Search Results

Search found 19305 results on 773 pages for 'above the gods'.

Page 353/773 | < Previous Page | 349 350 351 352 353 354 355 356 357 358 359 360  | Next Page >

• Accorian menu is not working properly

  - by Zerotoinfinite

  Hi, I am using accordin menu in my site, placed in Master Page, It has 4 pane, each pane have multiple links. it was working fine previously. But suddenly it is displaying this error message There is no source code available for the current location. It's is asking for show assembly. When I clicked on that I got a stopage at the stack 0000001a mov eax,dword ptr [ebp-0Ch] -- I am really not sure what does it means. Also, there are several links in accordin menu, after clicking on anyone of the link I am not able to click the other link, might be because of the above reason. Please help

  Read the article

• openssl ssl encryption

  - by deddihp

  Hello, I want to discuss about openssl write and read method. Assume I have an data structure like below: /-----------------------------------------------------\ | my_header | PAYLOAD | \-----------------------------------------------------/ | | \ / \ / not encrypted encrypted I think the proper algorithm would be like this : SEND: build my_header with my own header. encrypt PAYLOAD with encryption function attach my_header and PAYLOAD (encrypted) to one buffer send it using common POSIX function just like send or sendto RECV: using common POSIX function just like recv or recvfrom. extract my_header and PAYLOAD(encrypted) decrypt PAYLOAD with decryption function at last i got my_header and PAYLOAD(decrypted). How is your approach if you face a problem like above. Since openssl encrypt all of data that is sent to SSL_write function (CMIIW). Thanks

  Read the article

• Interpretation of Greek characters by FOP

  - by Geek

  Hi, Can you please help me interpret the Greek Characters with HTML display as HTML= & #8062; and Hex value 01F7E Details of these characters can be found on the below URL http://www.isthisthingon.org/unicode/index.php?page=01&subpage=F&hilite=01F7E When I run this character in Apache FOP, they give me an ArrayIndexOut of Bounds Exception Caused by: java.lang.ArrayIndexOutOfBoundsException: -1 at org.apache.fop.text.linebreak.LineBreakUtils.getLineBreakPairProperty(LineBreakUtils.java:668) at org.apache.fop.text.linebreak.LineBreakStatus.nextChar(LineBreakStatus.java:117) When I looked into the FOP Code, I was unable to understand the need for lineBreakProperties[][] Array in LineBreakUtils.java. I also noticed that FOP fails for all the Greek characters mentioned on the above page which are non-displayable with the similar error. What are these special characters ? Why is their no display for these characters are these Line Breaks or TAB’s ? Has anyone solved a similar issue with FOP ?

  Read the article

• ArrangeOverride Vs Storyboard Animation

  - by user275561

  Now I may not grasp the idea or this could be a mistake so feel free to correct me. I am doing a bubble breaker game in Silverlight. So when a bubble in a column gets bursted. I want to animate the above bubbles to simulate that they are being dropped. Each bubble knows its Row and column location and that gets updated in the View Model. Now my question is, Should I call invalidateArrange() on the Canvas from the ViewModel so it rearranges the bubbles or just have a storyboard animate the TranslateY. In my arrangeOverride Method I have something like this Rect childBounds = new Rect(CalculateLeft(dataContext.Column), CalculateTop(dataContext.Row), BubbleSize, BubbleSize); child.Arrange(childBounds); If there is a better way let me know. I am trying to learn the best practices.

  Read the article

• Python Threading

  - by anteater7171

  I'm trying to make a simple program that continually displays and updates a label that displays the CPU usage, while having other unrelated things going on. I've done enough research to know that threading is likely going to be involved. However, I'm having trouble applying what I've seen in simple examples of threading to what I'm trying to do. What I currently have going: import Tkinter import psutil,time from PIL import Image, ImageTk class simpleapp_tk(Tkinter.Tk): def __init__(self,parent): Tkinter.Tk.__init__(self,parent) self.parent = parent self.initialize() def initialize(self): self.labelVariable = Tkinter.StringVar() self.label = Tkinter.Label(self,textvariable=self.labelVariable) self.label.pack() self.button = Tkinter.Button(self,text='button',command=self.A) self.button.pack() def A (self): G = str(round(psutil.cpu_percent(), 1)) + '%' print G self.labelVariable.set(G) def B (self): print "hello" if __name__ == "__main__": app = simpleapp_tk(None) app.mainloop() In the above code I'm basically trying to get command A continually running, while allowing command B to be done when the users presses the button.

  Read the article

• trying to fade out a top div on hover to reveal working links in text below using JQuery

  - by Heath

  I need to fade a div (and image) to reveal a div underneath (text with clickable links) using jQuery. <script> $(document).ready(function(){ $("img.a").hover( function() { $(this).stop().animate({"opacity": "0"}, "slow"); }, function() { $(this).stop().animate({"opacity": "1"}, "slow"); }); }); </script> Used the above code and all worked well, until I went to click the links. Seems the top hidden div is preventing me from doing so. Tried the replaceWith function and that allowed me to click the links too - but couldn't get it to go back to showing original div when I moused out. Also, bossman wants the transition to be gradual - like a fade... Any suggestions? Many thanks! Heath

  Read the article

• Get th lat and lon using address

  - by sairam333

  Hi I use below code for getting the lattitude and longitude Using the given address try { List<Address> foundAdresses = gc.getFromLocationName(addressInput, 5); //Search addresses for (int j = 0; j < foundAdresses.size(); ++j) { //Save results as Longitude and Latitude //@todo: if more than one result, then show a selected-list Address x = foundAdresses.get(j); lat = x.getLatitude(); lon = x.getLongitude(); } } catch(Exception e) { } But the above code does not return any values into lat,lon(double variables), and i sue the uses-permissions in android manifest file also But the lat,lon variables does not getting any values.Please give me some suggestions.Thanks in advance.

  Read the article

• Request error "enable cookies" while posting app request to LinkedIn

  - by Jay

  Cookie error Hi, I am running S60 SDK 5th with Eclipse pulsar on win 7. I have oauth_token using with this Url https://www.linkedin.com/uas/oauth/authorize?oauth_token=. To get that grant access screen by LinkedIn. I am loading above Url using htmlComponent, and adding HtmlComponent to form and show it. Occasionally when I click on the "Ok I'll Allow It" button (i.e. after the button has been pressed) I get the following error message. "We’re sorry, there was a problem with your request. Please make sure you have cookies enabled and try again." but i'm receiving the response with oauth_token, oauth_token_secret, oauth_callback_confirmed = true, xoauth_request_auth_url, oauth_expires_in. Some buddy please help.

  Read the article

• xml validity with xsd with xsi:nillable element

  - by Laxmikanth Samudrala

  My XML file <tns:SampleInfoResponse xsi:schemaLocation="sampleNS test.xsd" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:tns="sampleNS"> String String String String String String String String String String String String MY XSD file <xsd:schema targetNamespace="sampleNS" elementFormDefault="qualified" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:tns="sampleNS" xmlns="http://www.w3.org/2001/XMLSchema"> parser is complaining on <tns:LSampleEnrlDetails/>, the XML file should be <tns:LSampleEnrlDetails xsi:nil="true"/> only for valid file ? By taking out the whole tag also the parser is complaining. I would like to know what possible cases for this tag makes the XML file valid according the above schema when i don't have the data to populate for tag

  Read the article

• Serializing response from JSP and converting them to C# objects

  - by SARAVAN

  I have a silverlight web application. From this app I am making a call to .jsp pages using WebClient class. Now jsp returns a response in the following format { "results":[{"Value":"1","Name":"Advertising"}, {"Value":"2","Name":"Automotive Expenses"},{"Value":"3","Name":"Business Miscellaneous"}] } The above response is assigned to my Stream object. I have a c# class CategoryType public class CategoryType { public string Value{get;set;} public string Name{get;set;} } My aim is to convert the reponses in to Collection<CategoryType> and use it in my C# Code As of now I am trying to use DataContractJSONSerialiser. But not sure if there is an easy and efficent way to do this. Any help would be appreciated

  Read the article

• Why does a looser specification in an overriding method compile after the exception specification fo

  - by Everyone

  The code below has an overridden method with a looser exception specification as compared to the method being overridden. //AnotherMain.java public class AnotherMain { public void dummyMethod( String args[] ) throws IOException{ throw new IOException(); } } //SubAnotherMain.java public class SubAnotherMain extends AnotherMain{ @Override public void dummyMethod( String[] args ) throws Exception { // To get this to compile, change the above - throws IOException, Exception super.dummyMethod(args); throw new Exception("This will not compile unless the exception specification has IOException too"); } } Afaik, the overriding method should not compile at all as the looser specification might break substitutability. Why does it compile after the original exception specification is included in the override? What have I misunderstood?

  Read the article

• AppDomain.UnhandeledException event not fired

  - by Yaakov Davis

  In a WPF application, the app simply crashes, without the above event being fired. (I'm also registered to DispatcherUnhandeledException, which doesn't fire as well.) I conclude that it doesn't fire since the handler is defined to place a log entry. When looking at the log, there's no corresponding entry. It happens in a production environment; I'm unable to point at a particular scenario. I've read few descriptions on scenarios where this might happen, but I still don't have a clear grasp on this. Can anyone share his experience / knowledge on this? How can I find the root of the crash and solve it? Many thanks.

  Read the article

• Are Symphony and CakePHP too slow to be usable?

  - by Aziz Light

  Until now, I have always said that CakePHP is too bloated and slow. I don't really know that, I just saw "some" benchmarks. What I really want to know, is that if those two frameworks (Symfony and CakePHP) are too slow to be usable in a way that the user will get frustrated. I already know that those frameworks are slower than other alternatives, but that's not the question. I ask the question because I want to create a project management web application and I still hesitate between a couple frameworks. I've had some trouble learning Zend, but imho I haven't tried hard enough. So in conclusion, in addition to the first question above, I would like to ask another question: If I want to create a project management tool (which is a pretty big project), which of the following should you suggest, considering the developement time, the speed of the resulting application, and the robustness of the final product: Symphony CakePHP Zend Framework Also I should mention that I don't know any of those frameworks, and that I want to learn one of them (at least).

  Read the article

• Get a value of checked checkbox into a button from a Gridview

  - by Nimish Kulkarni

  I have a Gridview Generated as follows : <asp:GridView ID="Cash_GridView" runat="server" CssClass="Grid" > <Columns> <asp:TemplateField> <ItemTemplate> <asp:CheckBox ID="MemberCheck" runat="server" /> </ItemTemplate> </asp:TemplateField> <asp:BoundField DataField="Loan_Acno" HeaderText="Loan A/C number" /> </Columns> </asp:Gridview> <asp:Button ID="CashPayButton" runat="server" Text="Pay Dividend" CssClass="bluesome" OnClick="CashPayButton_Click" /> And also having the above button click event now when i click checkbox on particular row i want that whole row to be get caluclated in the Button click event in the code behind protected void CashPayButton_Click(object sender, EventArgs e) { }

  Read the article

• Documentation concerning platform-specific macros in Linux/POSIX

  - by Nubok

  When compiling a C/C++ program under Windows using Visual Studio (or a compiler that tries to be compatible) there is a predefined macro _WIN32 (Source: http://msdn.microsoft.com/en-us/library/b0084kay.aspx) that you can use for platform-specific #ifdef-s. What I am looking for is an analogon under Linux: a macro which tells me that I am compiling for Linux/an OS that claims to be (more or less) POSIX-compatible. So I looked into gcc documentation and found this: http://gcc.gnu.org/onlinedocs/cpp/System_002dspecific-Predefined-Macros.html Applied to my program, the following macros (gcc 4.4.5 - Ubuntu 10.10) looked promising (I hope that I didn't drop an important macro): #define __USE_BSD 1 #define __unix__ 1 #define __linux 1 #define __unix 1 #define __linux__ 1 #define _POSIX_SOURCE 1 #define __STDC_HOSTED__ 1 #define __STDC_IEC_559__ 1 #define __gnu_linux__ 1 #define __USE_SVID 1 #define __USE_XOPEN2K 1 #define __USE_POSIX199506 1 #define _G_USING_THUNKS 1 #define __USE_XOPEN2K8 1 #define _BSD_SOURCE 1 #define unix 1 #define linux 1 #define __USE_POSIX 1 #define __USE_POSIX199309 1 #define __SSP__ 1 #define _SVID_SOURCE 1 #define _G_HAVE_SYS_CDEFS 1 #define __USE_POSIX_IMPLICITLY 1 Where do I find a detailed documentation of them - as to the mentioned Windows-specific macros above? Additionally I'd be interested in macros normally defined for other POSIX-compliant operating systems as *BSD etc.

  Read the article

• How do you do a foursquare style uitableview refresh?

  - by nickthedude

  If you haven't seen their implementation Of the refresh of a tableview it is extremely slick. I was surprised to see no search results asking for this to be explained so I figured ask it myself. If you haven't seen it, it basically adds a subviews to the uitableview above the header to the blank part of the screen when you pull a uitableview view down farther than it has data to display. Sorry if that doesn't make sense but just download the app and you will immediately want to do it too. Just wondering how they did it?

  Read the article

• Best way to auto-restore db on an houlry basis

  - by aron

  Hello, I have a demo site where anyone can login and test a management interface. Every hour I would like to flush all the data in the SQL 2008 Database and restore it from the original. Rae Gate sql has some awesome tools for this, however they are beyond my budget right now. Could I simply make a backup copy of the database's data file, then have a c# console app that deletes it and copies over the original. Then I can have a windows schedule task to run the .exe every hour. It's simple and free... would this work? I'm using SQL Server 2008 R2 Web edition I understand that red gate is technically better because I can set it to analyze the db and only update the records that were altered, and the approach I have above is like a "sledge hammer".

  Read the article

• Cross Domain Post - Losing POST Data

  - by Tomas Beblar

  I have 2 servers, both running R2 / IIS7 / ASP Classic sites (can't get around any of that) Server A is making the follow calls: Dim objXMLHTTP, xml Set xml = Server.CreateObject("Msxml2.ServerXmlHTTP.6.0") xml.Open "POST", templateName, false xml.setRequestHeader "Content-Type", "application/xml" xml.Send variables Where the templateName is the URL of Server B (It's an email template) ... and variables are a name value pair string like a query string password=myPassword&customerEmail=Dear+Bob,.... Server B receives the POST but all the POST data (password=myPassword&customerEmail=Dear+Bob,....) is missing from the POST password = Request.Form("templatePassword") customerEmail = Request.Form("RackAttackCustomerEmail") The above values are all empty. Here's the kicker. This all worked on our old servers (Windows Server 2003, IIS 6) But when we migrated over, this stopped working correctly. My question is: What would cause the POST data to be dropped in IIS 7 when it all worked in IIS 6? I've done about 3 days of research into this trying many different things and nothing has worked. The POST data is just gone.

  Read the article

• How to safely backport specific linux kernel commits to an older kernel using git

  - by superc0w

  I'm currently on a stable 2.6.32 kernel. But I need certain fixes on 2.6.33 branch to be incorporated into this 2.6.32 kernel so that I can create a custom kernel for testing purposes. I can't apply the said fixes directly to the 2.6.32 source because they seem to have dependencies on other fixes. Is there any safe way to incorporate only the fixes (and all their dependencies) I need into the 2.6.32 kernel with git to create a custom kernel? Assuming there is a way to do the above, is there a way to track the fixes that have been applied to the custom kernel (i.e. track which commits have been applied to the 2.6.32 kernel to create the custom kernel source)?

  Read the article

• can't publish my asp.net project?

  - by Sulaiman

  dears, when try to publish my mroject I get this error: Error 3 Task failed because "AL.exe" was not found, or the correct Microsoft Windows SDK is not installed. The task is looking for "AL.exe" in the "bin" subdirectory beneath the location specified in the InstallationFolder value of the registry key HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Microsoft SDKs\Windows\v6.0A. You may be able to solve the problem by doing one of the following: 1) Install the Microsoft Windows SDK for Windows Server 2008 and .NET Framework 3.5. 2) Install Visual Studio 2008. 3) Manually set the above registry key to the correct location. 4) Pass the correct location into the "ToolPath" parameter of the task.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Web.config encryption/decryption

  - by Akshay

  In my applications we.config file I have a connection string stored. I encrypted it using '---open the web.config file Dim config As Configuration = _ ConfigurationManager.OpenWebConfiguration( _ Request.ApplicationPath) '---indicate the section to protect Dim section As ConfigurationSection = _ config.Sections("connectionStrings") '---specify the protection provider section.SectionInformation.ProtectSection(protectionProvider) '---Apple the protection and update config.Save() Now I can decrypt it using the code Dim config As Configuration = _ ConfigurationManager.OpenWebConfiguration( _ Request.ApplicationPath) Dim section As ConfigurationSection = _ config.Sections("connectionStrings") section.SectionInformation.UnProtectSection() config.Save() I want to know where is the key stored. Also If somehow my web.config file is stolen, will it be possible for him/her to decrypt it using thhe code above.

  Read the article

• clang parser pass example

  - by anon

  Hi! Can anyone paste sample code for a clang extra preprocessor pass where it: takes every variable named "foo", and renames it "bar", thus making the following code legal: int main() { int foo; bar = 5; } ? Thanks! [Aside: what I'm trying to do is write my own macro system for clang. Doing the above will let me inject at the right level to do my rewrites.] Thanks!

  Read the article

• ASMX Still slow after 'Generate serialization assembly'

  - by Buzzer

  This question is related to: http://stackoverflow.com/questions/784918/asmx-web-service-slow-first-request. I inherited a proxy to a legacy ASMX Service. Basically as the post above states, the first call performance is literally 10 times slower than the subsequent calls. I went ahead and turned on ‘Generate serialization assembly' on the project that contains the proxy. The 'serializers' assembly is actually generated. However, I haven't seen any performance increase at all. Do I need to do anything else other than make sure the 'serializers' assembly is in the client's bin directory? Do I have to 'link' the proxy to the 'serializers' assembly during proxy generation (wsdl.exe)? I guess I'm stuck at this point. J Saunders where u at? :)

  Read the article

• WSS 3.0 navigation structure

  - by Dante

  Hi all, I'm a beginner in WSS 3.0 and I'm having some problems with the navigation setup. I can't find any documentation that clearly recommends best practices in this area. I'm trying to create an intranet, custom look and feel, that should have a structure similar to: Company - News - News type 1 - News type 2 - Organogram - ... Employees - Employees 1 - Employees 2 - Employees 2_1 - ... How to properly set this up? Company, News, are sites/subsites? And News type 1 and 2 are pages within a site? I created as described above and in the master page of the main site I added some scripts that will be used by web parts, like jquery. The subsites will have their own master page and will not recognize the scripts, I need to add them there which is annoying. Any recommendations? Or some resource that provides best practices setting up these structures? Thx in advance

  Read the article

< Previous Page | 349 350 351 352 353 354 355 356 357 358 359 360  | Next Page >