. This is show when using lsof: COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME apache2 2561 www-data mem REG 202,1 146032 639276 /usr/lib/libjpeg.so.62.0.0 So my thought is that I should be using libjpeg 6.2. So I removed libjpeg located in my /usr/local/lib directory. After rereading the PIL installation instructions, I realized that I might not have the dev/header files for libjpeg that PIL needs. So I also uninstalled libjpeg using the aptitude uninstaller (sudo aptitude remove libjpeg62). Then to ensure that I got the header files that PIL needed I installed libjpeg using aptitude: (sudo aptget install libjpeg62-dev). From here I cleaned out my Buildout directory, and reran Buildout, which in turn reinstalled PIL. Once again, I have JPEG support, now using the libjpeg62. So I go to test in the Django Admin. Still no JPEG support. So I wanted to test JPEG support in general and see if the exception was not handled, what kind of error it would throw. So in my homepage view I added the following code to open a JPEG image: import Image i = Image.open( "/absolute_path/file.jpg" ) v = i.verify() Then I pass i to the HTML view just to easily see the output. I deploy these changes to the server and restart. I am surprised not to see an error and get the following output: {{ i }} - <JpegImagePlugin.JpegImageFile image mode=RGB size=940x375 at 0x7F908C529BD8> {{ v }} - None So at this point I am really confused: Why can I successfully open a JPEG while the admin cannot? Am I missing something, is this not an issue with libjpeg? If not an issue with libjpeg, why can I upload a PNG with no issues? Any help would be much appreciated, I have been on this for 2 days debugging with no luck. Setup: 1. Rackspace Cloud Server 2. Ubuntu 10.04 3. Django 1.2.3 (Installed though Buildout) 4. PIL 1.1.7 (Installed though Buildout) 5. libjpeg 6.2 (installed through aptitude (sudo aptget install libjpeg62-dev)

  Read the article

• PHP framework question

  - by iconiK

  I'm currently working on a browser-based MMO and have chosen the LAMP stack because of the extremely low cost to start with in production (versus Windows + IIS + ASP.NET/C# + SQL Server, even though I have MSDN Universal). However I will need a PHP framework for this as it's no easy task. I am not restricted by anything other than the ability to run on Linux, as I will use a dedicated cloud hosting solution (and a VMWare image for development) and can configure it as needed. In no specific order: It has to be easily scalable; this is crucial. If the game becomes a steady success it will eventually outgrow the server beyond what the host provides and would have to be moved to several load-balanced servers. It is crucial that this can be done with minimum effort. I do know this might require following strict conventions, so if you know of any for your suggested framework please explain what would be needed. It has to provide modules for all the core tasks: authentication, ACL, database access, MVC, and so on. One or two missing modules are fine, as long as they can easily be written and integrated. It should support internationalization. I think there is no excuse for any web framework not to provide means of translating the application and switching between languages without a lot of effort from the programmer. Must have very good community support and preferably commercial support as well. Yes, I do know QCodo/QCubed is so nice, but it is not mature enough for this task. Smooth AJAX support is required. Whether the framework comes with AJAX-capable widgets or has an easy way of adding AJAX is not relevant, as long as AJAX is easily doable. I plan to use jQuery + Dojo or one of them alone - not exactly sure. Auto-magically doing stuff when it improves readability and relieves a lot of effort would be especially nice if it is generally reliable and does not interfere with other requirements. This seems to be the case of CakePHP. I have read a lot of comparisons and I know it's a really hot debate. The general answer is "try and see for yourself what suits you". However, I can't say it is easy for this task and I'm calling for your experience with building applications with similar requirements. So far I'm tied up between Zend and CakePHP by the general criteria, however, all well-known frameworks offer the same functionality in some way or another with different approaches each with it's own advantages and disadvantages. Edits: I am kinda new to MVC, however, I am willing to learn it and I don't care if a framework is easier for those new to MVC. I have lots of time to learn MVC and any other architectures (or whatever they're called) you recommend. I will use Zend as a utility "framework", even though it's just a collection of libraries (some good ones though, as I have been told). Current PHP contenders are: CakePHP, Kohana, Zend alone.

  Read the article

• "interface not found" in WCF Moniker without registration for excel

  - by tbischel

  I'm trying to connect excel to a WCF service, but I can't seem to get even a trivial case to work... I get an Invalid Syntax error when I try and create the proxy in excel. I've attached the visual studio debugger to excel, and get that the real error is "interface not found". I know the service works because the test client created by visual studio is ok... so the problem is in the VBA moniker string. I'm hoping to find one of two things: 1) a correction to my moniker string that will make this work, or 2) an existing sample project to download that has the source for both the host and client that does work. Here is the code for my VBA client: Dim addr As String addr = "service:mexAddress=net.tcp://localhost:7891/Test/WcfService1/Service1/mex, " addr = addr + "address=net.tcp://localhost:7891/Test/WcfService1/Service1/, " addr = addr + "contract=IService1, contractNamespace=http://tempuri.org, " addr = addr + "binding=NetTcpBinding_IService1, bindingNamespace=""http://tempuri.org""" MsgBox (addr) Dim service1 As Object Set service1 = GetObject(addr) MsgBox service1.Test(12) I have the following service: [ServiceContract] public interface IService1 { [OperationContract] string GetData(int value); } public class Service1 : IService1 { public string GetData(int value) { return string.Format("You entered: {0}", value); } } It has the following config file: <?xml version="1.0" encoding="utf-8" ?> <configuration> <system.web> <compilation debug="true" /> </system.web> <!-- When deploying the service library project, the content of the config file must be added to the host's app.config file. System.Configuration does not support config files for libraries. --> <system.serviceModel> <services> <service behaviorConfiguration="WcfService1.Service1Behavior" name="WcfService1.Service1"> <endpoint address="" binding="netTcpBinding" bindingConfiguration="" contract="WcfService1.IService1"> <identity> <dns value="localhost" /> </identity> </endpoint> <endpoint address="mex" binding="mexTcpBinding" bindingConfiguration="" contract="IMetadataExchange" /> <host> <baseAddresses> <add baseAddress="net.tcp://localhost:7891/Test/WcfService1/Service1/" /> </baseAddresses> </host> </service> </services> <behaviors> <serviceBehaviors> <behavior name="WcfService1.Service1Behavior"> <serviceMetadata httpGetEnabled="false" /> <serviceDebug includeExceptionDetailInFaults="false" /> </behavior> </serviceBehaviors> </behaviors> </system.serviceModel> </configuration>

  Read the article

• In Ruby, how to I read memory values from an external process?

  - by grg-n-sox

  So all I simply want to do is make a Ruby program that reads some values from known memory address in another process's virtual memory. Through my research and basic knowledge of hex editing a running process's x86 assembly in memory, I have found the base address and offsets for the values in memory I want. I do not want to change them; I just want to read them. I asked a developer of a memory editor how to approach this abstract of language and assuming a Windows platform. He told me the Win32API calls for OpenProcess, CreateProcess, ReadProcessMemory, and WriteProcessMemory were the way to go using either C or C++. I think that the way to go would be just using the Win32API class and mapping two instances of it; One for either OpenProcess or CreateProcess, depending on if the user already has th process running or not, and another instance will be mapped to ReadProcessMemory. I probably still need to find the function for getting the list of running processes so I know which running process is the one I want if it is running already. This would take some work to put all together, but I am figuring it wouldn't be too bad to code up. It is just a new area of programming for me since I have never worked this low level from a high level language (well, higher level than C anyways). I am just wondering of the ways to approach this. I could just use a bunch or Win32API calls, but that means having to deal with a bunch of string and array pack and unpacking that is system dependant I want to eventually make this work cross-platform since the process I am reading from is produced from an executable that has multiple platform builds, (I know the memory address changes from system to system. The idea is to have a flat file that contains all memory mappings so the Ruby program can just match the current platform environment to the matching memory mapping.) but from the looks of things I'll just have to make a class that wraps whatever is the current platform's system shared library memory related function calls. For all I know, there could already exist a Ruby gem that takes care of all of this for me that I am just not finding. I could also possibly try editing the executables for each build to make it so whenever the memory values I want to read from are written to by the process, it also writes a copy of the new value to a space in shared memory that I somehow have Ruby make an instance of a class that is a pointer under the hood to that shared memory address and somehow signal to the Ruby program that the value was updated and should be reloaded. Basically a interrupt based system would be nice, but since the purpose of reading these values is just to send to a scoreboard broadcasted from a central server, I could just stick to a polling based system that sends updates at fixed time intervals. I also could just abandon Ruby altogether and go for C or C++ but I do not know those nearly as well. I actually know more x86 than C++ and I only know C as far as system independent ANSI C and have never dealt with shared system libraries before. So is there a gem or lesser known module available that has already done this? If not, then any additional information as to how to accomplish this would be nice. I guess, long story short, how do I do all this? Thanks in advance, Grg PS: Also a confirmation that those Win32API calls should be aimed at the kernel32.dll library would be nice.

  Read the article

• curl_init undefined?

  - by udaya

  Hi I am importing the contacts from gmail to my page ..... The process doesnot work due to this error 'curl_init' is not defined The suggestion i got is to 1.uncomment destination curl.dll 2.copy the following libraries to the windows/system32 dir. ssleay32.dll libeay32.dll 3.copy php_curl.dll to windows/system32 After trying all these i refreshed my xampp Even then error occurs This is my page where i am trying to import the gmail contacts ` // set URL and other appropriate options curl_setopt($ch, CURLOPT_URL, "http://www.example.com/"); curl_setopt($ch, CURLOPT_HEADER, 0); // grab URL and pass it to the browser curl_exec($ch); // close cURL resource, and free up system resources curl_close($ch); ? "HOSTED_OR_GOOGLE", "Email" = $_POST['Email'], echo "Passwd" = $_POST['Passwd'], "service" = "cp", "source" = "tutsmore/1.2" ); //Now we are going to post these datas to the clientLogin url. // Initialize the curl object with the $curl = curl_init($clientlogin_url); //Make the post true curl_setopt($curl, CURLOPT_POST, true); //Passing the above array of parameters. curl_setopt($curl, CURLOPT_POSTFIELDS, $clientlogin_post); //Set this for authentication and ssl communication. curl_setopt($curl, CURLOPT_HTTPAUTH, CURLAUTH_ANY); //provide false to not to check the server for the certificate. curl_setopt($curl, CURLOPT_SSL_VERIFYPEER, false); //Tell curl to just don't echo the data but return it to a variable. curl_setopt($curl, CURLOPT_RETURNTRANSFER, 1); //The variable containing response $response = curl_exec($curl); //Check whether the user is successfully login using the preg_match and save the auth key if the user //is successfully logged in preg_match("/Auth=([a-z0-9_-]+)/i", $response, $matches); $auth = $matches[1]; // Include the Auth string in the headers $headers = array("Authorization: GoogleLogin auth=" . $auth); // Make the request to the google contacts feed with the auth key $curl = curl_init('http://www.google.com/m8/feeds/contacts/default/full?max-results=10000'); //passing the headers of auth key. curl_setopt($curl, CURLOPT_HTTPHEADER, $headers); //Return the result in a variable curl_setopt($curl, CURLOPT_RETURNTRANSFER, 1); //the variable with the response. $feed = curl_exec($curl); //Create empty array of contacts echo "contacts".$contacts=array(); //Initialize the DOMDocument object $doc=new DOMDocument(); //Check whether the feed is empty //If not empty then load that feed. if (!empty($feed)) $doc-loadHTML($feed); //Initialize the domxpath object and provide the loaded feed $xpath=new DOMXPath($doc); //Get every entry tags from the feed. $query="//entry"; $data=$xpath-query($query); //Process each entry tag foreach ($data as $node) { //children of each entry tag. $entry_nodes=$node-childNodes; //Create a temproray array. $tempArray=array(); //Process the child node of the entry tag. foreach($entry_nodes as $child) { //get the tagname of the child node. $domNodesName=$child-nodeName; switch($domNodesName) { case 'title' : { $tempArray['fullName']=$child-nodeValue; } break; case 'email' : { if (strpos($child-getAttribute('rel'),'home')!==false) $tempArray['email_1']=$child-getAttribute('address'); elseif(strpos($child-getAttribute('rel'),'work')!=false) $tempArray['email_2']=$child-getAttribute('address'); elseif(strpos($child-getAttribute('rel'),'other')!==false) $tempArray['email_3']=$child-getAttribute('address'); } break; } } if (!empty($tempArray['email_1']))$contacts[$tempArray['email_1']]=$tempArray; if(!empty($tempArray['email_2'])) $contacts[$tempArray['email_2']]=$tempArray; if(!empty($tempArray['email_3'])) $contacts[$tempArray['email_3']]=$tempArray; } foreach($contacts as $key=$val) { //Echo the email echo $key.""; } } else { //The form ? " method="POST" Email: Password: tutsmore don't save your email and password trust us. ` code is completely provided for debugging if any optimization is needed i will try to optimize the code

  Read the article

• Google Drive Update keeps throwing an error when I try to save a thumbnail

  - by Dano64

  The Base64 string checks out fine. I was able to export it to another website and download it again as my image. When I try to do an update using the Drive Javascript api, it just keeps returning this error: Invalidvaluefor:Notavalidbase64bytestring I also true making the string URL safe. Per this page https://google-api-client-libraries.appspot.com/documentation/drive/v2/python/latest/drive_v2.files.html Am I doing something wrong here, the documentation says send Base64, the string is valid and, the string is intact throughout the process, but Google will not accept it? I am using the javascript api, I think there is maybe a bug sending the thumbnail using the javascript api. This is the request Request URL:https://www.googleapis.com/upload/drive/v2/files/?uploadType=multipart Request Method:POST Status Code:400 Bad Request **Request Headers** :host:www.googleapis.com :method:POST :path:/upload/drive/v2/files/?uploadType=multipart :scheme:https :version:HTTP/1.1 accept:*/* accept-encoding:gzip,deflate,sdch accept-language:en-US,en;q=0.8 authorization:Bearer ya29.AHES6ZQr...YXDacdY4 content-length:14313 content-type:multipart/mixed; boundary="--mpart_delim" origin:https://www.googleapis.com x-javascript-user-agent:google-api-javascript-client/1.1.0-beta x-origin:https://app.pinteract.com x-referer:https://app.pinteract.com **Query String Parameters** uploadType:multipart **Request Payload** ----mpart_delim Content-Type: application/json {"id":null,"title":"Test Pinup.pint","mimeType":"application/vnd.pinteract.pint","thumbnail":{"mimeType":"image/png","image":"iVBORw0KGgoAAAANSUh...UVORK5CYII%3D"}} ----mpart_delim Content-Type: application/vnd.pinteract.pint Content-Transfer-Encoding: binary { "header" : {"id":"215A660A"} "members" : [ {"id":"100523752012631912873"} ], "manifest" : [ {"id":"0000","ele":[],"own":"100523752012631912873","dtc":1371679680000,"txt":"&Delta; Created","typ":0} ], "elements" : [ {"id":"0F54","x":560,"y":264,"bak":"#44ff44","own":"100523752012631912873","srt":"544","sta":0,"wid":120,"hgt":120,"dtc":0,"rec":"","txt":"This is Note"} ] } ----mpart_delim-- **Response Headers** content-length:10848 content-type:application/json date:Mon, 01 Jul 2013 14:41:33 GMT server:HTTP Upload Server Built on Jun 25 2013 11:32:14 (1372185134) status:400 Bad Request version:HTTP/1.1 This is the Response { "error": { "errors": [ { "domain": "global", "reason": "invalid", "message": "Invalid value for: Not a valid base64 byte string: iVBORw0KGgoAAAANSUhEUg...AASUVORK5CYII%3D" } ], "code": 400, "message": "Invalid value for: Not a valid base64 byte string: iVBORw0KGgoAAAANSU...lRtkAAAAASUVORK5CYII%3D" } } Raw Base64 String iVBORw0KGgoAAAANSUhEUgAAAGAAAABgCAYAAADimHc4AAAAGXRFWHRTb2Z0d2FyZQBBZG9iZSBJbWFnZVJlYWR5ccllPAAADjVJREFUeNrsXX2MHVUVP3fevH27SxfKhyBCsIqoKOhCBBISY5Hyj2JSGuXLP6SJwYAYICgxsUBr1AhqbE2I8Q9jjYE/CLFbP4IxVbaIYjAmS0wUC6ELRGy7tPt2t9vd997MPd6Z+3Xunfsq1r7tvNe56TAfO2/ezO93zu/ce+6ZB0DVqla1qlWtalWrWtWqVrWqVa1qJ1Nj/XCTm5+bHeUcz9+3f25tmvLVSYePIyLIBRhX24yxKXH63Kljw5Ni97UfbVhzpCLgGNs3/jp//r9en72l3UnWCsCvSjrpmQA54Nkq28q3FQn5mucL5OuIsUPi6f5Si6KJVasaT26/+T1vVgS8hfbl3+27br65dE+r1VknrH6IIfkjolmh/A8hwYJv1lySInYXhXc8W49r235++yVPVQQE2lee3n/d3OzS5tZS+2oWurlMYgj4qI45HsApCZYAzgFSsU7FfhSx5+txtHnnHR9+qiJAtPsnD1y4MLf09aXF9q3ZzTAmb8ohQaKtHEDLkGv9qIBHBbgmICXrlKyjKHoirkWbfn3X+EsnLQH37dr3mebs4o8x4WMSfGbAtyQoDSLga8BBeQJqqXE8QQIt12D2syVR2+LcxVpcu/23d1/++ElFwPdeXB555eWZ7x453LozEvuRtvqMgCyAhm7QyI7Sf7BEcI4mCNP9lBKhrD9R2zkJqVwLWfpOYyje8tSXLlsceAIy8Pf8Y98vOq1kXQZ8JG5By06kLZ/5+m8DcEiCMt3XXpCTwN0YkKrYkFu/0CfpCSC3M1IEEeILJ0ca9et/c/fliwNLQAb+SxR8JTkRJUAdy4DOtxCdQGyDb6ALyq0HuEHYyo+OAYlaUkVI7hkAk8ON+Ppd935kceAIMOC3BfjiayUB1gO0FAG4QTjfN9pTjAO0/0+9ICeDBmGyJDQoEzIyjxCr3YKET/7+vitWhIRopQh4+Z/7fyAtX4PPQG/X1JLt19Rit8XfIjDb7uftdWqa0Ox8sNfIF/CvK4mPFAB6yf4uaPzYYit5dKVwWREC7vrV619sLXU+L8Gg4AEBlXgFBdN8JgQ6M+fUHJDJNWiQD1yHkXOlDLLMcz53xTf/dNtASNBXn5l598y++b+L3k2j5gFdU1KkA2/kdEOR9IDsOpSCQBN4M/3nJuCaOEC03pEhJTuJJ0XtbEHsxBG75PmvXb2nrz3gzZnD2wVCjQgYsUAgVm2lRwdiR6LA9w4lS2YNnlcRq/avB653MfrdnueJf/XllP+kryXozl++toF30o9GnoVrvZU9HtINNaD44BFgHSmx4DP/swRkKz9F3WcGCOt9NQ0MwtWXbnn2xr4loL2cbNYDLAdcQgTz9FpbtAaUERANsJEFklHvIOMISiBzrqlJD4w/yKJJEL2lh/qSgDt2vrohTdJL/QdzBlvMtUQ6Io6cXgwBngZWD/xIeZVeM49o5g30KEGh+1Td4g+8f/Mfbuw7Atotbf0EVOchmQuGts5APsh4UNCbSBoDPE/oYt3B48zekzEIVF7Ae+cFPSHgCxOvXpwm/FLHslQ6GZgLfNfFk54iuMwhyAf2aJLTfcHg8cwLLnzwmQ/2DQFCem4pgOR4gzviLQDD3gIRzE1h+PshyaEB3wPYORccImVyUHR1P9s3BCSd9CZ/sOFPsjCV4ymkHViYCJOmYEV5co8xF1DnHrDwfe6cg1wzdZCRE8WY4tN9QYAY9Z4rBj7vzZNpiMWRHqJ5yKMCQcBg3cgJkpFPzjtkRw7x+ruwqxQBkUxNnGgXXbBp8rzSE3BksT3uZDDJUJahD7hKsGFACug+Cx8vegQWRtEsOOzHwO1h8WEQncOiSzpeegLaneQqB2wMEKHWGHhgigUzs2FYsHyAcNzonmfBgneZBfDoORk03nlF6QkQffCL3WdFM4uFSLUWHcuzTqPrTtCdkvSMlwb5ozZVPQHo3g8L+qgjOZ7t5HvHvScUH/ceUMrPrmkTzW+agbRrZswIkXmGKHUbPWCQWDH6shUK8n4g9aVQGQFT3+kYguGdGAoWHOas0nsAqowlnbUyD+BPpoNX56M/R7wAzHkItjLCDaQO1gZXBOcQ3Tego4dzYAsBMBw5yukB8o6ZARiVZSs7l8e8NSOKr60euwRM39J1bZBZG/KsRTuxhRoE+Q6T3gZqNPk0pWUXsfwEaA/IHyQHX1sZM/CiY9OWLH0GJ66ZSwYJuoYgDxMj9QiFeiFbzIWGA3oOBKrvdIWF9j9Z8NUPHoBoQUVq7RJsbnpCTIFNgEeZUANFghmZogWeYVG6bAmirYqgJSwFItC3eNdwqIdwpN7SBx7A0YZdRCo1ECQiMlYvk3WcDJAi7QGBYAzepDyqSXlTpKXWEPAI7sQk7RmWJFPeqGXInNcHHtBKUhiJa/KBsoq0CBSwQJIENg2RP7AqyNIdpYhYnfYI9KYo/SlJWxdKSSHgBTyAQzfZcqc9OfGG0veC4ijaTcsEgdZskqo1W7/jVrbpEhL6N7kPzpwu99dqHljPDaNXqGuvby0cQyQpY+EK8BSsV4i2u/QecLjdmR4biq2Gc5WCZmgSXJwzKeYkqqKyfDqyjZT12VEtFrqZ6FTC0bJ0S7AGMD8PSB2R8RjrOUhK3FPQniIlSpAxXXoCFlrJ1Kp6rLScmVElU2gzf5TFbJIMzawYM8GWBXI4tEoaObrvB5A6UBMLPI8qWj6aLmdeyqjApx6QSqKmjjdePSlL+dQPX5gdjqPVea2OKqqyBVFuXZCukgOg9TvZMVuamGc3/RJFJAMsXqyOowW53CtF0UW6VtK4qpgGaIvtlrhOS6yz8hS5na2xefDha0/vg4FYrsUT4v5vy1PD3JUfSjnKMZvt66PNxWA+k8VtahjdHhCQFzVoebpTC0S2uV+2SOOCkSFl/WitPy9hlN4x0TcTMjOLrZ1GRwMFsno77yVxWjzlWqUTfNH/u1to637GBT8/jxbr6uCOhBR1TqplCKTscNDygzt7gVXPKuM+8ejUbKOWyRCt61TlHqYQihVKSY7+loy0eqZAgkCRrl8d7b8Zk5rXlVSlnC5bF8dasiJOV8Zp6RHb0DzUA/npmQfkwXi5s80CwF2rRbdc0PEQ9eJEwdqJ9yQFj+HBc5MA+Nx5m9LuJ0R+8hhhJCgnd1uvcOoZAS/sn9sqBmVNCnoIzAJwafdj+uUKnvKuwCeBgCutHozM+DEhUYDbNSgScu1vit2tfUfA/CPrmgvtRHqBM4gCByBOQKTAUPAl8FwAb4tpE97dS5JuZFNZUtadKsATQ4RYAIhHwLameJa+IyBrfzswv3WxI7yASIEPjvumilpS1xMK3UjHe3xC1DXQexmDyhEJwh2OLviuJwjgcWsvMep5efr4t55b//ZThnbk4wBw+/6F2n3wS0v8EnUyIYM0tex1Q8l26qUkUjViThT4HZSLDLyQB9+ODLzZuTcI65/oawKyduW3/7zj9OH6+ihEgDcA82t3GEBxMkQBqntFvPC+MDjdS5qm0IGWgt/RwKveT7Yvjk8I8G/oNTbxShDw4qHDGz901tia0bg2jirvo9fcIQC7lJ+gk6RHPdEPUMhcOj9ZAMW353O5kgAroNU2pxKUpxw2rgQ2K/aS3jsf3D1+/qrhp0fE2MCkIzwJ6lYy6Fu/JcCf8QqMB8Baf6JAT8i2lp9EyY441hSfuWbukXVTA0VATsIDu8fPO6Xx9HBGAi1NJ2XkAMUKtcKcJ523JeBz5ycLbMo5VUDbtZYgua/BF72fpvjMNc0VAn/FCcjaBQ9Mjr9jtJF7An1zhQZiO0VvM6VQSEdbDwCPACpDKenVpMbybW9Hb2ejXfHpFQX/hBCQk7Bpcvzs4aEdo3G0hr4fHEGoiNdNRdOUhEuElSOdTEvABt2EkNFx+v3CCwCmUfZ4plYaixP2Yx2n3r9r9QWnNHasrsdrQ68KwX8hAOiEjJ421H18oGkFRQSXg6+O7gUZr4BJcYUbejnYKiUBuq3ZNHnPGY36Q42IrWYBL2B+4Szt/2vZAfJDTd6kigZeSw7J82R6v2X2kXVbT+Tzl+IHm4Q3rDlnuP6Q6KbeVjfxAPWbis7NojcdqSfWubJ8riUIrAfo1ENiPAS2i2NbRE9n+kQ/e6l+suw0QcSZwhtEL8kQQUvbTb0aLec0lk9Gv2AHYwkhQvzbLpYthx6+drosz1zKH+3LPGIsrq2PDu79/vA5F8p3igMEAFjZQV+CrCxNicM/FdY/UQaL7wsCdBsZGcH6GefB2EVXwsi574Pa294FSeM0aNVPpeMyFYQRhtrzEC0dgnTmFWi9sQcW9k5NLr2x5+PQm7ra/klF/F8WcngG4r1/hLG5F+HsQ+fA6OgoDDUaEMdx9rtv0vLTFNqdDrSWl2FhYQEOHNgPyeysCLOzzAsfpWsRDH5jZfb2gSQA3fQFKzMJJ4sHlJaEeFA9QHlB6G1YLFNMGGAPQPqMrKyeEMNgN5pg5V08AU6kNwwsASQQUy/nXdzkhElSPODgs4DMhkioPKA3RJgfvwoFCN6FkIqA4xwDQgTo90eSKgj3oHGe0q5oHBgVZwR0ql5Qz2MAhjwg+2O7Goj1VvtpD6jugb8AJUrMDagEcToSjgn48yCrzkvTBjYZx7khoK6e82AZgu5JQ4Bqi+oZ/10m3e8bAgSQE8dOQE7CJMh3e5fL+oylJiCKom3HSoBYDqdp+pjYLfX/Ta/UBBw5cmSSMbb1WAhgLNqYJMnLZZfL0seAZrN5rwDzfyGhWa/XNx48+OaT/RCv+iIIT0/vvbfRaFwjvOFoMSErLdxeq9Uu27v3le390mFg0IftpptvXetURXDefPyxn01B1apWtapVrWpVq1rVqla1t9L+I8AAvydNUrElRtkAAAAASUVORK5CYII="}],"code":400,"message":"Invalidvaluefor:Notavalidbase64bytestring:iVBORw0KGgoAAAANSUhEUgAAAGAAAABgCAYAAADimHc4AAAAGXRFWHRTb2Z0d2FyZQBBZG9iZSBJbWFnZVJlYWR5ccllPAAADjVJREFUeNrsXX2MHVUVP3fevH27SxfKhyBCsIqoKOhCBBISY5Hyj2JSGuXLP6SJwYAYICgxsUBr1AhqbE2I8Q9jjYE/CLFbP4IxVbaIYjAmS0wUC6ELRGy7tPt2t9vd997MPd6Z+3Xunfsq1r7tvNe56TAfO2/ezO93zu/ce+6ZB0DVqla1qlWtalWrWtWqVrWqVa1qJ1Nj/XCTm5+bHeUcz9+3f25tmvLVSYePIyLIBRhX24yxKXH63Kljw5Ni97UfbVhzpCLgGNs3/jp//r9en72l3UnWCsCvSjrpmQA54Nkq28q3FQn5mucL5OuIsUPi6f5Si6KJVasaT26/+T1vVgS8hfbl3+27br65dE+r1VknrH6IIfkjolmh/A8hwYJv1lySInYXhXc8W49r235++yVPVQQE2lee3n/d3OzS5tZS+2oWurlMYgj4qI45HsApCZYAzgFSsU7FfhSx5+txtHnnHR9+qiJAtPsnD1y4MLf09aXF9q3ZzTAmb8ohQaKtHEDLkGv9qIBHBbgmICXrlKyjKHoirkWbfn3X+EsnLQH37dr3mebs4o8x4WMSfGbAtyQoDSLga8BBeQJqqXE8QQIt12D2syVR2+LcxVpcu/23d1/++ElFwPdeXB555eWZ7x453LozEvuRtvqMgCyAhm7QyI7Sf7BEcI4mCNP9lBKhrD9R2zkJqVwLWfpOYyje8tSXLlsceAIy8Pf8Y98vOq1kXQZ8JG5By06kLZ/5+m8DcEiCMt3XXpCTwN0YkKrYkFu/0CfpCSC3M1IEEeILJ0ca9et/c/fliwNLQAb+SxR8JTkRJUAdy4DOtxCdQGyDb6ALyq0HuEHYyo+OAYlaUkVI7hkAk8ON+Ppd935kceAIMOC3BfjiayUB1gO0FAG4QTjfN9pTjAO0/0+9ICeDBmGyJDQoEzIyjxCr3YKET/7+vitWhIRopQh4+Z/7fyAtX4PPQG/X1JLt19Rit8XfIjDb7uftdWqa0Ox8sNfIF/CvK4mPFAB6yf4uaPzYYit5dKVwWREC7vrV619sLXU+L8Gg4AEBlXgFBdN8JgQ6M+fUHJDJNWiQD1yHkXOlDLLMcz53xTf/dNtASNBXn5l598y++b+L3k2j5gFdU1KkA2/kdEOR9IDsOpSCQBN4M/3nJuCaOEC03pEhJTuJJ0XtbEHsxBG75PmvXb2nrz3gzZnD2wVCjQgYsUAgVm2lRwdiR6LA9w4lS2YNnlcRq/avB653MfrdnueJf/XllP+kryXozl++toF30o9GnoVrvZU9HtINNaD44BFgHSmx4DP/swRkKz9F3WcGCOt9NQ0MwtWXbnn2xr4loL2cbNYDLAdcQgTz9FpbtAaUERANsJEFklHvIOMISiBzrqlJD4w/yKJJEL2lh/qSgDt2vrohTdJL/QdzBlvMtUQ6Io6cXgwBngZWD/xIeZVeM49o5g30KEGh+1Td4g+8f/Mfbuw7Atotbf0EVOchmQuGts5APsh4UNCbSBoDPE/oYt3B48zekzEIVF7Ae+cFPSHgCxOvXpwm/FLHslQ6GZgLfNfFk54iuMwhyAf2aJLTfcHg8cwLLnzwmQ/2DQFCem4pgOR4gzviLQDD3gIRzE1h+PshyaEB3wPYORccImVyUHR1P9s3BCSd9CZ/sOFPsjCV4ymkHViYCJOmYEV5co8xF1DnHrDwfe6cg1wzdZCRE8WY4tN9QYAY9Z4rBj7vzZNpiMWRHqJ5yKMCQcBg3cgJkpFPzjtkRw7x+ruwqxQBkUxNnGgXXbBp8rzSE3BksT3uZDDJUJahD7hKsGFACug+Cx8vegQWRtEsOOzHwO1h8WEQncOiSzpeegLaneQqB2wMEKHWGHhgigUzs2FYsHyAcNzonmfBgneZBfDoORk03nlF6QkQffCL3WdFM4uFSLUWHcuzTqPrTtCdkvSMlwb5ozZVPQHo3g8L+qgjOZ7t5HvHvScUH/ceUMrPrmkTzW+agbRrZswIkXmGKHUbPWCQWDH6shUK8n4g9aVQGQFT3+kYguGdGAoWHOas0nsAqowlnbUyD+BPpoNX56M/R7wAzHkItjLCDaQO1gZXBOcQ3Tego4dzYAsBMBw5yukB8o6ZARiVZSs7l8e8NSOKr60euwRM39J1bZBZG/KsRTuxhRoE+Q6T3gZqNPk0pWUXsfwEaA/IHyQHX1sZM/CiY9OWLH0GJ66ZSwYJuoYgDxMj9QiFeiFbzIWGA3oOBKrvdIWF9j9Z8NUPHoBoQUVq7RJsbnpCTIFNgEeZUANFghmZogWeYVG6bAmirYqgJSwFItC3eNdwqIdwpN7SBx7A0YZdRCo1ECQiMlYvk3WcDJAi7QGBYAzepDyqSXlTpKXWEPAI7sQk7RmWJFPeqGXInNcHHtBKUhiJa/KBsoq0CBSwQJIENg2RP7AqyNIdpYhYnfYI9KYo/SlJWxdKSSHgBTyAQzfZcqc9OfGG0veC4ijaTcsEgdZskqo1W7/jVrbpEhL6N7kPzpwu99dqHljPDaNXqGuvby0cQyQpY+EK8BSsV4i2u/QecLjdmR4biq2Gc5WCZmgSXJwzKeYkqqKyfDqyjZT12VEtFrqZ6FTC0bJ0S7AGMD8PSB2R8RjrOUhK3FPQniIlSpAxXXoCFlrJ1Kp6rLScmVElU2gzf5TFbJIMzawYM8GWBXI4tEoaObrvB5A6UBMLPI8qWj6aLmdeyqjApx6QSqKmjjdePSlL+dQPX5gdjqPVea2OKqqyBVFuXZCukgOg9TvZMVuamGc3/RJFJAMsXqyOowW53CtF0UW6VtK4qpgGaIvtlrhOS6yz8hS5na2xefDha0/vg4FYrsUT4v5vy1PD3JUfSjnKMZvt66PNxWA+k8VtahjdHhCQFzVoebpTC0S2uV+2SOOCkSFl/WitPy9hlN4x0TcTMjOLrZ1GRwMFsno77yVxWjzlWqUTfNH/u1to637GBT8/jxbr6uCOhBR1TqplCKTscNDygzt7gVXPKuM+8ejUbKOWyRCt61TlHqYQihVKSY7+loy0eqZAgkCRrl8d7b8Zk5rXlVSlnC5bF8dasiJOV8Zp6RHb0DzUA/npmQfkwXi5s80CwF2rRbdc0PEQ9eJEwdqJ9yQFj+HBc5MA+Nx5m9LuJ0R+8hhhJCgnd1uvcOoZAS/sn9sqBmVNCnoIzAJwafdj+uUKnvKuwCeBgCutHozM+DEhUYDbNSgScu1vit2tfUfA/CPrmgvtRHqBM4gCByBOQKTAUPAl8FwAb4tpE97dS5JuZFNZUtadKsATQ4RYAIhHwLameJa+IyBrfzswv3WxI7yASIEPjvumilpS1xMK3UjHe3xC1DXQexmDyhEJwh2OLviuJwjgcWsvMep5efr4t55b//ZThnbk4wBw+/6F2n3wS0v8EnUyIYM0tex1Q8l26qUkUjViThT4HZSLDLyQB9+ODLzZuTcI65/oawKyduW3/7zj9OH6+ihEgDcA82t3GEBxMkQBqntFvPC+MDjdS5qm0IGWgt/RwKveT7Yvjk8I8G/oNTbxShDw4qHDGz901tia0bg2jirvo9fcIQC7lJ+gk6RHPdEPUMhcOj9ZAMW353O5kgAroNU2pxKUpxw2rgQ2K/aS3jsf3D1+/qrhp0fE2MCkIzwJ6lYy6Fu/JcCf8QqMB8Baf6JAT8i2lp9EyY441hSfuWbukXVTA0VATsIDu8fPO6Xx9HBGAi1NJ2XkAMUKtcKcJ523JeBz5ycLbMo5VUDbtZYgua/BF72fpvjMNc0VAn/FCcjaBQ9Mjr9jtJF7An1zhQZiO0VvM6VQSEdbDwCPACpDKenVpMbybW9Hb2ejXfHpFQX/hBCQk7Bpcvzs4aEdo3G0hr4fHEGoiNdNRdOUhEuElSOdTEvABt2EkNFx+v3CCwCmUfZ4plYaixP2Yx2n3r9r9QWnNHasrsdrQ68KwX8hAOiEjJ421H18oGkFRQSXg6+O7gUZr4BJcYUbejnYKiUBuq3ZNHnPGY36Q42IrWYBL2B+4Szt/2vZAfJDTd6kigZeSw7J82R6v2X2kXVbT+Tzl+IHm4Q3rDlnuP6Q6KbeVjfxAPWbis7NojcdqSfWubJ8riUIrAfo1ENiPAS2i2NbRE9n+kQ/e6l+suw0QcSZwhtEL8kQQUvbTb0aLec0lk9Gv2AHYwkhQvzbLpYthx6+drosz1zKH+3LPGIsrq2PDu79/vA5F8p3igMEAFjZQV+CrCxNicM/FdY/UQaL7wsCdBsZGcH6GefB2EVXwsi574Pa294FSeM0aNVPpeMyFYQRhtrzEC0dgnTmFWi9sQcW9k5NLr2x5+PQm7ra/klF/F8WcngG4r1/hLG5F+HsQ+fA6OgoDDUaEMdx9rtv0vLTFNqdDrSWl2FhYQEOHNgPyeysCLOzzAsfpWsRDH5jZfb2gSQA3fQFKzMJJ4sHlJaEeFA9QHlB6G1YLFNMGGAPQPqMrKyeEMNgN5pg5V08AU6kNwwsASQQUy/nXdzkhElSPODgs4DMhkioPKA3RJgfvwoFCN6FkIqA4xwDQgTo90eSKgj3oHGe0q5oHBgVZwR0ql5Qz2MAhjwg+2O7Goj1VvtpD6jugb8AJUrMDagEcToSjgn48yCrzkvTBjYZx7khoK6e82AZgu5JQ4Bqi+oZ/10m3e8bAgSQE8dOQE7CJMh3e5fL+oylJiCKom3HSoBYDqdp+pjYLfX/Ta/UBBw5cmSSMbb1WAhgLNqYJMnLZZfL0seAZrN5rwDzfyGhWa/XNx48+OaT/RCv+iIIT0/vvbfRaFwjvOFoMSErLdxeq9Uu27v3le390mFg0IftpptvXetURXDefPyxn01B1apWtapVrWpVq1rVqla1t9L+I8AAvydNUrElRtkAAAAASUVORK5CYII= Url Encoded Base64 String iVBORw0KGgoAAAANSUhEUgAAAGAAAABgCAYAAADimHc4AAAAGXRFWHRTb2Z0d2FyZQBBZG9iZSBJbWFnZVJlYWR5ccllPAAADjVJREFUeNrsXX2MHVUVP3fevH27SxfKhyBCsIqoKOhCBBISY5Hyj2JSGuXLP6SJwYAYICgxsUBr1AhqbE2I8Q9jjYE%2FCLFbP4IxVbaIYjAmS0wUC6ELRGy7tPt2t9vd997MPd6Z%2B3Xunfsq1r7tvNe56TAfO2%2FezO93zu%2Fce%2B6ZB0DVqla1qlWtalWrWtWqVrWqVa1qJ1Nj%2FXCTm5%2BbHeUcz9%2B3f25tmvLVSYePIyLIBRhX24yxKXH63Kljw5Ni97UfbVhzpCLgGNs3%2Fjp%2F%2Fr9en72l3UnWCsCvSjrpmQA54Nkq28q3FQn5mucL5OuIsUPi6f5Si6KJVasaT26%2F%2BT1vVgS8hfbl3%2B27br65dE%2Br1VknrH6IIfkjolmh%2FA8hwYJv1lySInYXhXc8W49r235%2B%2ByVPVQQE2lee3n%2Fd3OzS5tZS%2B2oWurlMYgj4qI45HsApCZYAzgFSsU7FfhSx5%2BtxtHnnHR9%2BqiJAtPsnD1y4MLf09aXF9q3ZzTAmb8ohQaKtHEDLkGv9qIBHBbgmICXrlKyjKHoirkWbfn3X%2BEsnLQH37dr3mebs4o8x4WMSfGbAtyQoDSLga8BBeQJqqXE8QQIt12D2syVR2%2BLcxVpcu%2F23d1%2F%2B%2BElFwPdeXB555eWZ7x453LozEvuRtvqMgCyAhm7QyI7Sf7BEcI4mCNP9lBKhrD9R2zkJqVwLWfpOYyje8tSXLlsceAIy8Pf8Y98vOq1kXQZ8JG5By06kLZ%2F5%2Bm8DcEiCMt3XXpCTwN0YkKrYkFu%2F0CfpCSC3M1IEEeILJ0ca9et%2Fc%2FfliwNLQAb%2BSxR8JTkRJUAdy4DOtxCdQGyDb6ALyq0HuEHYyo%2BOAYlaUkVI7hkAk8ON%2BPpd935kceAIMOC3BfjiayUB1gO0FAG4QTjfN9pTjAO0%2F0%2B9ICeDBmGyJDQoEzIyjxCr3YKET%2F7%2BvitWhIRopQh4%2BZ%2F7fyAtX4PPQG%2FX1JLt19Rit8XfIjDb7uftdWqa0Ox8sNfIF%2FCvK4mPFAB6yf4uaPzYYit5dKVwWREC7vrV619sLXU%2BL8Gg4AEBlXgFBdN8JgQ6M%2BfUHJDJNWiQD1yHkXOlDLLMcz53xTf%2FdNtASNBXn5l598y%2B%2Bb%2BL3k2j5gFdU1KkA2%2FkdEOR9IDsOpSCQBN4M%2F3nJuCaOEC03pEhJTuJJ0XtbEHsxBG75PmvXb2nrz3gzZnD2wVCjQgYsUAgVm2lRwdiR6LA9w4lS2YNnlcRq%2FavB653MfrdnueJf%2FXllP%2BkryXozl%2B%2BtoF30o9GnoVrvZU9HtINNaD44BFgHSmx4DP%2FswRkKz9F3WcGCOt9NQ0MwtWXbnn2xr4loL2cbNYDLAdcQgTz9FpbtAaUERANsJEFklHvIOMISiBzrqlJD4w%2FyKJJEL2lh%2FqSgDt2vrohTdJL%2FQdzBlvMtUQ6Io6cXgwBngZWD%2FxIeZVeM49o5g30KEGh%2B1Td4g%2B8f%2FMfbuw7Atotbf0EVOchmQuGts5APsh4UNCbSBoDPE%2FoYt3B48zekzEIVF7Ae%2BcFPSHgCxOvXpwm%2FFLHslQ6GZgLfNfFk54iuMwhyAf2aJLTfcHg8cwLLnzwmQ%2F2DQFCem4pgOR4gzviLQDD3gIRzE1h%2BPshyaEB3wPYORccImVyUHR1P9s3BCSd9CZ%2FsOFPsjCV4ymkHViYCJOmYEV5co8xF1DnHrDwfe6cg1wzdZCRE8WY4tN9QYAY9Z4rBj7vzZNpiMWRHqJ5yKMCQcBg3cgJkpFPzjtkRw7x%2BruwqxQBkUxNnGgXXbBp8rzSE3BksT3uZDDJUJahD7hKsGFACug%2BCx8vegQWRtEsOOzHwO1h8WEQncOiSzpeegLaneQqB2wMEKHWGHhgigUzs2FYsHyAcNzonmfBgneZBfDoORk03nlF6QkQffCL3WdFM4uFSLUWHcuzTqPrTtCdkvSMlwb5ozZVPQHo3g8L%2BqgjOZ7t5HvHvScUH%2FceUMrPrmkTzW%2BagbRrZswIkXmGKHUbPWCQWDH6shUK8n4g9aVQGQFT3%2BkYguGdGAoWHOas0nsAqowlnbUyD%2BBPpoNX56M%2FR7wAzHkItjLCDaQO1gZXBOcQ3Tego4dzYAsBMBw5yukB8o6ZARiVZSs7l8e8NSOKr60euwRM39J1bZBZG%2FKsRTuxhRoE%2BQ6T3gZqNPk0pWUXsfwEaA%2FIHyQHX1sZM%2FCiY9OWLH0GJ66ZSwYJuoYgDxMj9QiFeiFbzIWGA3oOBKrvdIWF9j9Z8NUPHoBoQUVq7RJsbnpCTIFNgEeZUANFghmZogWeYVG6bAmirYqgJSwFItC3eNdwqIdwpN7SBx7A0YZdRCo1ECQiMlYvk3WcDJAi7QGBYAzepDyqSXlTpKXWEPAI7sQk7RmWJFPeqGXInNcHHtBKUhiJa%2FKBsoq0CBSwQJIENg2RP7AqyNIdpYhYnfYI9KYo%2FSlJWxdKSSHgBTyAQzfZcqc9OfGG0veC4ijaTcsEgdZskqo1W7%2FjVrbpEhL6N7kPzpwu99dqHljPDaNXqGuvby0cQyQpY%2BEK8BSsV4i2u%2FQecLjdmR4biq2Gc5WCZmgSXJwzKeYkqqKyfDqyjZT12VEtFrqZ6FTC0bJ0S7AGMD8PSB2R8RjrOUhK3FPQniIlSpAxXXoCFlrJ1Kp6rLScmVElU2gzf5TFbJIMzawYM8GWBXI4tEoaObrvB5A6UBMLPI8qWj6aLmdeyqjApx6QSqKmjjdePSlL%2BdQPX5gdjqPVea2OKqqyBVFuXZCukgOg9TvZMVuamGc3%2FRJFJAMsXqyOowW53CtF0UW6VtK4qpgGaIvtlrhOS6yz8hS5na2xefDha0%2Fvg4FYrsUT4v5vy1PD3JUfSjnKMZvt66PNxWA%2Bk8VtahjdHhCQFzVoebpTC0S2uV%2B2SOOCkSFl%2FWitPy9hlN4x0TcTMjOLrZ1GRwMFsno77yVxWjzlWqUTfNH%2Fu1to637GBT8%2Fjxbr6uCOhBR1TqplCKTscNDygzt7gVXPKuM%2B8ejUbKOWyRCt61TlHqYQihVKSY7%2Bloy0eqZAgkCRrl8d7b8Zk5rXlVSlnC5bF8dasiJOV8Zp6RHb0DzUA%2FnpmQfkwXi5s80CwF2rRbdc0PEQ9eJEwdqJ9yQFj%2BHBc5MA%2BNx5m9LuJ0R%2B8hhhJCgnd1uvcOoZAS%2Fsn9sqBmVNCnoIzAJwafdj%2BuUKnvKuwCeBgCutHozM%2BDEhUYDbNSgScu1vit2tfUfA%2FCPrmgvtRHqBM4gCByBOQKTAUPAl8FwAb4tpE97dS5JuZFNZUtadKsATQ4RYAIhHwLameJa%2BIyBrfzswv3WxI7yASIEPjvumilpS1xMK3UjHe3xC1DXQexmDyhEJwh2OLviuJwjgcWsvMep5efr4t55b%2F%2FZThnbk4wBw%2B%2F6F2n3wS0v8EnUyIYM0tex1Q8l26qUkUjViThT4HZSLDLyQB9%2BODLzZuTcI65%2FoawKyduW3%2F7zj9OH6%2BihEgDcA82t3GEBxMkQBqntFvPC%2BMDjdS5qm0IGWgt%2FRwKveT7Yvjk8I8G%2FoNTbxShDw4qHDGz901tia0bg2jirvo9fcIQC7lJ%2Bgk6RHPdEPUMhcOj9ZAMW353O5kgAroNU2pxKUpxw2rgQ2K%2FaS3jsf3D1%2B%2Fqrhp0fE2MCkIzwJ6lYy6Fu%2FJcCf8QqMB8Baf6JAT8i2lp9EyY441hSfuWbukXVTA0VATsIDu8fPO6Xx9HBGAi1NJ2XkAMUKtcKcJ523JeBz5ycLbMo5VUDbtZYgua%2FBF72fpvjMNc0VAn%2FFCcjaBQ9Mjr9jtJF7An1zhQZiO0VvM6VQSEdbDwCPACpDKenVpMbybW9Hb2ejXfHpFQX%2FhBCQk7Bpcvzs4aEdo3G0hr4fHEGoiNdNRdOUhEuElSOdTEvABt2EkNFx%2Bv3CCwCmUfZ4plYaixP2Yx2n3r9r9QWnNHasrsdrQ68KwX8hAOiEjJ421H18oGkFRQSXg6%2BO7gUZr4BJcYUbejnYKiUBuq3ZNHnPGY36Q42IrWYBL2B%2B4Szt%2F2vZAfJDTd6kigZeSw7J82R6v2X2kXVbT%2BTzl%2BIHm4Q3rDlnuP6Q6KbeVjfxAPWbis7NojcdqSfWubJ8riUIrAfo1ENiPAS2i2NbRE9n%2BkQ%2Fe6l%2Bsuw0QcSZwhtEL8kQQUvbTb0aLec0lk9Gv2AHYwkhQvzbLpYthx6%2Bdrosz1zKH%2B3LPGIsrq2PDu79%2FvA5F8p3igMEAFjZQV%2BCrCxNicM%2FFdY%2FUQaL7wsCdBsZGcH6GefB2EVXwsi574Pa294FSeM0aNVPpeMyFYQRhtrzEC0dgnTmFWi9sQcW9k5NLr2x5%2BPQm7ra%2FklF%2FF8WcngG4r1%2FhLG5F%2BHsQ%2BfA6OgoDDUaEMdx9rtv0vLTFNqdDrSWl2FhYQEOHNgPyeysCLOzzAsfpWsRDH5jZfb2gSQA3fQFKzMJJ4sHlJaEeFA9QHlB6G1YLFNMGGAPQPqMrKyeEMNgN5pg5V08AU6kNwwsASQQUy%2FnXdzkhElSPODgs4DMhkioPKA3RJgfvwoFCN6FkIqA4xwDQgTo90eSKgj3oHGe0q5oHBgVZwR0ql5Qz2MAhjwg%2B2O7Goj1VvtpD6jugb8AJUrMDagEcToSjgn48yCrzkvTBjYZx7khoK6e82AZgu5JQ4Bqi%2BoZ%2F10m3e8bAgSQE8dOQE7CJMh3e5fL%2BoylJiCKom3HSoBYDqdp%2BpjYLfX%2FTa%2FUBBw5cmSSMbb1WAhgLNqYJMnLZZfL0seAZrN5rwDzfyGhWa%2FXNx48%2BOaT%2FRCv%2BiIIT0%2FvvbfRaFwjvOFoMSErLdxeq9Uu27v3le390mFg0IftpptvXetURXDefPyxn01B1apWtapVrWpVq1rVqla1t9L%2BI8AAvydNUrElRtkAAAAASUVORK5CYII%3D

  Read the article

• python list mysteriously getting set to something within my django/piston handler

  - by Anverc

  To start, I'm very new to python, let alone Django and Piston. Anyway, I've created a new BaseHandler class "class BaseApiHandler(BaseHandler)" so that I can extend some of the stff that BaseHandler does. This has been working fine until I added a new filter that could limit results to the first or last result. Now I can refresh the api page over and over and sometimes it will limit the result even if I don't include /limit/whatever in my URL... I've added some debug info into my return value to see what is happening, and that's when it gets more weird. this return value will make more sense after you see the code, but here they are for reference: When the results are correct: "statusmsg": "2 hours_detail found with query: {'empid':'22','datestamp':'2009-03-02',}", when the results are incorrect (once you read the code you'll notice two things wrong. First, it doesn't have 'limit':'None', secondly it shouldn't even get this far to begin with. "statusmsg": "1 hours_detail found with query: {'empid':'22','datestamp':'2009-03-02',with limit[0,1](limit,None),}", It may be important to note that I'm the only person with access to the server running this right now, so even if it was a cache issue, it doesn't make sense that I can just refresh and get different results by hitting F5 while viewing: http://localhost/api/hours_detail/datestamp/2009-03-02/empid/22 Here's the code broken into urls.py and handlers.py so that you can see what i'm doing: URLS.PY urlpatterns = patterns('', #hours_detail/id/{id}/empid/{empid}/projid/{projid}/datestamp/{datestamp}/daterange/{fromdate}to{todate}/limit/{first|last}/exact #empid is required # id, empid, projid, datestamp, daterange can be in any order url(r'^api/hours_detail/(?:' + \ r'(?:[/]?id/(?P<id>\d+))?' + \ r'(?:[/]?empid/(?P<empid>\d+))?' + \ r'(?:[/]?projid/(?P<projid>\d+))?' + \ r'(?:[/]?datestamp/(?P<datestamp>\d{4,}[-/\.]\d{2,}[-/\.]\d{2,}))?' + \ r'(?:[/]?daterange/(?P<daterange>(?:\d{4,}[-/\.]\d{2,}[-/\.]\d{2,})(?:to|/-)(?:\d{4,}[-/\.]\d{2,}[-/\.]\d{2,})))?' + \ r')+' + \ r'(?:/limit/(?P<limit>(?:first|last)))?' + \ r'(?:/(?P<exact>exact))?$', hours_detail_resource), HANDLERS.PY # inherit from BaseHandler to add the extra functionality i need to process the possibly null URL params class BaseApiHandler(BaseHandler): # keep track of the handler so the data is represented back to me correctly post_name = 'base' # THIS IS THE LIST IN QUESTION - SOMETIMES IT IS GETTING SET TO [0,1] MYSTERIOUSLY # this gets set to a list when the results are to be limited limit = None def has_limit(self): return (isinstance(self.limit, list) and len(self.limit) == 2) def process_kwarg_read(self, key, value, d_post, b_exact): """ this should be overridden in the derived classes to process kwargs """ pass # override 'read' so we can better handle our api's searching capabilities def read(self, request, *args, **kwargs): d_post = {'status':0,'statusmsg':'Nothing Happened'} try: # setup the named response object # select all employees then filter - querysets are lazy in django # the actual query is only done once data is needed, so this may # seem like some memory hog slow beast, but it's actually not. d_post[self.post_name] = self.queryset(request) # this is a string that holds debug information... it's the string I mentioned before pasting this code s_query = '' b_exact = False if 'exact' in kwargs and kwargs['exact'] <> None: b_exact = True s_query = '\'exact\':True,' for key,value in kwargs.iteritems(): # the regex url possibilities will push None into the kwargs dictionary # if not specified, so just continue looping through if that's the case if value == None or key == 'exact': continue # write to the s_query string so we have a nice error message s_query = '%s\'%s\':\'%s\',' % (s_query, key, value) # now process this key/value kwarg self.process_kwarg_read(key=key, value=value, d_post=d_post, b_exact=b_exact) # end of the kwargs for loop else: if self.has_limit(): # THIS SEEMS TO GET HIT SOMETIMES IF YOU CONSTANTLY REFRESH THE API PAGE, EVEN THOUGH # THE LINE IN THE FOR LOOP WHICH UPDATES s_query DOESN'T GET HIS AND THUS self.process_kwarg_read ALSO # DOESN'T GET HIT SO NEITHER DOES limit = [0,1] s_query = '%swith limit[%s,%s](limit,%s),' % (s_query, self.limit[0], self.limit[1], kwargs['limit']) d_post[self.post_name] = d_post[self.post_name][self.limit[0]:self.limit[1]] if d_post[self.post_name].count() == 0: d_post['status'] = 0 d_post['statusmsg'] = '%s not found with query: {%s}' % (self.post_name, s_query) else: d_post['status'] = 1 d_post['statusmsg'] = '%s %s found with query: {%s}' % (d_post[self.post_name].count(), self.post_name, s_query) except: e = sys.exc_info()[1] d_post['status'] = 0 d_post['statusmsg'] = 'error: %s' % e d_post[self.post_name] = [] return d_post class HoursDetailHandler(BaseApiHandler): #allowed_methods = ('GET',) model = HoursDetail exclude = () post_name = 'hours_detail' def process_kwarg_read(self, key, value, d_post, b_exact): if ... # I have several if/elif statements here that check for other things... # 'self.limit =' only shows up in the following elif: elif key == 'limit': order_by = 'clock_time' if value == 'last': order_by = '-clock_time' d_post[self.post_name] = d_post[self.post_name].order_by(order_by) # TO GET HERE, THE ONLY PLACE IN CODE WHERE self.limit IS SET, YOU MUST HAVE GONE THROUGH # THE value == None CHECK???? self.limit = [0, 1] else: raise NameError def read(self, request, *args, **kwargs): # empid is required, so make sure it exists before running BaseApiHandler's read method if not('empid' in kwargs and kwargs['empid'] <> None and kwargs['empid'] >= 0): return {'status':0,'statusmsg':'empid cannot be empty'} else: return BaseApiHandler.read(self, request, *args, **kwargs) Does anyone have a clue how else self.limit might be getting set to [0, 1] ? Am I misunderstanding kwargs or loops or anything in Python?

  Read the article

• How do I evaluate my skillset against the current market to see what needs improvement and where my

  - by baijajusav

  First of all, this question may be out of bounds for this site. If so, remove it. I say this because this site seems to be a place for more concrete questions that are not so relative in nature. And before I begin, for those of you whom just prefer a question and not this sort of dialog, here is my question: How can I assess my current skills as a programmer and decide where and what areas to improve upon? That said, here's what I'm asking/talking about, in essence. The market is always in constant flux. As programmers we're always having to learn new things, update our skills, push ourselves into that next project. There's not a very good litmus test that I know of for us to get an idea of where we stand as programmers. I came across this blog post by Jeff Atwood talking about why can't programmers code. Instinctively (and as the post goes on to state) I rushed through the program in about 4 minutes (most of that time was b/c I was hand writing it out. Still, this doesn't really answer the question of where do my skills need to be to succeed in today's world. I real blogs, listen to podcasts, try to keep up on the latest things coming out. It has only been in the past couple of months that I made a decision to pick a focus area for my learning as I can't learn everything and trying to do so is to spread myself too thin. I chose ASP.NET MVC & C#. I plan to stick with Microsoft technologies, not out of some sense of loyalty or stubbornness, but rather because they seem to stream together and have a unifying connection between them. With Windows Phone 7 coming out, it seems that now is the obvious time to pick up WPF and Silverlight as well. Still, if you asked me to code something apart from intellisense and the internet, I probably couldn't get the syntax right. I don't have libraries memorized or know precisely where the classes I use exist within the .Net framework, namely because I haven't had to pull that knowledge out of the air. In a way, I suppose Visual Studio has insulated me, which isn't a good thing, but, at the same time, I've still been able to be productive. I'm working on my own side project to try and help my learning. In doing so, I'm trying to make use of best practices and 3rd party frameworks where I can. I'm using automapper and EF 1.0. I know everyone in the .net community seems to cry foul at the sound of EF 1.0, but I can't say why because I've never used it. There's no lazy loading and that has proven rather annoying; however, aside from that, I haven't had that much of an issue. Granted this is probably because I'm not writing tests as I go (which I'm not doing because I don't know how to test EF in tests and don't really have a clue how to write tests for ASP.NET MVC 1.0). I'm also using a custom membership provider; granted, it's a barebone implementation, but I'm using it still. My thinking in all of this is, while I am neglecting a great many important technologies that are in the mainstream, I'll have a working project in the end. I can come back and add those things after I finish. Doing it all now and at once seems like too much. I know how I work and I don't think I'd ever get it done that way. I've elected to make this a community wiki as I think this question might fight better there. If a moderator disagrees with that choice or the decision to post this here, the just delete the question. I'm not trying to make undue work for anyone. I'm just a programmer trying to assess my where his skills are now and where I should be improving.

  Read the article

• Writing a code example

  - by Stefano Borini

  I would like to have your feedback regarding code examples. One of the most frustrating experiences I sometimes have when learning a new technology is finding useless examples. I think an example as the most precious thing that comes with a new library, language, or technology. It must be a starting point, a wise and unadulterated explanation on how to achieve a given result. A perfect example must have the following characteristics: Self contained: it should be small enough to be compiled or executed as a single program, without dependencies or complex makefiles. An example is also a strong functional test if you correctly installed the new technology. The more issues could arise, the more likely is that something goes wrong, and the more difficult is to debug and solve the situation. Pertinent: it should demonstrate one, and only one, specific feature of your software/library, involving the minimal additional behavior from external libraries. Helpful: the code should bring you forward, step by step, using comments or self-documenting code. Extensible: the example code should be a small “framework” or blueprint for additional tinkering. A learner can start by adding features to this blueprint. Recyclable: it should be possible to extract parts of the example to use in your own code Easy: An example code is not the place to show your code-fu skillz. Keep it easy. helpful acronym: SPHERE. Prototypical examples of violations of those rules are the following: Violation of self-containedness: an example spanning multiple files without any real need for it. If your example is a python program, keep everything into a single module file. Don’t sub-modularize it. In Java, try to keep everything into a single class, unless you really must partition some entity into a meaningful object you need to pass around (and java mandates one class per file, if I remember correctly). Violation of Pertinency: When showing how many different shapes you can draw, adding radio buttons and complex controls with all the possible choices for point shapes is a bad idea. You de-focalize your example code, introducing code for event handling, controls initialization etc., and this is not part the feature you want to demonstrate, they are unnecessary noise in the understanding of the crucial mechanisms providing the feature. Violation of Helpfulness: code containing dubious naming, wrong comments, hacks, and functions longer than one page of code. Violation of Extensibility: badly factored code that have everything into a single function, with potentially swappable entities embedded within the code. Example: if an example reads data from a file and displays it, create a method getData() returning a useful entity, instead of opening the file raw and plotting the stuff. This way, if the user of the library needs to read data from a HTTP server instead, he just has to modify the getData() module and use the example almost as-is. Another violation of Extensibility comes if the example code is not under a fully liberal (e.g. MIT or BSD) license. Violation of Recyclability: when the code layout is so intermingled that is difficult to easily copy and paste parts of it and recycle them into another program. Again, licensing is also a factor. Violation of Easiness: Yes, you are a functional-programming nerd and want to show how cool you are by doing everything on a single line of map, filter and so on, but that could not be helpful to someone else, who is already under pressure to understand your library, and now has to understand your code as well. And in general, the final rule: if it takes more than 10 minutes to do the following: compile the code, run it, read the source, and understand it fully, it means that the example is not a good one. Please let me know your opinion, either positive or negative, or experience on this regard.

  Read the article

• Web service occasionally slows down significantly

  - by Swoop

  My company is running into a problem with a web service that is written in C#/ASP.Net. The service receives an identity key for data in SQL Server and a path to generate and save a PDF report for this data. In most cases, this web service returns results to the calling web pages very quickly, usually within a few seconds max. However, it seems to occasionally hit a significant slowdown. The web application calling the web service will generate a timeout error when this slowdown occurs. We have checked and the PDF does get created and saved to the server, so it looks like the web service eventually finishes executing. It seems to take about 1 to 2 minutes for processing to have completed. The PDF is generated using ActiveReports from Data Dynamics. Wwhen this problem occurs, making a small change to the web service's config file (ie, adding a blank space to a connection string line) seems to restart the web service and everything is perfectly ok for a period of time afterwards. Other web applications that are running on the same web server do not seem to experience this type of behavior, only this particular web service. I have added the code for the web service below. It is basic calls to 3rd party libraries. We are not able to recreate this problem in test. I am wondering what might be causing this issue? [WebMethod] public string Publish(int identity, string transactionType, string directory, string filename) { try { AdpConnection Conn = new AdpConnection(ConfigurationManager.AppSettings["myDBConnString"]); AdpCommand Cmd = new AdpCommand("storedproc_GetData", oConn); AdpParameter Param; Cmd.CommandType = CommandType.StoredProcedure; Param = Cmd.CreateParameter("@Identity", DbType.Int32); Param.Value = identity; Cmd.Parameters.Add(oParam); Conn.Open(); string aResponse = Cmd.ExecuteScalar().ToString(); Conn.Close(); if (transactionType == "typeA") { //Parse response DataSet dsResponse = ParseDataResponse(aResponse); //dsResponse.WriteXml(@ConfigurationManager.AppSettings["DocsDir"] + identity.ToString() + ".xml"); DataDynamics.ActiveReports.ActiveReport3 rpt = new DataDynamics.ActiveReports.ActiveReport3(); rpt.LoadLayout(@ConfigurationManager.AppSettings["myReportPath"] + "TypeA.rpx"); rpt.AddNamedItem("ReportPath", @ConfigurationManager.AppSettings["myReportPath"]); rpt.AddNamedItem("XMLSTRING", FormatXML(dsResponse.GetXml())); DataDynamics.ActiveReports.DataSources.XMLDataSource xmlds = new DataDynamics.ActiveReports.DataSources.XMLDataSource(); xmlds.FileURL = null; xmlds.RecordsetPattern = "//DataPatternA"; xmlds.LoadXML(FormatXML(dsResponse.GetXml())); if (!System.IO.Directory.Exists(@ConfigurationManager.AppSettings["DocsDir"] + directory + @"\")) { System.IO.Directory.CreateDirectory(@ConfigurationManager.AppSettings["DocsDir"] + directory + @"\"); } string sXML = FormatXML(dsResponse.GetXml()); StreamWriter sw = new StreamWriter(@ConfigurationManager.AppSettings["DocsDir"] + directory + @"\" + filename + ".xml", false); sw.Write(sXML); sw.Close(); rpt.DataSource = xmlds; rpt.Run(true); DataDynamics.ActiveReports.Export.Pdf.PdfExport xPdf = new DataDynamics.ActiveReports.Export.Pdf.PdfExport(); xPdf.Export(rpt.Document, @ConfigurationManager.AppSettings["DocsDir"] + directory + @"\" + filename + ".pdf"); } } catch(Exception ex) { return "Error: " + ex.ToString(); } return @ConfigurationManager.AppSettings["DocsDir"] + directory + @"\" + filename + ".pdf"; }

  Read the article

• Temporary "Backup" of SharePoint Content During Feature and Solution Deployment

  - by ccomet

  I need to decide on a method for storing a subset of the content in a SharePoint site, so that when I delete and recreate certain lists as part of a feature activation, I can re-insert all of this content back where it should belong. I have an idea myself, but I don't know if it's the only method and more importantly, the right method. My client has me creating a SharePoint system for them to communicate with their clients. The business process has maybe 5 stages in it (maybe it's more, I don't even know because they don't tell me everything), and the current system I've written over the past months is maybe 2 stages through. This meets our deadline of completing those systems by Monday next week... but at that point my client is planning on making the site live from that point. In effect, their work with their clients will be running parallel with my work for them. As I complete my own work on a separate test server, I'll push each following stage of the process onto the live server. Scheduled downtimes during non-business times (like a weekend) will be available for me to perform these pushes. Keeping pace so that my development is faster than the actual business process is my own problem and off-topic... so let's get back to the problem I stated at the start of this post. In this system, we have sets of features which will create lists for their associated content types and field types when activated, and delete these lists when the feature is deactivated. Most updates don't need to deactivate and reactivate these features, such as workflow changes, custom actions, custom forms, and similar ilk. But there are some parts which do require this. On my test server, it's okay for me to obliterate lists, but once the site is live and there's real correspondence data, it's absolutely unacceptable to do this. So when I need to implement a new change in functionality, I need to be able to store the currently present data in several lists, deactivate the feature, reactivate the feature, and restore all of this data. Perhaps I have hoist myself by my own petard with the feature system I implemented. Unfortunately, the necessity to later on make several of these "project sites" meant I had to do a lot of my code with the concept of "Can be deployed repeatedly" in mind. My current plan is to run through lists and libraries which will be affected by the particular feature that is to be reset. Files and all of their versions will be saved in a directory on the server. Then, a set of text files will be used to store all of the important field values for the items. This includes a lot of cross-list reference lookups that will need to be maintained, but that's simple enough. Then, I deactivate the feature, deploy the new solution, and reactivate the feature. We upload all of the files in the order specified by their versions and update them with the stored fields for those versions, so that we retain the version structure. As each one is first uploaded, the new ID is picked out, and all relevant lookups in the rest of the files are updated (in some manner that I make sure I don't re-update it later with an incorrect value, of course). After that, we run through all the rest of the items in the order most conducive to keeping the relational data correct. This roughly summarizes what my current plan is. To my advantage, there are no long running workflows in the system that will be affected by this, so there's nothing I will have to worry about making sure nothing is "still running" when I do this stuff. I don't really know all the cons of this approach... I can imagine they're quite hefty. But I'm unsure what other choices I even have, and my searches haven't turned up anything. Is there anyone who can think of a better idea? Or will anyone just tell me that I really have no other choice? Thanks in advance!

  Read the article

• VFS: file-max limit 1231582 reached

  - by Rick Koshi

  I'm running a Linux 2.6.36 kernel, and I'm seeing some random errors. Things like ls: error while loading shared libraries: libpthread.so.0: cannot open shared object file: Error 23 Yes, my system can't consistently run an 'ls' command. :( I note several errors in my dmesg output: # dmesg | tail [2808967.543203] EXT4-fs (sda3): re-mounted. Opts: (null) [2837776.220605] xv[14450] general protection ip:7f20c20c6ac6 sp:7fff3641b368 error:0 in libpng14.so.14.4.0[7f20c20a9000+29000] [4931344.685302] EXT4-fs (md16): re-mounted. Opts: (null) [4982666.631444] VFS: file-max limit 1231582 reached [4982666.764240] VFS: file-max limit 1231582 reached [4982767.360574] VFS: file-max limit 1231582 reached [4982901.904628] VFS: file-max limit 1231582 reached [4982964.930556] VFS: file-max limit 1231582 reached [4982966.352170] VFS: file-max limit 1231582 reached [4982966.649195] top[31095]: segfault at 14 ip 00007fd6ace42700 sp 00007fff20746530 error 6 in libproc-3.2.8.so[7fd6ace3b000+e000] Obviously, the file-max errors look suspicious, being clustered together and recent. # cat /proc/sys/fs/file-max 1231582 # cat /proc/sys/fs/file-nr 1231712 0 1231582 That also looks a bit odd to me, but the thing is, there's no way I have 1.2 million files open on this system. I'm the only one using it, and it's not visible to anyone outside the local network. # lsof | wc 16046 148253 1882901 # ps -ef | wc 574 6104 44260 I saw some documentation saying: file-max & file-nr: The kernel allocates file handles dynamically, but as yet it doesn't free them again. The value in file-max denotes the maximum number of file- handles that the Linux kernel will allocate. When you get lots of error messages about running out of file handles, you might want to increase this limit. Historically, the three values in file-nr denoted the number of allocated file handles, the number of allocated but unused file handles, and the maximum number of file handles. Linux 2.6 always reports 0 as the number of free file handles -- this is not an error, it just means that the number of allocated file handles exactly matches the number of used file handles. Attempts to allocate more file descriptors than file-max are reported with printk, look for "VFS: file-max limit reached". My first reading of this is that the kernel basically has a built-in file descriptor leak, but I find that very hard to believe. It would imply that any system in active use needs to be rebooted every so often to free up the file descriptors. As I said, I can't believe this would be true, since it's normal to me to have Linux systems stay up for months (even years) at a time. On the other hand, I also can't believe that my nearly-idle system is holding over a million files open. Does anyone have any ideas, either for fixes or further diagnosis? I could, of course, just reboot the system, but I don't want this to be a recurring problem every few weeks. As a stopgap measure, I've quit Firefox, which was accounting for almost 2000 lines of lsof output (!) even though I only had one window open, and now I can run 'ls' again, but I doubt that will fix the problem for long. (edit: Oops, spoke too soon. By the time I finished typing out this question, the symptom was/is back) Thanks in advance for any help. And another update: My system was basically unusable, so I decided I had no option but to reboot. But before I did, I carefully quit one process at a time, checking /proc/sys/fs/file-nr after each termination. I found that, predictably, the number of open files gradually went down as I closed things down. Unfortunately, it wasn't a large effect. Yes, I was able to clear up 5000-10000 open files, but there were still over 1.2 million left. I shut down just about everything. All interactive shells, except for the one ssh I left open to finish closing down, httpd, even nfs service. Basically everything in the process table that wasn't a kernel process, and there were still an appalling number of files apparently left open. After the reboot, I found that /proc/sys/fs/file-nr showed about 2000 files open, which is much more reasonable. Starting up 2 Xvnc sessions as usual, along with the dozen or so monitoring windows I like to keep open, brought the total up to about 4000 files. I can see nothing wrong with that, of course, but I've obviously failed to identify the root cause. I'm still looking for ideas, since I definitely expect it to happen again. And another update, the next day: I watched the system carefully, and discovered that /proc/sys/fs/file-nr showed a growth of about 900 open files per hour. I shut down the system's only NFS client for the night, and the growth stopped. Mind you, it didn't free up the resources, but it did at least stop consuming more. Is this a known bug with NFS? I'll be bringing the NFS client back online today, and I'll narrow it down further. If anyone is familiar with this behavior, feel free to jump in with "Yeah, NFS4 has this problem, go back to NFS3" or something like that.

  Read the article

• Using only alphanumeric characters(a-z) inside toCharArray

  - by Aaron

  Below you will find me using toCharArray in order to send a string to array. I then MOVE the value of the letter using a for statement... for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } However, when I use shiftCode to move the value such as... a shifted by -1; I get a symbol @. Is there a way to send the string to shiftCode or tell shiftCode to ONLY use letters? I need it to see my text, like "aaron", and when I use the for statement iterate through a-z only and ignore all symbols and numbers. I THINK it is as simple as... letter=codeWord.toCharArray(a,z); But trying different forms of that and googling it didn't give me any results. Perhaps it has to do with regex or something? Below you will find a complete copy of my program; it works exactly how I want it to do; but it iterates through letters and symbols. I also tried finding instructions online for toCharArray but if there exists any arguments I can't locate them. My program... import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Aaron L. Jones * CS219 * AaronJonesProg3 * * This program is designed to - * Work as a Ceasar Cipher */ /** * * Aaron Jones */ public class AaronJonesProg3 { static String codeWord; static int shiftCode; static int i; static char[] letter; /** * @param args the command line arguments */ public static void main(String[] args) throws IOException { // Instantiating that Buffer Class // We are going to use this to read data from the user; in buffer // For performance related reasons BufferedReader reader; // Building the reader variable here // Just a basic input buffer (Holds things for us) reader = new BufferedReader(new InputStreamReader(System.in)); // Java speaks to us here / We get it to query our user System.out.print("Please enter text to encrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); /**************************************************************** **************************************************************** ***************************************************************/ // Java speaks to us here / We get it to query our user System.out.print("Please enter text to decrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); } }

  Read the article

• How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

  - by Pitming

  I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

  Read the article

• Set up linux box for hosting a-z

  - by microchasm

  I am in the process of reinstalling the OS on a machine that will be used to host a couple of apps for our business. The apps will be local only; access from external clients will be via vpn only. The prior setup used a hosting control panel (Plesk) for most of the admin, and I was looking at using another similar piece of software for the reinstall - but I figured I should finally learn how it all works. I can do most of the things the software would do for me, but am unclear on the symbiosis of it all. This is all an attempt to further distance myself from the land of Configuration Programmer/Programmer, if at all possible. I can't find a full walkthrough anywhere for what I'm looking for, so I thought I'd put up this question, and if people can help me on the way I will edit this with the answers, and document my progress/pitfalls. Hopefully someday this will help someone down the line. The details: CentOS 5.5 x86_64 httpd: Apache/2.2.3 mysql: 5.0.77 (to be upgraded) php: 5.1 (to be upgraded) The requirements: SECURITY!! Secure file transfer Secure client access (SSL Certs and CA) Secure data storage Virtualhosts/multiple subdomains Local email would be nice, but not critical The Steps: Download latest CentOS DVD-iso (torrent worked great for me). Install CentOS: While going through the install, I checked the Server Components option thinking I was going to be using another Plesk-like admin. In hindsight, considering I've decided to try to go my own way, this probably wasn't the best idea. Basic config: Setup users, networking/ip address etc. Yum update/upgrade. Upgrade PHP/MySQL: To upgrade PHP and MySQL to the latest versions, I had to look to another repo outside CentOS. IUS looks great and I'm happy I found it! Add IUS repository to our package manager cd /tmp wget http://dl.iuscommunity.org/pub/ius/stable/Redhat/5/x86_64/epel-release-1-1.ius.el5.noarch.rpm rpm -Uvh epel-release-1-1.ius.el5.noarch.rpm wget http://dl.iuscommunity.org/pub/ius/stable/Redhat/5/x86_64/ius-release-1-4.ius.el5.noarch.rpm rpm -Uvh ius-release-1-4.ius.el5.noarch.rpm yum list | grep -w \.ius\. # list all the packages in the IUS repository; use this to find PHP/MySQL version and libraries you want to install Remove old version of PHP and install newer version from IUS rpm -qa | grep php # to list all of the installed php packages we want to remove yum shell # open an interactive yum shell remove php-common php-mysql php-cli #remove installed PHP components install php53 php53-mysql php53-cli php53-common #add packages you want transaction solve #important!! checks for dependencies transaction run #important!! does the actual installation of packages. [control+d] #exit yum shell php -v PHP 5.3.2 (cli) (built: Apr 6 2010 18:13:45) Upgrade MySQL from IUS repository /etc/init.d/mysqld stop rpm -qa | grep mysql # to see installed mysql packages yum shell remove mysql mysql-server #remove installed MySQL components install mysql51 mysql51-server mysql51-devel transaction solve #important!! checks for dependencies transaction run #important!! does the actual installation of packages. [control+d] #exit yum shell service mysqld start mysql -v Server version: 5.1.42-ius Distributed by The IUS Community Project Upgrade instructions courtesy of IUS wiki: http://wiki.iuscommunity.org/Doc/ClientUsageGuide Install rssh (restricted shell) to provide scp and sftp access, without allowing ssh login cd /tmp wget http://dag.wieers.com/rpm/packages/rssh/rssh-2.3.2-1.2.el5.rf.x86_64.rpm rpm -ivh rssh-2.3.2-1.2.el5.rf.x86_64.rpm useradd -m -d /home/dev -s /usr/bin/rssh dev passwd dev Edit /etc/rssh.conf to grant access to SFTP to rssh users. vi /etc/rssh.conf Uncomment or add: allowscp allowsftp This allows me to connect to the machine via SFTP protocol in Transmit (my FTP program of choice; I'm sure it's similar with other FTP apps). rssh instructions appropriated (with appreciation!) from http://www.cyberciti.biz/tips/linux-unix-restrict-shell-access-with-rssh.html Set up virtual interfaces ifconfig eth1:1 192.168.1.3 up #start up the virtual interface cd /etc/sysconfig/network-scripts/ cp ifcfg-eth1 ifcfg-eth1:1 #copy default script and match name to our virtual interface vi ifcfg-eth1:1 #modify eth1:1 script #ifcfg-eth1:1 | modify so it looks like this: DEVICE=eth1:1 IPADDR=192.168.1.3 NETMASK=255.255.255.0 NETWORK=192.168.1.0 ONBOOT=yes NAME=eth1:1 Add more Virtual interfaces as needed by repeating. Because of the ONBOOT=yes line in the ifcfg-eth1:1 file, this interface will be brought up when the system boots, or the network starts/restarts. service network restart Shutting down interface eth0: [ OK ] Shutting down interface eth1: [ OK ] Shutting down loopback interface: [ OK ] Bringing up loopback interface: [ OK ] Bringing up interface eth0: [ OK ] Bringing up interface eth1: [ OK ] ping 192.168.1.3 64 bytes from 192.168.1.3: icmp_seq=1 ttl=64 time=0.105 ms And this is where I'm at. I will keep editing this as I make progress. Any tips on how to Configure virtual interfaces/ip based virtual hosts for SSL, setting up a CA, or anything else would be appreciated.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Managing BES Software Configurations

  - by DaveJohnston

  Hi, I am having problems with OTA deployment of a bespoke application that we have written. I have read loads of threads elsewhere and I have got mixed help, but for my particular case none of it has really helped. So I thought I would explain my exact situation and try and get some help here. I am running BES version 4.1.5 (Bundle 79) for Microsoft Exchange. The application we have written is split into 5 modules, which we control, and another 4 modules which are 3rd party libraries that we require. So for our modules the version numbers are regularly changing but for the others they are pretty much always going to remain the same. We have an alx file set up that identifies all of the files required and in fact I am able to create a software configuration and deploy the application with no problems. What I am trying to do however is maintain multiple versions of our application on the BES and be able to select which version I want to deploy to each user. I have tried this a number of ways (as I said I have read lots of other threads with solutions to this problem) but each seems to come with its own problem. First of all I tried just creating different configurations for each version of the application, but because they each had the same application ID the BES informed me that I couldn't do this. I read somewhere that the solution was to create a second shared folder (e.g. \Program Files\Common Files\RIM) and add the apploader stuff and the new version of the app to this folder. I could then create a second software configuration that would have the same application ID. The result of this seemed promising to start with. When I changed the config that was assigned to a user the new version was pushed out fine. But afterwards the BES reported that the device state was invalid, which meant I couldn't push anything else until I reactivated the device. I guess this is because the first config was never set to disallowed so the old version wasn't removed and the device essentially reported that it had multiple versions of the same application installed. The next suggestion I got was to change the application ID for each version, e.g. to include the version number. This meant that each version of the application could be included in a single configuration and I could set one to disallowed and the other to required. Initially this worked and the first version was deployed. But when I switched (i.e. the old version became disallowed and the new version required) the BES reported upgrade required and removed the old version. The device restarts and the old version is gone but the new version is not pushed out. I checked the BES and it still said Upgrade Required. I checked the log files and found: [40000] (11/12 09:50:27.397):{0xEB8} {[email protected], PIN=1234, UserId=2}SCS::PollDBQueueNewRequests - Queuing POLL_FOR_MISSING_APPS request [40000] (11/12 09:50:28.241):{0xE9C} RequestHandler::PollForMissingApps: Starting Poll For Missing Apps. [40304] (11/12 09:50:28.241):{0xE90} WorkerThreadPool:: ThreadProc(): Thread released with empty queue [40000] (11/12 09:50:28.241):{0xE9C} SCS::RemoveAppDeliveryRequests - No App Delivery Requests purged for User id 2 [30000] (11/12 09:50:28.960):{0xE9C} Discard duplicate module group "name" on device [30000] (11/12 09:50:28.960):{0xE9C} Discard duplicate module group "name" on device [40000] (11/12 09:50:29.163):{0xE9C} RequestHandler::PollForMissingApps: Completed Poll For Missing Apps, elapsed time 0.922 seconds. (You will notice I have removed actual names and email addresses etc for privacy reasons. But one question: where does the name of the module group come from? In my case it is close to the application ID but doesn't include the version number that I added at the end in order to get it to work. Is that information embedded in a COD file or something??) So it is reporting a duplicate module group on the device? What does this mean? I checked the device properties (as reported on the BES) and it confirms that the modules with the old version numbers are still present on the device. So the application has been removed but not the modules?? I checked the device and the modules are gone, so it is just the BES reporting that they are still there?? I checked the database and it has the modules in questions in the SyncDeviceMgmt table. If I delete these from the DB the BES changes to report Install Required, and low and behold the new version of the app is pushed out. So at the end of all that, my question is: does anyone have any other suggestions of how to handle upgrading our bespoke application OTA from the BES? Or can anyone point out something I am doing wrong in what I described above that might solve the problems I am having? I guess the question is why does the database maintain that the modules are on the device after they are removed? Thanks for any help you can provide.

  Read the article

• How do I solve "Two different CRTLDLLs are loaded" when using packages in C++ Builder 2010?

  - by David M

  Hi, We are trying to split up our monolithic EXE into a combination of an EXE and several packages. So far, we have one package that we're trying to use, and when running the EXE Codeguard shows the following error on startup: CG Error Two different CRTLDLLs are loaded. CG might report false errors (C:\Windows\system32\CC32100MT.DLL) (D:\Projects\Foo\Bar.bpl) OK I read this as two different runtime libraries being loaded - one, the correct one (CC32100MT.dll), one incorrect, which is the package we're trying to use. Continuing to run the program shows odd errors, especially casting between classes or passing a pointer to a class as a parameter in a method that crosses the EXE/DLL boundary. Codeguard itself doesn't show any other errors at all though. How do we solve this? Some more details We've looked at as many things as we (the developer working on this and I) can collectively think of: Each project is built using runtime packages. The EXE host lists Bar in its package list. Each project is set to compile with dynamic RTL. However, changing this does not solve the problem. The package is linked to the EXE via its BPI file, but linking via a LIB makes no difference either. The EXE and BPL are compiled with the same project settings, where the same options exist for both types of project. We think, anyway :) There is only one copy of the BPL and BPI on the system: it's definitely linking to the right one. Examining the EXE and BPL with Depends and TDump show they are both using C:\Windows\system32\CC32100MT.DLL. They should both be using the one RTL. Creating a new project (a plain VCL forms application) and linking to the BPL (via its BPI) works fine. Something in the process of adding all the files and LIBs that make our EXE contain the code it needs to changes this, but we haven't been able to figure out what. The LIBs all either correspond to DLLs we use (flat C interface, usually look as though they were built with MSVC) or are simple projects with lots of related files, compiled to a lib for the purpose of linking into the EXE - these correspond roughly to the areas of the program we want to split to BPLs, by the way. There don't seem to be project options for the LIB projects that would affect RTL linking, unless we've missed them. I have exhaustively hunted through Depends and looked at all RTL and CC32*.dll files the EXE and every single DLL references. All are identical: rtl140.bpl and CC32100MT.DLL. Fully qualified paths show they are the same files, too. Everything should be using the one same run-time library. We're stumped. Absolutely stumped. We've had other problems using BPLs (they seem to be surprisingly tricky things, especially using C++) but have managed to solve them all. This one we've had no luck at all and we'd really appreciate any insights :) We're using C++Builder 2010 (as part of RAD Studio actually, but with little Delphi code apart from components.)

  Read the article

< Previous Page | 343 344 345 346 347 348 349 350 351 352 353 354  | Next Page >