Search Results

Search found 20617 results on 825 pages for 'mac os'.

Page 363/825 | < Previous Page | 359 360 361 362 363 364 365 366 367 368 369 370  | Next Page >

• Can I delete the OEM partition on the new Dell XPS 15?

  - by timepilot

  My new Dell XPS 15 L521X just arrived. I need to set this up to dual boot Linux. Sadly, the system comes with four primary partitions. I can't do a clean install at the moment, so one of the partitions will have to be deleted before I can install Linux. The layout is as follows: OEM: 39mb Hibernation: 8gb OS: 457gb Recovery: 12gb Obviously, I can't delete the Hibernation and OS partitions (will shrink to make space for Linux) and I'd like to keep the recovery partition if possible. So my question is what is on the small OEM partition? What functionality will I lose if I delete it?

  Read the article

• Is there an Ubuntu alternative to iExplorer (formerly iPhone Explorer)?

  - by nerdabilly

  I'm trying to view the entire contents of my iPhone in Ubuntu 10.04. I'm able to mount and view the digital media folders, but I'm looking for behavior more like the Mac/Windows iExplorer app that will list the /var folder as well as Applications, etc rather than just making it look like an external filesystem. I've found a few options that require jailbreak but I'd rather not go that route if it's at all possible. Thanks!

  Read the article

• Google incruste son outil de conversion vers le HTML5 dans Flash Professionnel, Swiffy y est disponible en tant que plug-in

  Google incruste son outil de conversion vers le HTML5 dans Flash Professionnel Swiffy y est disponible en tant que plug-in Mise à jour du 17 novembre 2011 par Idelways Google avait sorti Swiffy en juin dernier (lire ci-devant), un outil de conversion Flash/HTML5 qu'il propose aujourd'hui en tant que plug-in pour Flash Professionnel, l'environnement phare de création d'animations multimédia d'Adobe. Cette extension disponible pour Windows et Mac OS incruste la commande d'exportation vers le HTML5 dans les menus du navigateur. Elle est aussi disponible via raccourci clavier pour une meilleure intégration au flux de travail...

  Read the article

• Computer temporarily freezes and then resumes

  - by trizicus

  This happens on ALL operating systems (7, Ubuntu, etc.). What happens is everything for 1-3 seconds becomes unresponsive, I then hear what sounds like my other internal hard drive 'spinning up', and then viola everything is responsive again. Note: Already ran SMART tests, no issues at all. I think issue is that the HDD spins down and when need it gets 'turned-on' (OS settings turn off HDD's after 20 mins of inactivity) and because my pagefile is on the other HDD it causes OS to temporarily freeze. Need more tips, and insight. Thanks More info: Running Quad CPU, 4GB RAM, Intel SSD, GT 240.

  Read the article

• Get started with Omnis Studio

  <b>Linux User and Developer:</b> "Omnis Studio is a cross-platform (Windows, Mac and Linux) Rapid Application Development tool. It allows you to quickly build applications using a combination of graphical elements as well as a code editor."

  Read the article

• What are the major distinctions between PureDarwin and FreeBSD?

  - by ??????? ???????????

  I'm looking to install a different unix on my workstation to acquire some perspective on GNU/Linux and out of curiosity. I have narrowed my options down to these two. The reason for considering PureDarwin is because I have very little experience with Apple's products. So my question is will installing and using PureDarwin give me a closer understanding of OSX than would running FreeBSD? What I have in mind are day to day routines like adding users, installing software and configuring various aspects of the underlying OS. I know that the GUI of OSX would not be available, but that is not a concern. As a secondary, less important question, can I buy OS X in the apple store and run it in a virtual machine or does that violate their EULA?

  Read the article

• Google Chrome 5 et ses nombreuses améliorations sortent officiellement et simultanément sur Linux, M

  Mise à jour du 26/05/10 Google Chrome 5 et ses nombreuses améliorations sortent officiellement Et simultanément sur Linux, Mac et Windows L'arrivée de Chrome 6 sur le dev channel le laissait présager (lire ci-avant), Chrome 5 était en phase de finalisation. Ce n'est donc pas une surprise de voir arriver aujourd'hui la version officielle du navigateur de Google avec ses nombreuses améliorations : dont une « de 30 et 35 % aux be...

  Read the article

• Wrong resolution for TV connected via HDMI (32LG3000)

  - by timse201

  I have a LG Electronics 32LG3000 TV. I can't select the right resolution for my TV connected via HDMI. I can select 1360x768 but not 1366x768. The quality on my TV is very bad. HDMI1 connected 1360x768+1280+0 (normal left inverted right x axis y axis) 700mm x 390mm 1360x768 59.8*+ 1920x1080 60.0 1280x1024 60.0 1280x720 59.7 1024x768 75.1 70.1 60.0 832x624 74.6 800x600 75.0 60.3 640x480 75.0 60.0 59.9 720x400 70.1 I have a Intel 3000 graphic card and no settings menu like this there are no restricted drivers for my mac.

  Read the article

• Blacklist a single access point of a wireless network

  - by Zr40

  At my university, one of the wireless access points is failing. When something tries to associate to the network using that access point, it deassociates the client, claiming 802.1X authentication failure. Other access points do work normally using the same credentials. The issue has been reported, but after a month it still has still not been fixed. Now, I'm looking for a way to blacklist the access point's BSSID, so the OS prefers other access points on the same SSID. How can I blacklist specific BSSIDs in either Mac OS X Snow Leopard or Windows 7?

  Read the article

• Solaris 11 installed, no updates?

  - by Paul De Niro

  I was messing around with solaris and decided to give Solaris 11 a try so I downloaded it from the Oracle website. After installing the OS, I went into the package manager and did an update. It told me that there were to available updates! I find this hard to believe considering that it's running a vulnerable version of firefox and java, its own in-house software product! Many of the other software products that came with the default install are also out of date and vulnerable. Is this normal for an Oracle install, or did I do something wrong with the upgrade process? I typed "pkg update" at the prompt, and I noticed that it did call out to pkg.oracle.com looking for updates. I find it bizarre that there are no updates available for an OS that was released a couple months ago with vulnerable software...

  Read the article

• Compiz problems in Ubuntu 12.10

  - by Antonio Raffaele Iannaccone

  I have installed ubuntu 12.10 x64 on my notebook and I wanted to make a little customization in the UI, so i downloaded Compiz Settings Manager and opened it up. Once I opened it up, I found out that in the compiz are not all those settings and animations (that I could apply like on the photos, videos etc.) so I reinstalled it few times. Once I get bored with the reinstalling I checked one field in there and Ubuntu (OS) started to get "lagged" (Dash get hid, OS started to do not respond very well). So please, can anyone help me? How can I customize my ubuntu without get lagged and with all the animations that have to be available in the compiz? Thanks to all! thank you! It seems that it helped to fix the Dash-hide problem, but I still do not have all the animations and features that have to be in the Compiz (program). Can you help me with this too please? Thanks a lot!

  Read the article

• How to partition my hard drive, quicker?

  - by Sam

  When I install Windows 7 on my hard drive, it makes three partitions. One with the OS itself, one with bootmgr inside (that is 100 MiB), and one with the factory image (all the crapware from HP). My final goal is to have the OS on a partition of 100 GiB and keep the rest (900 GiB) for storage. I thought it would be easy using gparted, but it is taking so long. It will take hours. There must a way to partition the drive before installing Windows. Yeah, because what I think makes the shrinking/moving of the partitions take so long is because they are not empty (am I wrong?).

  Read the article

• Eclipse Juno Switch Editor in Order

  - by inspectorG4dget

  In case it matters: OS: Mac OS X Lion (10.7.4) Eclipse: Juno, Build id: 20120614-1722 I have several files open in my eclipse workspace as tabs. The default shortcuts for previous and next editors are ?F6 and ?shiftF6. I know how to change these shortcuts, that's not the issue. However, what I want to do, is switch between editors in the way in which they're ordered in the tab bar. Currently, the editors change in order of last used/viewed. So, if I had three files (A, B and C in order) open and I'm currently editing A and I edited B last, when I use the shortcut for "Previous Editor", it takes me to B instead of C (and vice versa). Is there any way for me to get this functionality out of eclipse (if so, how)? Thank you

  Read the article

• Is it OK to create all primary partitions.?

  - by james

  I have a 320GB hard disk. I only use either ubuntu or kubuntu (12.04 for now). I don't want to use windows or any other dual boot os. And i need only 3 partitions on my hard disk. One for the OS and remaining two for data storage. I don't want to create swap also. Now can i create all primary partitions on the hard disk. Are there any disadvantages in doing so. If all the partitions are primary i think i can easily resize partitions in future. On second thought i have the idea of using seperate partition for /home. Is it good practice . If i have to do this, i will create 4 partitions all primary. In any case i don't want to create more than 4 partitions . And i know the limit will be 4. So is it safe to create all 3 or 4 primary partitions. Pls suggest me, What are the good practices . (previously i used win-xp and win-7 on dual boot with 2 primary partitions and that bugged me somehow i don't remember. Since then i felt there should be only one primary partition in a hard disk.) EDIT 1 : Now i will use four partitions in the sequence - / , /home , /for-data , /swap . I have another question. Does a partition need continuous blocks on the disk. I mean if i want to resize partitions later, can i add space from sda3 to sda1. Is it possible and is it safe to do ?

  Read the article

• node.js server not running

  - by CMDadabo

  I am trying to learn node.js, but I'm having trouble getting the simple server to run on localhost:8888. Here is the code for server.js: var http = require("http"); http.createServer(function(request, response) { response.writeHead(200, {"Content-Type": "text/plain"}); response.write("Hello World"); response.end(); }).listen(8888); server.js runs without errors, and trying netstat -an | grep 8888 from terminal returns tcp4 0 0 *.8888 *.* LISTEN However, when I go to localhost:8888 in a browser, it says that it cannot be found. I've looked at all the related questions, and nothing has worked so far. I've tried different ports, etc. I know that my router blocks incoming traffic on port 8888, but shouldn't that not matter if I'm trying to access it locally? I've run tomcat servers on this port before, for example. Thanks so much for your help! node.js version: v0.6.15 OS: Mac OS 10.6.8

  Read the article

• Starting VM as an executable with as low overhead as possible

  - by Robert Koritnik

  Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

  Read the article

• Why am I getting [mount error(22): Invalid argument] while trying to mount SMB network drive?

  - by Steve_

  Disclaimer: I am very new to Linux :) Anyway, onward: I have a fresh instance of Ubuntu Server (12.04.1 LTS) running on my network and I want to mount a network drive to the server so I can access the contents. The network drive is a SAMBA compatible drive running Darwin OS. If I run the following command: smbclient -L //192.168.0.2 -U myuser It prompts me for the password and then displays output similar to: Domain=[SERVER01] OS=[Darwin] Server=[@(#)PROGRAM:smbd PROJECT:smbx-105.4.0] Sharename Type Comment --------- ---- ------- Comp Staff's Public Folder Disk CompRaid03 Disk Dropbox Disk Groups Disk IPC$ IPC Public Disk Users Disk compstaff Disk However, when I try and mount the CompRaid03 share, using this command: sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/myshare -o username=myuser I get the same password prompt, but after putting the correct password in, I received this error: mount error(22): Invalid argument dmesg | tail returns: [23576.037373] CIFS VFS: cifs_mount failed w/return code = -22 I don't understand what is wrong with this command. I've managed to mount a share on my current (Windows 8) machine using basically the same command but with a different IP address and share name (obviously). I've spent a good few hours trying to solve this and got no where. Any help or pointers would be greatly appreciated. Thanks Steve EDIT As suggested I've also trued using "user=" instead of "username=": sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/svnrepo -o user=myuser This results in the same "Invalid argument" error.

  Read the article

• virutalbox always get back the same ip

  - by user1012451

  I exported a virtual machine from my work station, and I am trying to renew the ip-address at home. I put one copy on my laptop and one copy on my PC. I've done this sudo rm /etc/udev/rules.d/70-persistent-net.rules and changed the MAC address, but they keep coming back as 192.168.1.165. I need them to be different because I need to run two of these exports at the same time, so I cannot afford to have the same IP. What can I do? Thanks.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Top causes of slow ssh logins

  - by Peter Lyons

  I'd love for one of you smart and helpful folks to post a list of common causes of delays during an ssh login. Specifically, there are 2 spots where I see a range from instantaneous to multi-second delays. Between issuing the ssh command and getting a login prompt and between entering the passphrase and having the shell load Now, specifically I'm looking at ssh details only here. Obviously network latency, speed of the hardware and OSes involved, complex login scripts, etc can cause delays. For context I ssh to a vast multitude of linux distributions and some Solaris hosts using mostly Ubuntu, CentOS, and MacOS X as my client systems. Almost all of the time, the ssh server configuration is unchanged from the OS's default settings. What ssh server configurations should I be interested in? Are there OS/kernel parameters that can be tuned? Login shell tricks? Etc?

  Read the article

• Multi-monitor resolution and position settings lost after reboot

  - by SoftDeveloper

  I've had two 1280x1024 monitors running for years on an nVidia 8800GT card with no problems. I've now replaced one monitor with a new 2560x1440 one. The card seems to support both fine, however every time I reboot the resolutions and monitor positions revert to the old settings. I've tried upgrading, downgrading, stripping out and reinstalling many versions of the nvidia drivers to no avail. Logging in as another user doesn't help - same problem. Booting into another another OS (Win7 64) works OK, so it is just this OS installation. During boot up everything looks fine (ie native 2450x1440 res) until the nVidia control panel or something is loaded which flips it back into the old mode. I have no old saved nvidia profiles. I can't find anything in the registry relating to these old settings. Its driving me crazy having to set resolutions and realign monitors on every reboot! Can anybody help?

  Read the article

• Google Chrome 5.0 en beta pour toutes les plateformes, géolocalisation, surf privé et à traduction a

  Mise à jour du 29/03/10 NB : Les commentaires sur cette mise à jour commencent ici dans le topic Google Chrome 5.0 en beta pour toutes les plateformes Mac et Linux accèdent aussi à la géolocalisation, au surf privé et à la traduction automatique Depuis Vendredi, Chrome, la navigateur de Google qui n'arrête pas de gagner des parts de marché, est disponible en beta pour sa version 5. Si celle-ci

  Read the article

• Installing drivers and getting -> Error Code 28

  - by Adrov

  I've recently upgraded mainboard, without reinstalling OS, so I guess that's the issue. I really don't want to install OS at this moment. Issue is I can't install USB drivers, if I right-click uninstall, just installs same driver, which isn't working ofc. and giving error code 28. I fixed such issue once long long time ago, with editing registry, but I really can't remember what and where I have to do, so if anyone know please let me know, I'm also open to all other solutions to this issue. http://i.stack.imgur.com/AuBtB.png

  Read the article

• Oracle Java Products Updates (2013/10/30)

  - by Hiro

  Oracle Java Products Media Pack ?????2013/10/30 ???????????????? Oracle JRE/JDK 7 Update 45 ???????????????????? ???????????????Apple Mac OS X (Intel) (64-bit), Linux x86, Linux x86-64, Microsoft Windows (32-bit), Microsoft Windows x64, Oracle Solaris on SPARC (32-bit), Oracle Solaris on SPARC (64-bit), Oracle Solaris on x86 (32-bit), Oracle Solaris on x86-64 (64-bit) ??? ?????

  Read the article

• Migrating users and IIS settings from a workgroup win2k3 machine to a new win2k8r2

  - by amber

  I am retiring my old Windows Server 2003 Standard 32bit machine to a new machine with Windows Server 2008 R2 Standard. The two sticking points are migrating user accounts (and there are a lot of them) and IIS settings/websites (again, there are a lot). The new machine has not been provisioned yet. I'm at that point where I'm about install the OS on it. The old machibe is configured with a mirrored set for its OS and data partitions. I have broken the mirror set, replicated all of the data to an external drive, and then rebuilt the mirror set. In short, I have an image of the old machine to play with while safely leaving it up and running. Thanks!

  Read the article

< Previous Page | 359 360 361 362 363 364 365 366 367 368 369 370  | Next Page >