Search Results

Search found 11536 results on 462 pages for 'whole foods market'.

Page 37/462 | < Previous Page | 33 34 35 36 37 38 39 40 41 42 43 44  | Next Page >

  • SecurityException: Permission Denial requires null

    - by Matroska
    Hi all, I would like to launch the market from a preference screen but when I try to do this I obain a java.lang.SecurityException: Permission Denial: starting Intent { cmp=com.action.test/.ui.activities.Test } from ProcessRecord{44db1300 3697:com.pippo.pluto/10067} (pid=3697, uid=10067) requires null. This is my code: startActivity(new Intent(Intent.ACTION_VIEW,Uri.parse("market://search?q=pname:com.action.test"))); what am I doing wrong? Thanks in advance Tobia

    Read the article

  • Android Respond To URL in Intent

    - by Isaac Waller
    I want my intent to be launched when the user goes to a certain url: for example, the android market does this with http://market.android.com/ urls. so does youtube. I want mine to do that too. If anybody could explain this, thank you very much. Isaac Waller

    Read the article

  • PHP mobile browser detection?

    - by TreyK
    I'm in need of a way to detect mobile browsers server-side. I'd like a way that requires me to do little to set up and little to maintain, yet still provide me with accurate detection of (at the VERY least) Android, Mobile Safari and Blackberry browsers, along with alternatives like Opera. I'd like to have at least the majority of the mobile market covered, and I'd really prefer virtually all of the market if it doesn't take much.

    Read the article

  • Android: I uploaded my first app! Keywords?...

    - by Allan
    I've just uploaded my first app on the market. It all went and looks well. I tried a few keywords to search for it, words that I also have in my description AND promo text, but some words don't find my app, some do. How does the keyword strategy work for an app on the market, I couldn't find no documentation on it.

    Read the article

  • Can you make a living as a system programmer?

    - by Helper Method
    Is there still a market for C system programmers? I love Java and some of the newer JVM languages but at the same time I really enjoy low-level system programming under Unix, using C and the GNU toolchain (it makes you feel elitist ;-)). Now I wonder a) is there still a market for C system programmers and b) how much do you earn compared to an app programmer c) is it that much fun in a large scale project?

    Read the article

  • A reliable, Australia-based ASP.NET Web Hosting

    - by Leonardo
    In the excellent Secret Geek’s Building a Micro-ISV series, Leon Bambrick admits that he prefers to host his sites in the US because of the prices and proximity to his target market. For Australian companies and start-ups, what’s the best ASP.NET web hosting in the country? Should a company consider hosting its website overseas even if the potential market is in here?

    Read the article

  • Implementing In App purchases in Android?

    - by hgpc
    It looks like Android won't natively support in-app purchases for a while, and when it does there might be a huge user base with devices that don't support them. What's the best way to implement iPhone-like (additional content or services) in-app purchases in Android using the Android Market if possible? The solution should consider in particular: For all kinds of in-app purchases: Android Market's 24-hour cancellation policy For consumables/non-consumables: storage of additional content (ie: use precious application memory to avoid piracy, or use SD card to avoid bloating application memory) Thanks!

    Read the article

  • which images load the android device at the time of installation?

    - by VSC
    I am placing 20 images in hdpi folder, 20 images in mdpi folder and 20 images in ldpi folder, all are same images but different resolutions . I am placing my app in android market. One user install my app in his normal android device through market, My question is total 60 images download the device or only 20 images(mdpi) download the device at the time of install the app.Thanks for reading my question.

    Read the article

  • Microsoft Declares the Future of ASP.NET is Web API

    - by sbwalker
    Sitting on a plane on my way home from Tech Ed 2012 in Orlando, I thought it would be a good time to jot down some key takeaways from this year’s conference. Some of these items I have known since the Microsoft MVP Summit which occurred in Redmond in late February ( but due to NDA restrictions I could not share them with the developer community at large ) and some of them are a result of insightful conversations with a wide variety of industry insiders and Microsoft employees at the conference. First, let’s travel back in time 4 years to the Microsoft MVP Summit in 2008. Microsoft was facing some heat from market newcomer Ruby on Rails and responded with a new web development framework of its own, ASP.NET MVC. At the Summit they estimated that MVC would only be applicable for ~10% of all new web development projects. Based on that prediction I questioned why they were investing such considerable resources for such a relative edge case, but my guess is that they felt it was an important edge case at the time as some of the more vocal .NET evangelists as well as some very high profile start-ups ( ie. Twitter ) had publicly announced their intent to use Rails. Microsoft made a lot of noise about MVC. In fact, they focused so much of their messaging and marketing hype around MVC that it appeared that WebForms was essentially dead. Yes, it may have been true that Microsoft continued to invest in WebForms, but from an outside perspective it really appeared that MVC was the only framework getting any real attention. As a result, MVC started to gain market share. An inside source at Microsoft told me that MVC usage has grown at a rate of about 5% per year and now sits at ~30%. Essentially by focusing so much marketing effort on MVC, Microsoft actually created a larger market demand for it.  This is because in the Microsoft ecosystem there is somewhat of a bandwagon mentality amongst developers. If Microsoft spends a lot of time talking about a specific technology, developers get the perception that it must be really important. So rather than choosing the right tool for the job, they often choose the tool with the most marketing hype and then try to sell it to the customer. In 2010, I blogged about the fact that MVC did not make any business sense for the DotNetNuke platform. This was because our ecosystem relied on third party extensions which were dependent on the WebForms model. If we migrated the core to MVC it would mean that all of the third party extensions would no longer be compatible, which would be an irresponsible business decision for us to make at the expense of our users and customers. However, this did not stop the debate from continuing to occur in our ecosystem. Clearly some developers had drunk Microsoft’s Kool-Aid about MVC and were of the mindset, to paraphrase an old Scottish saying, “If its not MVC, it’s crap”. Now, this is a rather ignorant position to take as most of the benefits of MVC can be achieved in WebForms with solid architecture and responsible coding practices. Clean separation of concerns, unit testing, and direct control over page output are all possible in the WebForms model – it just requires diligence and discipline. So over the past few years some horror stories have begun to bubble to the surface of software development projects focused on ground-up rewrites of web applications for the sole purpose of migrating from WebForms to MVC. These large scale rewrites were typically initiated by engineering teams with only a single argument driving the business decision, that Microsoft was promoting MVC as “the future”. These ill-fated rewrites offered no benefit to end users or customers and in fact resulted in a less stable, less scalable and more complicated systems – basically taking one step forward and two full steps back. A case in point is the announcement earlier this week that a popular open source .NET CMS provider has decided to pull the plug on their new MVC product which has been under active development for more than 18 months and revert back to WebForms. The availability of multiple server-side development models has deeply fragmented the Microsoft developer community. Some folks like to compare it to the age-old VB vs. C# language debate. However, the VB vs. C# language debate was ultimately more of a religious war because at least the two dominant programming languages were compatible with one another and could be used interchangeably. The issue with WebForms vs. MVC is much more challenging. This is because the messaging from Microsoft has positioned the two solutions as being incompatible with one another and as a result web developers feel like they are forced to choose one path or another. Yes, it is true that it has always been technically possible to use WebForms and MVC in the same project, but the tooling support has always made this feel “dirty”. The fragmentation has also made it difficult to attract newcomers as the perceived barrier to entry for learning ASP.NET has become higher. As a result many new software developers entering the market are gravitating to environments where the development model seems more simple and intuitive ( ie. PHP or Ruby ). At the same time that the Web Platform team was busy promoting ASP.NET MVC, the Microsoft Office team has been promoting Sharepoint as a platform for building internal enterprise web applications. Sharepoint has great penetration in the enterprise and over time has been enhanced with improved extensibility capabilities for software developers. But, like many other mature enterprise ASP.NET web applications, it is built on the WebForms development model. Similar to DotNetNuke, Sharepoint leverages a rich third party ecosystem for both generic web controls and more specialized WebParts – both of which rely on WebForms. So basically this resulted in a situation where the Web Platform group had headed off in one direction and the Office team had gone in another direction, and the end customer was stuck in the middle trying to figure out what to do with their existing investments in Microsoft technology. It really emphasized the perception that the left hand was not speaking to the right hand, as strategically speaking there did not seem to be any high level plan from Microsoft to ensure consistency and continuity across the different product lines. With the introduction of ASP.NET MVC, it also made some of the third party control vendors scratch their heads, and wonder what the heck Microsoft was thinking. The original value proposition of ASP.NET over Classic ASP was the ability for web developers to emulate the highly productive desktop development model by using abstract components for creating rich, interactive web interfaces. Web control vendors like Telerik, Infragistics, DevExpress, and ComponentArt had all built sizable businesses offering powerful user interface components to WebForms developers. And even after MVC was introduced these vendors continued to improve their products, offering greater productivity and a superior user experience via AJAX to what was possible in MVC. And since many developers were comfortable and satisfied with these third party solutions, the demand remained strong and the third party web control market continued to prosper despite the availability of MVC. While all of this was going on in the Microsoft ecosystem, there has also been a fundamental shift in the general software development industry. Driven by the explosion of Internet-enabled devices, the focus has now centered on service-oriented architecture (SOA). Service-oriented architecture is all about defining a public API for your product that any client can consume; whether it’s a native application running on a smart phone or tablet, a web browser taking advantage of HTML5 and Javascript, or a rich desktop application running on a PC. REST-based services which utilize the less verbose characteristics of JSON as a transport mechanism, have become the preferred approach over older, more bloated SOAP-based techniques. SOA also has the benefit of producing a cross-platform API, as every major technology stack is able to interact with standard REST-based web services. And for web applications, more and more developers are turning to robust Javascript libraries like JQuery and Knockout for browser-based client-side development techniques for calling web services and rendering content to end users. In fact, traditional server-side page rendering has largely fallen out of favor, resulting in decreased demand for server-side frameworks like Ruby on Rails, WebForms, and (gasp) MVC. In response to these new industry trends, Microsoft did what it always does – it immediately poured some resources into developing a solution which will ensure they remain relevant and competitive in the web space. This work culminated in a new framework which was branded as Web API. It is convention-based and designed to embrace native HTTP standards without copious layers of abstraction. This framework is designed to be the ultimate replacement for both the REST aspects of WCF and ASP.NET MVC Web Services. And since it was developed out of band with a dependency only on ASP.NET 4.0, it means that it can be used immediately in a variety of production scenarios. So at Tech Ed 2012 it was made abundantly clear in numerous sessions that Microsoft views Web API as the “Future of ASP.NET”. In fact, one Microsoft PM even went as far as to say that if we look 3-4 years into the future, that all ASP.NET web applications will be developed using the Web API approach. This is a fairly bold prediction and clearly telegraphs where Microsoft plans to allocate its resources going forward. Currently Web API is being delivered as part of the MVC4 package, but this is only temporary for the sake of convenience. It also sounds like there are still internal discussions going on in terms of how to brand the various aspects of ASP.NET going forward – perhaps the moniker of “ASP.NET Web Stack” coined a couple years ago by Scott Hanselman and utilized as part of the open source release of ASP.NET bits on Codeplex a few months back will eventually stick. Web API is being positioned as the unification of ASP.NET – the glue that is able to pull this fragmented mess back together again. The  “One ASP.NET” strategy will promote the use of all frameworks - WebForms, MVC, and Web API, even within the same web project. Basically the message is utilize the appropriate aspects of each framework to solve your business problems. Instead of navigating developers to a fork in the road, the plan is to educate them that “hybrid” applications are a great strategy for delivering solutions to customers. In addition, the service-oriented approach coupled with client-side development promoted by Web API can effectively be used in both WebForms and MVC applications. So this means it is also relevant to application platforms like DotNetNuke and Sharepoint, which means that it starts to create a unified development strategy across all ASP.NET product lines once again. And so what about MVC? There have actually been rumors floated that MVC has reached a stage of maturity where, similar to WebForms, it will be treated more as a maintenance product line going forward ( MVC4 may in fact be the last significant iteration of this framework ). This may sound alarming to some folks who have recently adopted MVC but it really shouldn’t, as both WebForms and MVC will continue to play a vital role in delivering solutions to customers. They will just not be the primary area where Microsoft is spending the majority of its R&D resources. That distinction will obviously go to Web API. And when the question comes up of why not enhance MVC to make it work with Web API, you must take a step back and look at this from the higher level to see that it really makes no sense. MVC is a server-side page compositing framework; whereas, Web API promotes client-side page compositing with a heavy focus on web services. In order to make MVC work well with Web API, would require a complete rewrite of MVC and at the end of the day, there would be no upgrade path for existing MVC applications. So it really does not make much business sense. So what does this have to do with DotNetNuke? Well, around 8-12 months ago we recognized the software industry trends towards web services and client-side development. We decided to utilize a “hybrid” model which would provide compatibility for existing modules while at the same time provide a bridge for developers who wanted to utilize more modern web techniques. Customers who like the productivity and familiarity of WebForms can continue to build custom modules using the traditional approach. However, in DotNetNuke 6.2 we also introduced a new Service Framework which is actually built on top of MVC2 ( we chose to leverage MVC because it had the most intuitive, light-weight REST implementation in the .NET stack ). The Services Framework allowed us to build some rich interactive features in DotNetNuke 6.2, including the Messaging and Notification Center and Activity Feed. But based on where we know Microsoft is heading, it makes sense for the next major version of DotNetNuke ( which is expected to be released in Q4 2012 ) to migrate from MVC2 to Web API. This will likely result in some breaking changes in the Services Framework but we feel it is the best approach for ensuring the platform remains highly modern and relevant. The fact that our development strategy is perfectly aligned with the “One ASP.NET” strategy from Microsoft means that our customers and developer community can be confident in their current and future investments in the DotNetNuke platform.

    Read the article

  • Which Single Source Publishing tools and strategies are available?

    - by Another Registered User
    I'm about to write a 1000-Pages Documentation about a huge programming framework. The goal is to bring this documentation online into an web platform, so that online users can search through it and read it online. At the same time, the text has to be made public in PDF format for download. And at the same time, the whole thing needs to go into a printed book as well (print on demand, they want a giant PDF file with the whole book). The PDF files: The whole content is divided into several chapters. Every chapter will be available as a standalone PDF eBook. And finally, all chapters will be available in one huge printed book. Is LaTeX capable for something like that? Can it be used for Single Source Publishing? Or would I have to take a look at other technologies like DocBook, etc.?

    Read the article

  • forced reformat without login / and bootcamp

    - by debug
    ok.. im pretty good with stuff like this, but I have a question. I have mac mini with 10.5.(x) on one partition, and bootcamp (windows) on the other. My boss wants me to reformat the whole mac (10.6 (x)), which is usually easy. He does not remember his password to login, which means I cannot log in and allocate the bootcamp back to one partition using Disk Utility, then reformat the whole drive. When I insert the Snow leopard CD, I can only wipe out one partition, my question is: Is there a way to force a wipe out of both drives in the boot sequence? Any help to wipe out this whole drive and do a clean install would be helpful.. Thanks superusers!

    Read the article

  • How does MySQL 5.5 and InnoDB on Linux use RAM?

    - by Loren
    Does MySQL 5.5 InnoDB keep indexes in memory and tables on disk? Does it ever do it's own in-memory caching of part or whole tables? Or does it completely rely on the OS page cache (I'm guessing that it does since Facebook's SSD cache that was built for MySQL was done at the OS-level: https://github.com/facebook/flashcache/)? Does Linux by default use all of the available RAM for the page cache? So if RAM size exceeds table size + memory used by processes, then when MySQL server starts and reads the whole table for the first time it will be from disk, and from that point on the whole table is in RAM? So using Alchemy Database (SQL on top of Redis, everything always in RAM: http://code.google.com/p/alchemydatabase/) shouldn't be much faster than MySQL, given the same size RAM and database?

    Read the article

  • Command to see all Windows commands

    - by open_sourse
    When I type help in windows command line, it lists a whole bunch of commands. However I find that there is a whole set of commands that do not appear in this list, for e.g. many networking commands such as ping, tracert, arp, netstat, net etc. I am sure that there is also a whole bunch of non-networking command which is also not listed. So my question is this. Why are these additional commands not shown in help? Is there a subset/group of commands only that help shows? Is there any command/method to list all the commands that can be executed in windows? (I am not talking about additional .exes that get added to path when some new software is installed..)

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How do I restore a backup of my keyring (containing ssh key passprases, nautilus remote filesystem passwords and wifi passwords)?

    - by con-f-use
    I changed the disk on my laptop and installed Ubuntu on the new disk. Old disk had 12.04 upgraded to 12.10 on it. Now I want to copy my old keyring with WiFi passwords, ftp passwords for nautilus and ssh key passphrases. I have the whole data from the old disk available (is now a USB disk and I did not delete the old data yet or do anything with it - I could still put it in the laptop and boot from it like nothing happend). The old methods of just copying ~/.gconf/... and ~/.gnome2/keyrings won't work. Did I miss something? 1. Edit: I figure one needs to copy files not located in the users home directory as well. I copied the whole old /home/confus (which is my home directory) to the fresh install to no effect. That whole copy is now reverted to the fresh install's home directory, so my /home/confus is as it was the after fresh install. 2. Edit: The folder /etc/NetworkManager/system-connections seems to be the place for WiFi passwords. Could be that /usr/share/keyrings is important as well for ssh keys - that's the only sensible thing that a search came up with: find /usr/ -name "*keyring* 3. Edit: Still no ssh and ftp passwords from the keyring. What I did: Convert old hard drive to usb drive Put new drive in the laptop and installed fresh version of 12.10 there Booted from old hdd via USB and copied its /etc/NetwrokManager/system-connections, ~/.gconf/ and ~/.gnome2/keyrings, ~/.ssh over to the new disk. Confirmed that all keys on the old install work Booted from new disk Result: No passphrase for ssh keys, no ftp passwords in keyring. At least the WiFi passwords are migrated.

    Read the article

  • BizTalk: History of one project architecture

    - by Leonid Ganeline
    "In the beginning God made heaven and earth. Then he started to integrate." At the very start was the requirement: integrate two working systems. Small digging up: It was one system. It was good but IT guys want to change it to the new one, much better, chipper, more flexible, and more progressive in technologies, more suitable for the future, for the faster world and hungry competitors. One thing. One small, little thing. We cannot turn off the old system (call it A, because it was the first), turn on the new one (call it B, because it is second but not the last one). The A has a hundreds users all across a country, they must study B. A still has a lot nice custom features, home-made features that cannot disappear. These features have to be moved to the B and it is a long process, months and months of redevelopment. So, the decision was simple. Let’s move not jump, let’s both systems working side-by-side several months. In this time we could teach the users and move all custom A’s special functionality to B. That automatically means both systems should work side-by-side all these months and use the same data. Data in A and B must be in sync. That’s how the integration projects get birth. Moreover, the specific of the user tasks requires the both systems must be in sync in real-time. Nightly synchronization is not working, absolutely.   First draft The first draft seems simple. Both systems keep data in SQL databases. When data changes, the Create, Update, Delete operations performed on the data, and the sync process could be started. The obvious decision is to use triggers on tables. When we are talking about data, we are talking about several entities. For example, Orders and Items [in Orders]. We decided to use the BizTalk Server to synchronize systems. Why it was chosen is another story. Second draft   Let’s take an example how it works in more details. 1.       User creates a new entity in the A system. This fires an insert trigger on the entity table. Trigger has to pass the message “Entity created”. This message includes all attributes of the new entity, but I focused on the Id of this entity in the A system. Notation for this message is id.A. System A sends id.A to the BizTalk Server. 2.       BizTalk transforms id.A to the format of the system B. This is easiest part and I will not focus on this kind of transformations in the following text. The message on the picture is still id.A but it is in slightly different format, that’s why it is changing in color. BizTalk sends id.A to the system B. 3.       The system B creates the entity on its side. But it uses different id-s for entities, these id-s are id.B. System B saves id.A+id.B. System B sends the message id.A+id.B back to the BizTalk. 4.       BizTalk sends the message id.A+id.B to the system A. 5.       System A saves id.A+id.B. Why both id-s should be saved on both systems? It was one of the next requirements. Users of both systems have to know the systems are in sync or not in sync. Users working with the entity on the system A can see the id.B and use it to switch to the system B and work there with the copy of the same entity. The decision was to store the pairs of entity id-s on both sides. If there is only one id, the entities are not in sync yet (for the Create operation). Third draft Next problem was the reliability of the synchronization. The synchronizing process can be interrupted on each step, when message goes through the wires. It can be communication problem, timeout, temporary shutdown one of the systems, the second system cannot be synchronized by some internal reason. There were several potential problems that prevented from enclosing the whole synchronization process in one transaction. Decision was to restart the whole sync process if it was not finished (in case of the error). For this purpose was created an additional service. Let’s call it the Resync service. We still keep the id pairs in both systems, but only for the fast access not for the synchronization process. For the synchronizing these id-s now are kept in one main place, in the Resync service database. The Resync service keeps record as: ·       Id.A ·       Id.B ·       Entity.Type ·       Operation (Create, Update, Delete) ·       IsSyncStarted (true/false) ·       IsSyncFinished (true/false0 The example now looks like: 1.       System A creates id.A. id.A is saved on the A. Id.A is sent to the BizTalk. 2.       BizTalk sends id.A to the Resync and to the B. id.A is saved on the Resync. 3.       System B creates id.B. id.A+id.B are saved on the B. id.A+id.B are sent to the BizTalk. 4.       BizTalk sends id.A+id.B to the Resync and to the A. id.A+id.B are saved on the Resync. 5.       id.A+id.B are saved on the B. Resync changes the IsSyncStarted and IsSyncFinished flags accordingly. The Resync service implements three main methods: ·       Save (id.A, Entity.Type, Operation) ·       Save (id.A, id.B, Entity.Type, Operation) ·       Resync () Two Save() are used to save id-s to the service storage. See in the above example, in 2 and 4 steps. What about the Resync()? It is the method that finishes the interrupted synchronization processes. If Save() is started by the trigger event, the Resync() is working as an independent process. It periodically scans the Resync storage to find out “unfinished” records. Then it restarts the synchronization processes. It tries to synchronize them several times then gives up.     One more thing, both systems A and B must tolerate duplicates of one synchronizing process. Say on the step 3 the system B was not able to send id.A+id.B back. The Resync service must restart the synchronization process that will send the id.A to B second time. In this case system B must just send back again also created id.A+id.B pair without errors. That means “tolerate duplicates”. Fourth draft Next draft was created only because of the aesthetics. As it always happens, aesthetics gave significant performance gain to the whole system. First was the stupid question. Why do we need this additional service with special database? Can we just master the BizTalk to do something like this Resync() does? So the Resync orchestration is doing the same thing as the Resync service. It is started by the Id.A and finished by the id.A+id.B message. The first works as a Start message, the second works as a Finish message.     Here is a diagram the whole process without errors. It is pretty straightforward. The Resync orchestration is waiting for the Finish message specific period of time then resubmits the Id.A message. It resubmits the Id.A message specific number of times then gives up and gets suspended. It can be resubmitted then it starts the whole process again: waiting [, resubmitting [, get suspended]], finishing. Tuning up The Resync orchestration resubmits the id.A message with special “Resubmitted” flag. The subscription filter on the Resync orchestration includes predicate as (Resubmit_Flag != “Resubmitted”). That means only the first Sync orchestration starts the Resync orchestration. Other Sync orchestration instantiated by the resubmitting can finish this Resync orchestration but cannot start another instance of the Resync   Here is a diagram where system B was inaccessible for some period of time. The Resync orchestration resubmitted the id.A two times. Then system B got the response the id.A+id.B and this finished the Resync service execution. What is interesting about this, there were submitted several identical id.A messages and only one id.A+id.B message. Because of this, the system B and the Resync must tolerate the duplicate messages. We also told about this requirement for the system B. Now the same requirement is for the Resunc. Let’s assume the system B was very slow in the first response and the Resync service had time to resubmit two id.A messages. System B responded not, as it was in previous case, with one id.A+id.B but with two id.A+id.B messages. First of them finished the Resync execution for the id.A. What about the second id.A+id.B? Where it goes? So, we have to add one more internal requirement. The whole solution must tolerate many identical id.A+id.B messages. It is easy task with the BizTalk. I added the “SinkExtraMessages” subscriber (orchestration with one receive shape), that just get these messages and do nothing. Real design Real architecture is much more complex and interesting. In reality each system can submit several id.A almost simultaneously and completely unordered. There are not only the “Create entity” operation but the Update and Delete operations. And these operations relate each other. Say the Update operation after Delete means not the same as Update after Create. In reality there are entities related each other. Say the Order and Order Items. Change on one of it could start the series of the operations on another. Moreover, the system internals are the “black boxes” and we cannot predict the exact content and order of the operation series. It worth to say, I had to spend a time to manage the zombie message problems. The zombies are still here, but this is not a problem now. And this is another story. What is interesting in the last design? One orchestration works to help another to be more reliable. Why two orchestration design is more reliable, isn’t it something strange? The Synch orchestration takes all the message exchange between systems, here is the area where most of the errors could happen. The Resync orchestration sends and receives messages only within the BizTalk server. Is there another design? Sure. All Resync functionality could be implemented inside the Sync orchestration. Hey guys, some other ideas?

    Read the article

  • Dualboot harddisk encryption

    - by amfcosta
    I have a system with both Ubuntu 11.10 and Windows 7 and I want to encrypt the whole harddisk or at least some of my partitions. My partition table is something like this (the ones marked with * are the ones that need to be encrypted): Windows boot reserved partition *Windows system partition (ntfs) *Windows data partition (ntfs) Ubuntu root partition (ext4) *Ubuntu home partition (ext4) Ubuntu swap As I said I don't need to encrypt the whole disk. What is the best way to accomplish this? Maybe something (TrueCrypt?) where I enter the password before the system boots so that it decrypts the whole hdd? Or maybe individual encryption using Windows-only encryption (for Windows partitions) and Ubuntu home encryption (well, for Ubuntu home partition)? By the way, I almost always use Ubuntu, so it would be nice if I could continue to boot Ubuntu by default but have an option to boot Windows too (like in grub). EDIT: I was thinking of doing this: encrypting ubuntu home with eCryptfs (I think this is used to encrypt home when selected during installation). Encrypting Windows partitions with TrueCrypt. Still having Grub as a bootloader, when I choose ubuntu everything goes as normal (home is decrypted when login in). When I choose windows the TrueCrypt password prompt shows and windows boots.

    Read the article

  • Page Spamming via locations

    - by codemonkey
    Hi guys I am new here so please be gentle :) I have created a web page for a small mail order business. The page asks the reader if they are in need of a supplier for products in their "area" and if they have ever been let down by a supplier in that "area" etc. It also lists all the local villages and hamlets around the [area] where they can also supply too. This page is dynamically created and the [area] changes and so do the small towns that are local to the town. The page also contains information on the products so the word count vs town names is not stupid. An example of one of the URL would be www.website.com/1014/Halesowen/ It basically covers the whole of the UK so around 800 main towns with 28,000 local villages. The URL changes, so does the title and h1 tags, also each page is Geo coded for that town. My question really is this a good or bad idea? Is it a black hat technique ? I have been told if I have to ask the question then it probably is but the site does supply to all these areas just as any mail order company does and would like to get listed higher in each town for the products. I have seen this done on a few sites but only with a few targeted towns and not the whole of the UK so I would be really interested in your guys thoughts on this. I would post the URL to the site but as I am new here I am a bit unsure of the rules regarding posting links. The whole site needs a lot of other onsite SEO work doing and I will be doing that over the next few weeks. I look forward to your views on this. p.s. If I am allowed to post the URL without getting into trouble so you can see it someone let me know? Thanks in advance

    Read the article

  • Pasting from vim in terminal to Google Docs (Firefox + Vimperator) - need to understand

    - by LIttle Ancient Forest Kami
    I had some trouble with copy-pasting text from vim in terminal to Google Docs (aka Drive) document (hereafter GDd) in FF browser (with Vimperator). Note: I have a file opened in Vim 7.2 in terminal :version displays both +clipboard and +xterm-clipboard I'm on Ubuntu 10.04 LTS, so I don't think that's Unity-related I want to use Vim, not GVim, nor gedit... I'm avid fan of mouseless navigation, so solution with mouse was not what I wanted. I have the solution, but I need understanding. What I tried and where it gets me: Yanking whole file text via: ggvGy allows me to: paste it via mouse middle button, NOT with Ctrl+v or Shift+Insert here, in text area for entering question text in gedit but NOT in GDd where I want it pasted, even if I switch Vimperator to pass-through mode with Insert does NOT show in XClip after xclip -o From gedit, I can copy-paste the text into GDd (Vimperator's pass-through mode not required). :%! !xclip -i (or :first, last) reports whole file (all lines, to be precise) as filtered, though shell returns 1 `xclip -o' returns nothing (is empty) or returns previously copied value with 2. no surprise, but I can't paste at all not only to GDd but also to gedit or here setting clipboard (:set clipboard=unnamed) to unnamed doesn't help using "+y or "*y on whole file text actually does the trick So, the question (it's actually three, say "split" and I will): why middle mouse button pastes different things than Ctrl+v and how to know what will be pasted with each? why just yanking (without registers) works with mouse but not with keyboard / XClip? why didn't unnamed register help? After setting, it should make unnamed and * registers same?

    Read the article

  • SQLAuthority News – Pluralsight Course Review – Practices for Software Startups – Part 1 of 2

    - by pinaldave
    This is first part of the two part series of Practices for Software Startup Pluralsight Course. The course is written by Stephen Forte (Blog | Twitter). Stephen Forte is the Chief Strategy Officer of the venture backed company, Telerik, a leading vendor of developer and team productivity tools. Stephen is also a Certified Scrum Master, Certified Scrum Professional, PMP, and also speaks regularly at industry conferences around the world. He has written several books on application and database development.  Stephen is also a board member of the Scrum Alliance. Startups – Everybodies Dream Start-up companies are an important topic right now – everyone wants to start their own business.  It is also important to remember that all companies were a start up at one point – from your corner store to the giants like Microsoft and Apple.  Research proves that not every start-up succeeds, in fact, most will fail before their first year.  There are many reasons for this, and this could be due to the fact that there are many stages to a start-up company, and stumbling at any of these stages can lead to failure.  It is important to understand what makes a start-up company succeed at all its hurdles to become successful.  It is even important to define success.  For most start-ups this would mean becoming their own independently functioning company or to be bought out for a hefty profit by a larger company.  The idea of making a hefty profit by living your dream is extremely important, and you can even think of start-ups as the new craze.  That’s why studying them is so important – they are very popular, but things have changed a lot since their inception. Starting the Startups Beginning a start-up company used to be difficult, but now facilities and information is widely available, and it is much easier.  But that means it is much easier to fail, also.  Previously to start your own company, everything was planned and organized, resources were ensured and backed up before beginning; even the idea of starting your own business was a big thing.  Now anybody can do it, and the steps are simple and outlines everywhere – you can get online software and easily outsource , cloud source, or crowdsource a lot of your material.  But without the type of planning previously required, things can often go badly. New Products – New Ideas – New World There are so many fantastic new products, but they don’t reach success all the time.  I find start-up companies very interesting, and whenever I meet someone who is interested in the subject or already starting their own company, I always ask what they are doing, their plans, goals, market, etc.  I am sorry to say that in most cases, they cannot answer my questions.  It is true that many fantastic ideas fail because of bad decisions.  These bad decisions were not made intentionally, but people were simply unaware of what they should be doing.  This will always lead to failure.  But I am happy to say that all these issues can be gone because Pluralsight is now offering a course all about start-ups by Stephen Forte.  Stephen is a start up leader.  He has successfully started many companies and most are still going strong, or have gone on to even bigger and better things. Beginning Course on Startup I have always thought start-ups are a fascinating subject, and decided to take his course, but it is three hours long.  This would be hard to fit into my busy work day all at once, so I decided to do half of his course before my daughter wakes up, and the other half after she goes to sleep.  The course is divided into six modules, so this would be easy to do.  I began the first chapter early in the morning, at 5 am.  Stephen jumped right into the middle of the subject in the very first module – designing your business plan.  The first question you will have to answer to yourself, to others, and to investors is: What is your product and when will we be able to see it?  So a very important concept is a “minimal viable product.”  This means setting goals for yourself and your product.  We all have large dreams, but your minimal viable product doesn’t have to be your final vision at the very first.  For example: Apple is a giant company, but it is still evolving.  Steve Jobs didn’t envision the iPhone 6 at the very beginning.  He had to start at the first iPhone and do his market research, and the idea evolved into the technology you see now.  So for yourself, you should decide a beginning and stop point.  Do your market research.  Determine who you want to reach, what audience you want for your product.  You can have a great idea that simply will not work in the market, do need, bottlenecks, lack of resources, or competition.  There is a lot of research that needs to be done before you even write a business plan, and Stephen covers it in the very first chapter. The Team – Unique Key to Success After jumping right into the subject in the very first module, I wondered what Stephen could have in store for me for the rest of the course.  Chapter number two is building a team.  Having a team is important regardless of what your startup is.  You can be a true visionary with endless ideas and energy, but one person can still not do everything.  It is important to decide from the very beginning if you will have cofounders, team leaders, and how many employees you’ll need.  Even more important, you’ll need to decide what kind of team you want – what personalities, skills, and type of energy you want each of your employees to bring.  Do you want to have an A+ team with a B- idea, or do you have a B- idea that needs an A+ team to sell it?  Stephen asks all the hard questions!  I was especially impressed by his insight on developing.  You have to decide if you need developers, how many, and what their skills should be. I found this insight extremely useful for everyday usage, not just for start-up companies.  I would apply this kind of information in management at any position.  An amazing team will build an amazing product – and that doesn’t matter if you’re a start-up company or a small team working for a much larger business. Customer Development – The Ultimate Obective Chapter three was about customer development. According to Stephen, there are four different steps to develop a customer base.  The first question to ask yourself is if you are envisioning a large customer base buying a few products each, or a small, dedicated base that buys a lot of your product – quantity vs. Quality.  He also discusses how to earn, retain, and get more customers.  He also says that each customer should be placed in a different role – some will be like investors, who regularly spend with you and invest their money in your business.  It is then your job to take that investment and turn it into a better product in the future.  You need to deal with their money properly – think of it is as theirs as investors, not yours as profit.  At the end of this module I felt that only Stephen could provide this kind of insight, and then he listed all the resources he took his information from.  I have never seen a group of people so passionate about their customers. It was indeed a long day for me. In tomorrow’s part 2 we will discuss rest of the three module and also will see a quick video of the Practices for Software Startup Pluralsight Course. Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Best Practices, PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • Is Berkeley DB a NoSQL solution?

    - by Gregory Burd
    Berkeley DB is a library. To use it to store data you must link the library into your application. You can use most programming languages to access the API, the calls across these APIs generally mimic the Berkeley DB C-API which makes perfect sense because Berkeley DB is written in C. The inspiration for Berkeley DB was the DBM library, a part of the earliest versions of UNIX written by AT&T's Ken Thompson in 1979. DBM was a simple key/value hashtable-based storage library. In the early 1990s as BSD UNIX was transitioning from version 4.3 to 4.4 and retrofitting commercial code owned by AT&T with unencumbered code, it was the future founders of Sleepycat Software who wrote libdb (aka Berkeley DB) as the replacement for DBM. The problem it addressed was fast, reliable local key/value storage. At that time databases almost always lived on a single node, even the most sophisticated databases only had simple fail-over two node solutions. If you had a lot of data to store you would choose between the few commercial RDBMS solutions or to write your own custom solution. Berkeley DB took the headache out of the custom approach. These basic market forces inspired other DBM implementations. There was the "New DBM" (ndbm) and the "GNU DBM" (GDBM) and a few others, but the theme was the same. Even today TokyoCabinet calls itself "a modern implementation of DBM" mimicking, and improving on, something first created over thirty years ago. In the mid-1990s, DBM was the name for what you needed if you were looking for fast, reliable local storage. Fast forward to today. What's changed? Systems are connected over fast, very reliable networks. Disks are cheep, fast, and capable of storing huge amounts of data. CPUs continued to follow Moore's Law, processing power that filled a room in 1990 now fits in your pocket. PCs, servers, and other computers proliferated both in business and the personal markets. In addition to the new hardware entire markets, social systems, and new modes of interpersonal communication moved onto the web and started evolving rapidly. These changes cause a massive explosion of data and a need to analyze and understand that data. Taken together this resulted in an entirely different landscape for database storage, new solutions were needed. A number of novel solutions stepped up and eventually a category called NoSQL emerged. The new market forces inspired the CAP theorem and the heated debate of BASE vs. ACID. But in essence this was simply the market looking at what to trade off to meet these new demands. These new database systems shared many qualities in common. There were designed to address massive amounts of data, millions of requests per second, and scale out across multiple systems. The first large-scale and successful solution was Dynamo, Amazon's distributed key/value database. Dynamo essentially took the next logical step and added a twist. Dynamo was to be the database of record, it would be distributed, data would be partitioned across many nodes, and it would tolerate failure by avoiding single points of failure. Amazon did this because they recognized that the majority of the dynamic content they provided to customers visiting their web store front didn't require the services of an RDBMS. The queries were simple, key/value look-ups or simple range queries with only a few queries that required more complex joins. They set about to use relational technology only in places where it was the best solution for the task, places like accounting and order fulfillment, but not in the myriad of other situations. The success of Dynamo, and it's design, inspired the next generation of Non-SQL, distributed database solutions including Cassandra, Riak and Voldemort. The problem their designers set out to solve was, "reliability at massive scale" so the first focal point was distributed database algorithms. Underneath Dynamo there is a local transactional database; either Berkeley DB, Berkeley DB Java Edition, MySQL or an in-memory key/value data structure. Dynamo was an evolution of local key/value storage onto networks. Cassandra, Riak, and Voldemort all faced similar design decisions and one, Voldemort, choose Berkeley DB Java Edition for it's node-local storage. Riak at first was entirely in-memory, but has recently added write-once, append-only log-based on-disk storage similar type of storage as Berkeley DB except that it is based on a hash table which must reside entirely in-memory rather than a btree which can live in-memory or on disk. Berkeley DB evolved too, we added high availability (HA) and a replication manager that makes it easy to setup replica groups. Berkeley DB's replication doesn't partitioned the data, every node keeps an entire copy of the database. For consistency, there is a single node where writes are committed first - a master - then those changes are delivered to the replica nodes as log records. Applications can choose to wait until all nodes are consistent, or fire and forget allowing Berkeley DB to eventually become consistent. Berkeley DB's HA scales-out quite well for read-intensive applications and also effectively eliminates the central point of failure by allowing replica nodes to be elected (using a PAXOS algorithm) to mastership if the master should fail. This implementation covers a wide variety of use cases. MemcacheDB is a server that implements the Memcache network protocol but uses Berkeley DB for storage and HA to replicate the cache state across all the nodes in the cache group. Google Accounts, the user authentication layer for all Google properties, was until recently running Berkeley DB HA. That scaled to a globally distributed system. That said, most NoSQL solutions try to partition (shard) data across nodes in the replication group and some allow writes as well as reads at any node, Berkeley DB HA does not. So, is Berkeley DB a "NoSQL" solution? Not really, but it certainly is a component of many of the existing NoSQL solutions out there. Forgetting all the noise about how NoSQL solutions are complex distributed databases when you boil them down to a single node you still have to store the data to some form of stable local storage. DBMs solved that problem a long time ago. NoSQL has more to do with the layers on top of the DBM; the distributed, sometimes-consistent, partitioned, scale-out storage that manage key/value or document sets and generally have some form of simple HTTP/REST-style network API. Does Berkeley DB do that? Not really. Is Berkeley DB a "NoSQL" solution today? Nope, but it's the most robust solution on which to build such a system. Re-inventing the node-local data storage isn't easy. A lot of people are starting to come to appreciate the sophisticated features found in Berkeley DB, even mimic them in some cases. Could Berkeley DB grow into a NoSQL solution? Absolutely. Our key/value API could be extended over the net using any of a number of existing network protocols such as memcache or HTTP/REST. We could adapt our node-local data partitioning out over replicated nodes. We even have a nice query language and cost-based query optimizer in our BDB XML product that we could reuse were we to build out a document-based NoSQL-style product. XML and JSON are not so different that we couldn't adapt one to work with the other interchangeably. Without too much effort we could add what's missing, we could jump into this No SQL market withing a single product development cycle. Why isn't Berkeley DB already a NoSQL solution? Why aren't we working on it? Why indeed...

    Read the article

  • People, Process & Engagement: WebCenter Partner Keste

    - by Michael Snow
    v\:* {behavior:url(#default#VML);} o\:* {behavior:url(#default#VML);} w\:* {behavior:url(#default#VML);} .shape {behavior:url(#default#VML);} Within the WebCenter group here at Oracle, discussions about people, process and engagement cross over many vertical industries and products. Amidst our growing partner ecosystem, the community provides us insight into great customer use cases every day. Such is the case with our partner, Keste, who provides us a guest post on our blog today with an overview of their innovative solution for a customer in the transportation industry. Keste is an Oracle software solutions and development company headquartered in Dallas, Texas. As a Platinum member of the Oracle® PartnerNetwork, Keste designs, develops and deploys custom solutions that automate complex business processes. Seamless Customer Self-Service Experience in the Trucking Industry with Oracle WebCenter Portal  Keste, Oracle Platinum Partner Customer Overview Omnitracs, Inc., a Qualcomm company provides mobility solutions for trucking fleets to companies in the transportation industry. Omnitracs’ mobility services include basic communications such as text as well as advanced monitoring services such as GPS tracking, temperature tracking of perishable goods, load tracking and weighting distribution, and many others. Customer Business Needs Already the leading provider of mobility solutions for large trucking fleets, they chose to target smaller trucking fleets as new customers. However their existing high-touch customer support method would not be a cost effective or scalable method to manage and service these smaller customers. Omnitracs needed to provide several self-service features to make customer support more scalable while keeping customer satisfaction levels high and the costs manageable. The solution also had to be very intuitive and easy to use. The systems that Omnitracs sells to these trucking customers require professional installation and smaller customers need to track and schedule the installation. Information captured in Oracle eBusiness Suite needed to be readily available for new customers to track these purchases and delivery details. Omnitracs wanted a high impact User Interface to significantly improve customer experience with the ability to integrate with EBS, provisioning systems as well as CRM systems that were already implemented. Omnitracs also wanted to build an architecture platform that could potentially be extended to other Portals. Omnitracs’ stated goal was to deliver an “eBay-like” or “Amazon-like” experience for all of their customers so that they could reach a much broader market beyond their large company customer base. Solution Overview In order to manage the increased complexity, the growing support needs of global customers and improve overall product time-to-market in a cost-effective manner, IT began to deliver a self-service model. This self service model not only transformed numerous business processes but is also allowing the business to keep up with the growing demands of the (internal and external) customers. This solution was a customer service Portal that provided self service capabilities for large and small customers alike for Activation of mobility products, managing add-on applications for the devices (much like the Apple App Store), transferring services when trucks are sold to other companies as well as deactivation all without the involvement of a call service agent or sending multiple emails to different Omnitracs contacts. This is a conceptual view of the Customer Portal showing the details of the components that make up the solution. 12.00 The portal application for transactions was entirely built using ADF 11g R2. Omnitracs’ business had a pressing requirement to have a portal available 24/7 for its customers. Since there were interactions with EBS in the back-end, the downtimes on the EBS would negate this availability. Omnitracs devised a decoupling strategy at the database side for the EBS data. The decoupling of the database was done using Oracle Data Guard and completely insulated the solution from any eBusiness Suite down time. The customer has no knowledge whether eBS is running or not. Here are two sample screenshots of the portal application built in Oracle ADF. Customer Benefits The Customer Portal not only provided the scalability to grow the business but also provided the seamless integration with other disparate applications. Some of the key benefits are: Improved Customer Experience: With a modern look and feel and a Portal that has the aspects of an App Store, the customer experience was significantly improved. Page response times went from several seconds to sub-second for all of the pages. Enabled new product launches: After successfully dominating the large fleet market, Omnitracs now has a scalable solution to sell and manage smaller fleet customers giving them a huge advantage over their nearest competitors. Dozens of new customers have been acquired via this portal through an onboarding process that now takes minutes Seamless Integrations Improves Customer Support: ADF 11gR2 allowed Omnitracs to bring a diverse list of applications into one integrated solution. This provided a seamless experience for customers to route them from Marketing focused application to a customer-oriented portal. Internally, it also allowed Sales Representatives to have an integrated flow for taking a prospect through the various steps to onboard them as a customer. Key integrations included: Unity Core Salesforce.com Merchant e-Solution for credit card Custom Omnitracs Applications like CUPS and AUTO Security utilizing OID and OVD Back end integration with EBS (Data Guard) and iQ Database Business Impact Significant business impacts were realized through the launch of customer portal. It not only allows the business to push through in underserved segments, but also reduces the time it needs to spend on customer support—allowing the business to focus more on sales and identifying the market for new products. Some of the Immediate Benefits are The entire onboarding process is now completely automated and now completes in minutes. This represents an 85% productivity improvement over their previous processes. And it was 160 times faster! With the success of this self-service solution, the business is now targeting about 3X customer growth in the next five years. This represents a tripling of their overall customer base and significant downstream revenue for the ongoing services. 90%+ improvement of customer onboarding and management process by utilizing, single sign on integration using OID/OAM solution, performance improvements and new self-service functionality Unified login for all Customers, Partners and Internal Users enables login to a common portal and seamless access to all other integrated applications targeted at the respective audience Significantly improved customer experience with a better look and feel with a more user experience focused Portal screens. Helped sales of the new product by having an easy way of ordering and activating the product. Data Guard helped increase availability of the Portal to 99%+ and make it independent of EBS downtime. This gave customers the feel of high availability of the portal application. Some of the anticipated longer term Benefits are: Platform that can be leveraged to launch any new product introduction and enable all product teams to reach new customers and new markets Easy integration with content management to allow business owners more control of the product catalog Overall reduced TCO with standardization of the Oracle platform Managed IT support cost savings through optimization of technology skills needed to support and modify this solution ------------------------------------------------------------ 12.00 Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 -"/ /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-family:"Times New Roman","serif";}

    Read the article

  • OOW2012 Session: Identity Management and the Cloud

    - by Darin Pendergraft
    Cloud architecture and the agility and cost savings it provides are compelling reasons for companies to consider this alternative deployment option.  However, concerns about security keep customers from making the investment. If you are at Oracle Openworld 2012, please join us for a discussion about IDM and the Cloud - Wednesday,  October 3 @ 1:15 pm - 2:15 pm in Moscone West 3008. Mike Neuenschwander and Melody Liu from Oracle will host special guests John Houston from UPMC, Tim Patterson from CONAGRA Foods Inc., and John Hill from SaskTel as they discuss how customers are addressing security and identity issues in the cloud. Click the link for a full session description: session description

    Read the article

  • Blogging locally and globally–my experience

    - by DigiMortal
    In Baltic MVP Summit 2011 there was discussion about having two blogs - one for local and another for global audience – and how to publish once written information in these blogs. There are many ways how to optimize your blogging activities if you have more than one audience and here you can find my experiences, best practices and advices about this topic. My two blogs I have to working blogs: this one here technology and programming blog for local market My local blog is almost five years old and it makes it one of the oldest company blogs in Estonia. It is still active and I write there as much as I have time for it. This blog here is active since September 2007, so it is about 3.5 years old right now. Both of these blogs are  my major hits in my MVP carrier and they have very good web statistics too. My local blog My local blog is about programming, web and technology. It has way wider target audience then this blog here has. By example, in my local blog I blog also about local events, cool new concept phones, different webs providing some interesting services etc. But local guys can find there also my postings about how to solve one or another programming problem and postings about Microsoft technologies I am playing with. This far my local blog has a lot of readers for such a small country that Estonia is. This blog has made me a lot of cool contacts and I have had there a lot of interesting discussions about different technical topics. Why I started this blog? Living in small country is different than living in big country. In small country you have less people and therefore smaller audience so you have to target more than one technical topic to find enough readers. In a same time you are still interested in your main topics and you want to reach to more people who are sharing same interests with you. Practically one day y will grow out from local market and you go global. This is how this blog was born. Was it worth to create, promote and mess with it? Every second I have put on my time to this blog has been worth of it. Thanks to this blog I have found new good friends and without them I think it is more boring to work on different problems and solutions. Defining target audiences One thing you should always do when having more than one blog is defining target audiences. If you are just technomaniac interested in sharing your stuff and make some new friends and have something to write to your MVP nomination form then you don’t have to go through complex targeting process. You can do it simple way and same effectively. Here is how I defined target audiences to my blogs: local blog – reader of my local blog is IT professional, software developer, technology innovator or just some guy who is interested in technology,   this blog – reader of this blog is experienced professional software developer who works on Microsoft technologies or software developer who is open minded and open to new technologies and interesting solutions to development problems. You can see how local blog – due to small market with less people – has wider definition for audience while this blog is heavily targeted to Microsoft technologies and specially to software development. On practical side these decisions are also made well I think because it is very hard to build up popular common IT blog. On global level it is better to target some specific niche and find readers who are professionals on your favorite topics. Thanks to this blog I have found new friends who are professional developers and I am very happy about all the discussions I have had with them. Publishing content to different blogs My local blog and this blog have some overlapping topics like .NET, databases and SEO. Due to this overlapping there is question: when I write posting to my local blog then should I have to publish same thing in my global blog? And if I write something to my global blog then should I publish same thing also in my local blog? Well, it really depends on the definition of your target audiences. If they match then of course it is good idea to translate you post and publish it also to another blog. But if you have different audiences then you may need to modify your posting before publishing it. The questions you have to answer are: is target audience interested in this topic? is target audience expecting more specific and deeper handling of this topic or are they expecting more general handling of topic? is the problem you are discussing actual for target audience or not? You have to answer these questions and after that make your decision. If you need to modify your original posting then take some time and do it. Provide quality to all your readers because they will respect you if you respect them. Cross-posting and referencing It is tempting to save time that preparing some blog post takes and if you have are done with posting in one blog it may seem like good idea to make short posting to another blog and add reference to first one where topic is discussed longer. Well, don’t do it – all your readers expect good quality content from you and jumping from one blog post to another is disturbing for them. Of course, there is problem with differences between target audiences. You may have wider target audience and some people may be interested in more specific handling of topic. In this case feel free to refer your blog you are writing in english. This is not working very well in opposite direction because almost all my global blog readers understand english but not estonian. By example, estonian language is complex one and online translating tools make very poor translations from estonian language. This is why I don’t even plan to publish postings here that refer to my local blog for more information. I am keeping these two blogs as two different worlds and if there is posting that fits well to both blogs I will write my posting to one blog and then answer previous three questions before posting same thing to another blog. Conclusion Growing out of your local market is not anything mysterious if you are living in small country. As it is harder to find people there who are interested in same topics with you then sooner or later you will start finding these new contacts from global audience. Global audience is bigger and to be visible there you must provide high quality content to your audience. It is something you will learn over time and you will learn every day something new when you are posting to your global blog. You may ask: if global blog is much more complex thing to do then is it worth to do at all? My answer is: yes, do it for sure. It is not easy thing to do when you start but if you work on your global blog and improve it over time you will get over all obstacles pretty soon. Just don’t forget one thing – content is king and your readers expect high quality from you.

    Read the article

< Previous Page | 33 34 35 36 37 38 39 40 41 42 43 44  | Next Page >