Search Results

Search found 86529 results on 3462 pages for 'new steve'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 352/3462 | < Previous Page | 348 349 350 351 352 353 354 355 356 357 358 359  | Next Page >

  • CSS Expand Parent Div To Child Height

    - by Steve Horn
    I have a page structure similar to this: <body> <div id="parent"> <div id="childRightCol"> <div> <div id="childLeftCol"> <div> </div> </body> I would like for the parent div to expand in height when the inner div height expands. Edit: One caveat is that if/when the width of the child content expands past the width of the browser window, my current CSS puts a horizontal scroll on the parent div. I would like the scrollbar to be at the page level. (Currently my parent div is set to overflow: auto;) Can you please help me with the CSS for this?

    Read the article

  • CakePHP: Why does adding 'Security' component break my app?

    - by Steve
    I have a strange problem -- of my own making -- that's cropped up, and is driving me crazy. At some point, I inadvertently destroyed a file in the app/tmp directory...I'm not sure which file. But now my app breaks when I include the "Security" component, and works just fine when it's not included. I'm thinking it might be related to the Security.salt value somehow, or possibly to the saved session info, but I don't really have a deep enough knowledge of CakePHP to figure it out. Can anyone offer any insight here?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Learning MVC - Maintaining model state

    - by GenericTypeTea
    First of all, I'm very new to MVC. Bought the books, but not got the T-Shirt yet. I've put together my first little application, but I'm looking at the way I'm maintaining my model and I don't think it looks right. My form contains the following: <% using (Html.BeginForm("Reconfigured", null, FormMethod.Post, new { id = "configurationForm" })) { %> <%= Html.DropDownList("selectedCompany", new SelectList(Model.Companies, Model.SelectedCompany), new { onchange = "$('#configurationForm').submit()" })%> <%= Html.DropDownList("selectedDepartment", new SelectList(Model.Departments, Model.SelectedDepartment), new { onchange = "$('#configurationForm').submit()" })%> <%=Html.TextArea("comment", Model.Comment) %> <%} %> My controller has the following: public ActionResult Index(string company, string department, string comment) { TestModel form = new TestModel(); form.Departments = _someRepository.GetList(); form.Companies = _someRepository.GetList(); form.Comment = comment; form.SelectedCompany = company; form.SelectedDepartment = department; return View(form); } [HttpPost] public ActionResult Reconfigured(string selectedCompany, string selectedDepartment, string comment) { return RedirectToAction("Index", new { company = selectedCompany, department = selectedDepartment, comment = comment}); } And finally, this is my route: routes.MapRoute( "Default", "{controller}/{company}/{department}", new { controller = "CompanyController", action = "Index", company="", department="" } ); Now, every time I change DropDownList value, all my values are maintained. I end up with a URL like the following after the Reconfigure action is called: http://localhost/Main/Index/Company/Sales?comment=Foo%20Bar Ideally I'd like the URL to remain as: http://localhost/Main/Index My routing object is probably wrong. This can't be the right way? It seems totally wrong to me as for each extra field I add, I have to add the property into the Index() method? I had a look at this answer where the form is passed through TempData. This is obviously an improvement, but it's not strongly typed? Is there a way to do something similar but have it strongly typed? This may be a simple-enough question, but the curse of 10 years of WinForms/WebForms makes this MVC malarky hard to get your head 'round.

    Read the article

  • Get the first and second objects from a list using LINQ

    - by Vahid
    I have a list of Person objects. How can I get the first and second Person objects that meet a certain criteria from List<Person> People using LINQ? Let's say here is the list I've got. How can I get the first and second persons that are over 18 that is James and Jodie. public class Person { public string Name; public int age; } var People = new List<Person> { new Person {Name = "Jack", Age = 15}, new Person {Name = "James" , Age = 19}, new Person {Name = "John" , Age = 14}, new Person {Name = "Jodie" , Age = 21}, new Person {Name = "Jessie" , Age = 19} }

    Read the article

  • Qt Qbrush issue

    - by Solitaire
    What is the difference in the following code, QGraphicsScene * scence = new QGraphicsScene(); QBrush *brush = new QBrush((QColor(60,20,20))); scence->setBackgroundBrush(*brush); QGraphicsView *view = new QGraphicsView(); view->setScene(scence); //view->setBackgroundBrush(*brush); //view->setCacheMode(QGraphicsView::CacheBackground); view->showFullScreen(); gives black color background QGraphicsScene * scence = new QGraphicsScene(); QBrush *brush = new QBrush(); brush->setColor(QColor(60,20,20)); scence->setBackgroundBrush(*brush); QGraphicsView *view = new QGraphicsView(); view->setScene(scence); //view->setBackgroundBrush(*brush); //view->setCacheMode(QGraphicsView::CacheBackground); view->showFullScreen(); it gives nothing.

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • Self-extracting Delphi program

    - by Steve
    I'm writing an updater program in Delphi7 which will be run once, but needs many files to run. What I'd like the achieve: 1, User runs exe 2, Exe unpacks files, runs updater 3, If updater detects and error, prompts the user to send log in e-mail 4, After the updater is run, temporary files are deleted (some of these files are dlls used by the updater program, so the updater has to be closed before the files can be deleted) Can anyone recommend a good solution? I've thought about using Inno Setup (too complicated for such an easy task) or using a self-extracting zip file (but how to delete the files afterwards)? Thanks!

    Read the article

  • click li, go to next li

    - by steve
    Can't find a simple solution to this, I know it's easy and I've tried a few things but I can't quite get it to work. I'm currently working with a sidescrolling site and I want every time you click an image (contained in an li) it scrolls to the next li. I have jQuery plugin localscroll so it smoothly goes from one to the next, and that's working. I need to now write a code that triggers jQuery to utilize the localscroll function and go to the next li. Right now I have this, but I know it's not right: $(document).ready(function () { var gallery = $('.wrapper ul li') $(gallery).click(function() { $.localscroll().next(li); }); });

    Read the article

  • windows phone deserialization json

    - by user2042227
    I have a weird issue. so I am making a few calls in my app to a webservice, which replies with data. However I am using a token based login system, so the first time the user enters the app I get a token from the webservice to login for that specific user and that token returns only that users details. The problem I am having is when the user changes I need to make the calls again, to get the new user's details, but using visual studio's breakpoint debugging, it shows the new user's token making the call however the problem is when the json is getting deserialized, it is as if it still reads the old data and deserializes that, when I exit my app with the new user it works fine, so its as if it is reading cached values, but I have no idea how to clear it? I am sure the new calls are being made and the problem lies with the deserializing, but I have tried clearing the values before deserializing them again, however nothing works. am I missing something with the json deserializer, how van I clear its cached values? here I make the call and set it not to cache so it makes a new call everytime: client.Headers[HttpRequestHeader.CacheControl] = "no-cache"; var token_details = await client.DownloadStringTaskAsync(uri); and here I deserialize the result, it is at this section the old data gets shown, so the raw json being shown inside "token_details" is correct, only once I deserialize the token_details, it shows the wrong data. deserialized = JsonConvert.DeserializeObject(token_details); and the class I am deserializing into is a simple class nothing special happening here, I have even tried making the constructor so that it clears the values each time it gets called. public class test { public string status { get; set; } public string name{ get; set; } public string birthday{ get; set; } public string errorDes{ get; set; } public test() { status = ""; name= ""; birthday= ""; errorDes= ""; } } uri's before making the calls: {https://whatever.co.za/token/?code=BEBCg==&id=WP7&junk=121edcd5-ad4d-4185-bef0-22a4d27f2d0c} - old call "UBCg==" - old reply {https://whatever.co.za/token/?code=ABCg==&id=WP7&junk=56cc2285-a5b8-401e-be21-fec8259de6dd} - new call "UBCg==" - new response which is the same response as old call as you can see i did attach a new GUID everytime i make the call, but then the new uri is read before making the downloadstringtaskasync method call, but it returns with the old data

    Read the article

  • How do you insert 9 MB file into a Blob Field Using Oracle.DataAccess?

    - by discwiz
    Trying to insert a large audio file into an Oracle 10g database and keep getting this error: ORA-01460: unimplemented or unreasonable conversion requested The byte array length of the audio file is 2702577. The procedure works with smaller array lengths, but not the larger ones. Here is my code and Thanks! Dim oracleConnection As New OracleClient.OracleConnection Dim Cmd As New OracleClient.OracleCommand Dim oracleDataAdapter As New OracleDataAdapter oracleConnection.ConnectionString = System.Configuration.ConfigurationManager.AppSettings("MasterConnectionODT") Cmd.Connection = oracleConnection Cmd.CommandText = "Audio.ADD_AUDIO" Cmd.CommandType = CommandType.StoredProcedure Dim aParam As New OracleClient.OracleParameter aParam.ParameterName = "I_FACILITY_ID_C" aParam.OracleType = OracleType.Char aParam.Value = FacID aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) aParam = New OracleParameter aParam.ParameterName = "I_TARP_ID_N" aParam.OracleType = OracleType.Number aParam.Value = TarpID aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) aParam = New OracleParameter aParam.ParameterName = "I_AUDIO_BLOB" aParam.OracleType = OracleType.Blob aParam.Value = Audio aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) Using oracleConnection oracleConnection.Open() Cmd.ExecuteNonQuery() End Using

    Read the article

  • How to bind a List to a WPF treeview using Xaml?

    - by Joan Venge
    I don't know how to bind a List of Drink to a WPF TreeView. struct Drink { public string Name { get; private set; } public int Popularity { get; private set; } public Drink ( string name, int popularity ) : this ( ) { this.Name = name; this.Popularity = popularity; } } List<Drink> coldDrinks = new List<Drink> ( ){ new Drink ( "Water", 1 ), new Drink ( "Fanta", 2 ), new Drink ( "Sprite", 3 ), new Drink ( "Coke", 4 ), new Drink ( "Milk", 5 ) }; } } I have searched the web, for instance saw here. But what's this even mean: ItemsSource="{x:Static local:TreeTest.BoatList}" x:? static? local? How do you specify a collection in your code in the xaml?

    Read the article

  • Rails Controller

    - by Steve
    Hi...In Rails, is it ok to define logic in a controller with a model. For example, take there is an User Model, which is good design. 1)Leaving the UserModel with the CRUD models and moving all the other User Specific actions to a separate controller or 2)Add the user specific actions to the same UserModels Thanks :)

    Read the article

  • Strange results - I obtain same value for all keys

    - by Pietro Luciani
    I have a problem with mapreduce. Giving as input a list of song ("Songname"#"UserID"#"boolean") i must have as result a song list in which is specified how many time different useres listen them... so a output ("Songname","timelistening"). I used hashtable to allow only one couple . With short files it works well but when I put as input a list about 1000000 of records it returns me the same value (20) for all records. This is my mapper: public static class CanzoniMapper extends Mapper<Object, Text, Text, IntWritable>{ private IntWritable userID = new IntWritable(0); private Text song = new Text(); public void map(Object key, Text value, Context context) throws IOException, InterruptedException { /*StringTokenizer itr = new StringTokenizer(value.toString()); while (itr.hasMoreTokens()) { word.set(itr.nextToken()); context.write(word, one); }*/ String[] caratteri = value.toString().split("#"); if(caratteri[2].equals("1")){ song.set(caratteri[0]); userID.set(Integer.parseInt(caratteri[1])); context.write(song,userID); } } } This is my reducer: public static class CanzoniReducer extends Reducer<Text,IntWritable,Text,IntWritable> { private IntWritable result = new IntWritable(); public void reduce(Text key, Iterable<IntWritable> values, Context context) throws IOException, InterruptedException { Hashtable<IntWritable,Text> doppioni = new Hashtable<IntWritable,Text>(); for (IntWritable val : values) { doppioni.put(val,key); } result.set(doppioni.size()); //doppioni.clear(); context.write(key,result); } } and main: Configuration conf = new Configuration(); Job job = new Job(conf, "word count"); job.setJarByClass(Canzoni.class); job.setMapperClass(CanzoniMapper.class); //job.setCombinerClass(CanzoniReducer.class); //job.setNumReduceTasks(2); job.setReducerClass(CanzoniReducer.class); job.setOutputKeyClass(Text.class); job.setOutputValueClass(IntWritable.class); FileInputFormat.addInputPath(job, new Path(args[0])); FileOutputFormat.setOutputPath(job, new Path(args[1])); System.exit(job.waitForCompletion(true) ? 0 : 1); Any idea???

    Read the article

  • php run function on all images from one dir in recursive mode (noob)

    - by Steve
    hey guyz i have a function $result = create_watermark( 'input_file_name' ,'output_file_name'); i have dir called /images n have 500 images in it and all images are link images_(some_unknown_numbers).png (all png) now i want run them thru function in loop and want out put like /markedimage/images_1.png images_2.png images_3.png i need help how can i run them in loop and how out put name can change want run script on Ubuntu so we can use shell too if any body want check function it is here http://paste2.org/p/789149 plz provide me code because i m newbie thanks in advance

    Read the article

  • Compare values for audit trail

    - by kagaku
    I'm attempting to develop an audit trail/tracking solution for an existing database written in PLSQL/PHP - however I'm still unsure as of yet on an easy (to implement and maintain) solution for tracking changes to fields/values. For instance, the project tracking portion of the DB APP tracks over 200 fields and ideally I'd like a nice way to show a history of changes, such as: 5/10/2010 - Project 435232 updated by John Doe Changed Project Name (Old: Test Project; New: Super Test Project) Changed Submission Date (Old: 5/10/2010; New: 5/11/2010) Changed Description (Old: This is an example!; New: This is a test example) Essentially for each field (db column) it would output a new line to show the old/new values. So far my current idea is saving the current version of the data to a temporary table, updating the primary table with the new data then loading each row into an array and doing an array compare to determine the differences. This seems a bit convoluted, and if there is an easier method I'd love to know it. Any ideas or suggestions are much appreciated!

    Read the article

  • How do you protect a common resource using mutexes?

    - by Steve
    I have a common resource, which I want 1 and only 1 instance of my application (or it's COM API) to have access to at any time. I have tried to protect this resource using mutexes, but when multiple threads of a host dotnet application try to access the COM object, the mutex doesn't seem to be released. This is the code I have used to protect my resource. repeat Mutex := CreateMutex(nil, True, PChar('Connections')); until (Mutex <> 0) and (GetLastError <> ERROR_ALREADY_EXISTS); try //use resource here! finally CloseHandle(Mutex); end; If I run the threads simultaneously, the first thread get's through (obviously, being the first one to create the mutex), but subsequent threads are caught in the repeat loop. If I run each thread at 5 second intervals, then all is ok. I suspect I'm not using mutexes correctly here, but I have found very little documentation about how to do this. Any ideas?

    Read the article

  • Google Site Data fetching

    - by inTagger
    Hail! I want to fetch image from NOT PUBLIC Google Site's page. I'm using WebClient for this purposes. var uri = new Uri("http://sites.google.com/a/MYDOMAIN.COM/SITENAME/" + "_/rsrc/1234567890/MYIMAGE.jpg"); string fileName = "d:\\!temp\\MYIMAGE.jpg"; if (File.Exists(fileName)) File.Delete(fileName); using (var webClient = new WebClient()) { var networkCredential = new NetworkCredential("USERNAME", "PASSWORD"); var credentialCache = new CredentialCache { {new Uri("sites.google.com"), "Basic", networkCredential}, {new Uri("www.google.com"), "Basic", networkCredential} }; webClient.Credentials = credentialCache; webClient.DownloadFile(uri, fileName); } It doesn't download image, but html file with login form is downloaded. If i open this link in browser it shows me login form then i enter username and password and then i can see the image. How i must use my credentials to download file with WebClient or HttpWebRequest?

    Read the article

  • Empty namespace using Linq Xml

    - by porum
    I'm trying to create a sitemap using Linq to Xml, but am getting an empty namespace attribute, which I would like to get rid of. e.g. XNamespace ns = "http://www.sitemaps.org/schemas/sitemap/0.9"; XDocument xdoc = new XDocument(new XDeclaration("1.0", "utf-8", "true"), new XElement(ns + "urlset", new XElement("url", new XElement("loc", "http://www.example.com/page"), new XElement("lastmod", "2008-09-14")))); The result is ... <urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"> <url xmlns=""> <loc>http://www.example.com/page</loc> <lastmod>2008-09-14</lastmod> </url> </urlset> I would rather not have the xmlns="" on the url element. I can strip it out using Replace on the final xdoc.ToString(), but is there a more correct way?

    Read the article

  • How to encrypt and save a binary stream after serialization and read it back?

    - by Anindya Chatterjee
    I am having some problems in using CryptoStream when I want to encrypt a binary stream after binary serialization and save it to a file. I am getting the following exception System.ArgumentException : Stream was not readable. Can anybody please show me how to encrypt a binary stream and save it to a file and deserialize it back correctly? The code is as follows: class Program { public static void Main(string[] args) { var b = new B {Name = "BB"}; WriteFile<B>(@"C:\test.bin", b, true); var bb = ReadFile<B>(@"C:\test.bin", true); Console.WriteLine(b.Name == bb.Name); Console.ReadLine(); } public static T ReadFile<T>(string file, bool decrypt) { T bObj = default(T); var _binaryFormatter = new BinaryFormatter(); Stream buffer = null; using (var stream = new FileStream(file, FileMode.OpenOrCreate)) { if(decrypt) { const string strEncrypt = "*#4$%^.++q~!cfr0(_!#$@$!&#&#*&@(7cy9rn8r265&$@&*E^184t44tq2cr9o3r6329"; byte[] dv = {0x12, 0x34, 0x56, 0x78, 0x90, 0xAB, 0xCD, 0xEF}; CryptoStream cs; DESCryptoServiceProvider des = null; var byKey = Encoding.UTF8.GetBytes(strEncrypt.Substring(0, 8)); using (des = new DESCryptoServiceProvider()) { cs = new CryptoStream(stream, des.CreateEncryptor(byKey, dv), CryptoStreamMode.Read); } buffer = cs; } else buffer = stream; try { bObj = (T) _binaryFormatter.Deserialize(buffer); } catch(SerializationException ex) { Console.WriteLine(ex.Message); } } return bObj; } public static void WriteFile<T>(string file, T bObj, bool encrypt) { var _binaryFormatter = new BinaryFormatter(); Stream buffer; using (var stream = new FileStream(file, FileMode.Create)) { try { if(encrypt) { const string strEncrypt = "*#4$%^.++q~!cfr0(_!#$@$!&#&#*&@(7cy9rn8r265&$@&*E^184t44tq2cr9o3r6329"; byte[] dv = {0x12, 0x34, 0x56, 0x78, 0x90, 0xAB, 0xCD, 0xEF}; CryptoStream cs; DESCryptoServiceProvider des = null; var byKey = Encoding.UTF8.GetBytes(strEncrypt.Substring(0, 8)); using (des = new DESCryptoServiceProvider()) { cs = new CryptoStream(stream, des.CreateEncryptor(byKey, dv), CryptoStreamMode.Write); buffer = cs; } } else buffer = stream; _binaryFormatter.Serialize(buffer, bObj); buffer.Flush(); } catch(SerializationException ex) { Console.WriteLine(ex.Message); } } } } [Serializable] public class B { public string Name {get; set;} } It throws the serialization exception as follows The input stream is not a valid binary format. The starting contents (in bytes) are: 3F-17-2E-20-80-56-A3-2A-46-63-22-C4-49-56-22-B4-DA ...

    Read the article

  • Remove .net ContextMenuStrip Padding

    - by Frosty840
    Hi, When creating a ContextMenuStrip, there is a huge amount of padding around the contained controls. For example: Me.myMenu = New ContextMenuStrip 'unset all obvious padding settings' Me.myMenu.ShowCheckMargin = False Me.myMenu.ShowImageMargin = False Me.myMenu.Margin = New System.Windows.Forms.Padding(0) Me.myMenu.Padding = New System.Windows.Forms.Padding(0) Dim addButton As New Button addButton.Size = New Size(60, 60) addButton.Text = "Button" Dim addControlHost As New ToolStripControlHost(addButton) Me.myMenu.Items.Add(addcontrolhost) Me.ContextMenuStrip = Me.myMenu This, ideally, would cause a 60x60 button to pop up at the cursor location. What actually pops up is this: The button is there, as expected, but despite there being no margin, no padding, and having set both Show*Margin settings to False, there is a massive border around the Button. I'm probably missing something blindingly obvious, but how can I get rid of all the white bordering, especially that huge right-hand margin?

    Read the article

  • PhoneGap's vibrate() and beep() functions break in iPhone, Android emulators

    - by Steve Nay
    I have a PhoneGap app that I'm testing on webOS, Android, and iPhone. I'm using physical devices as well as emulators (the ones that come with their respective SDKs, not the PhoneGap emulator). Part of the code uses the navigator.notification.vibrate() and navigator.notification.beep() functions. All the physical devices I'm using either perform the behavior or ignore it if they're not capable (e.g., the iPod can't vibrate). However, the emulators behave differently. The Android emulator kills the app whenever the beep() function is called. The iPhone emulator causes the app to hang whenever the vibrate() function is called. Is there any way to get the emulators to ignore those function calls when they are unable to execute them? That is, is there a way to get them to degrade gracefully so I can test the app both places without having to modify the code specifically for the emulators?

    Read the article

  • How to copy from C# control and paste link into excel.

    - by Steve H.
    I have an application that I want to link to excel. I have no preference which control is used as long as I can copy the data or control, and paste link into excel. When the data changes in my application, I want the cell to change in excel. I have a client that claims it is possible and he has seen it, but has no proof and may be confused. I have searched the internet and have come up with a number of half-solutions, and people who want the opposite of what I want. Does anyone know the full solution?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 348 349 350 351 352 353 354 355 356 357 358 359  | Next Page >