Search Results

Search found 89481 results on 3580 pages for 'new technology'.

Page 373/3580 | < Previous Page | 369 370 371 372 373 374 375 376 377 378 379 380  | Next Page >

  • INSERT OR IGNORE in a trigger

    - by dan04
    I have a database (for tracking email statistics) that has grown to hundreds of megabytes, and I've been looking for ways to reduce it. It seems that the main reason for the large file size is that the same strings tend to be repeated in thousands of rows. To avoid this problem, I plan to create another table for a string pool, like so: CREATE TABLE AddressLookup ( ID INTEGER PRIMARY KEY AUTOINCREMENT, Address TEXT UNIQUE ); CREATE TABLE EmailInfo ( MessageID INTEGER PRIMARY KEY AUTOINCREMENT, ToAddrRef INTEGER REFERENCES AddressLookup(ID), FromAddrRef INTEGER REFERENCES AddressLookup(ID) /* Additional columns omitted for brevity. */ ); And for convenience, a view to join these tables: CREATE VIEW EmailView AS SELECT MessageID, A1.Address AS ToAddr, A2.Address AS FromAddr FROM EmailInfo LEFT JOIN AddressLookup A1 ON (ToAddrRef = A1.ID) LEFT JOIN AddressLookup A2 ON (FromAddrRef = A2.ID); In order to be able to use this view as if it were a regular table, I've made some triggers: CREATE TRIGGER trg_id_EmailView INSTEAD OF DELETE ON EmailView BEGIN DELETE FROM EmailInfo WHERE MessageID = OLD.MessageID; END; CREATE TRIGGER trg_ii_EmailView INSTEAD OF INSERT ON EmailView BEGIN INSERT OR IGNORE INTO AddressLookup(Address) VALUES (NEW.ToAddr); INSERT OR IGNORE INTO AddressLookup(Address) VALUES (NEW.FromAddr); INSERT INTO EmailInfo SELECT NEW.MessageID, A1.ID, A2.ID FROM AddressLookup A1, AddressLookup A2 WHERE A1.Address = NEW.ToAddr AND A2.Address = NEW.FromAddr; END; CREATE TRIGGER trg_iu_EmailView INSTEAD OF UPDATE ON EmailView BEGIN UPDATE EmailInfo SET MessageID = NEW.MessageID WHERE MessageID = OLD.MessageID; REPLACE INTO EmailView SELECT NEW.MessageID, NEW.ToAddr, NEW.FromAddr; END; The problem After: INSERT OR REPLACE INTO EmailView VALUES (1, '[email protected]', '[email protected]'); INSERT OR REPLACE INTO EmailView VALUES (2, '[email protected]', '[email protected]'); The updated rows contain: MessageID ToAddr FromAddr --------- ------ -------- 1 NULL [email protected] 2 [email protected] [email protected] There's a NULL that shouldn't be there. The corresponding cell in the EmailInfo table contains an orphaned ToAddrRef value. If you do the INSERTs one at a time, you'll see that Alice's ID in the AddressLookup table changes! It appears that this behavior is documented: An ON CONFLICT clause may be specified as part of an UPDATE or INSERT action within the body of the trigger. However if an ON CONFLICT clause is specified as part of the statement causing the trigger to fire, then conflict handling policy of the outer statement is used instead. So the "REPLACE" in the top-level "INSERT OR REPLACE" statement is overriding the critical "INSERT OR IGNORE" in the trigger program. Is there a way I can make it work the way that I wanted?

    Read the article

  • Find cheapest price for X number of days

    - by user76152
    Hey 'FLow. I have a technical challenge for you regarding an algorithm. Lets say I have this list of days and prices: List<ReservationPrice> prices = new List<ReservationPrice>(); prices.Add(new ReservationPrice { NumberOfDays = 1, Price = 1000 }); prices.Add(new ReservationPrice { NumberOfDays = 2, Price = 1200 }); prices.Add(new ReservationPrice { NumberOfDays = 3, Price = 2500 }); prices.Add(new ReservationPrice { NumberOfDays = 4, Price = 3100 }); prices.Add(new ReservationPrice { NumberOfDays = 7, Price = 4000 }); What I would like to able to do now is: give me the best price from the list based on a number of days. So if ask for 3 days the best price from the list is from child one (1000) and two (1200), but there are of course different combinations you would have to try out at first. How would an algorithm that found the best price from this list look like ? Thank you!

    Read the article

  • SqlCommand asp.net C#

    - by emilios
    i you please help me out with my problem i am trying to create a function that output the data on a dropdownlist an setting my parameters my code goes as follow : public static List<string> GetTracks(out List<string> trackIds, string conferenceId) { var res = new List<string>(); trackIds = new List<string>(); var sqlCon = new SqlConnection(System.Configuration.ConfigurationManager.ConnectionStrings["ConnectionString"].ConnectionString); SqlCommand cmd = new SqlCommand("select Track_name,Track_ID from TrackCommittee where Conference_id= @conferenceId", sqlCon); DataSet ds = new DataSet(); cmd.Connection.Open(); cmd.Parameters.Add(new SqlParameter("@conferenceId", conferenceId)); using (SqlDataReader sdr = cmd.ExecuteReader()) { while (sdr.Read()) { res.Add(sdr.GetString(sdr.GetOrdinal("Track_name"))); trackIds.Add(sdr.GetInt32(sdr.GetOrdinal("Track_ID")).ToString()); } } cmd.Connection.Close(); cmd.Dispose(); return res; } thanking you in advance

    Read the article

  • Asp.net MVC RSS help needed.

    - by coure06
    Following the tutorial at http://www.developerzen.com/2009/01/11/aspnet-mvc-rss-feed-action-result/ My code for the controller is like this, but i am not getting any result from http://www.gadgetfind.com/rss.xml public ActionResult Feed() { SyndicationFeed feed = new SyndicationFeed("Test Feed", "This is a test feed", new Uri("http://www.gadgetfind.com/rss.xml"), "TestFeedID", DateTime.Now); SyndicationItem item = new SyndicationItem("Test Item", "This is the content for Test Item", new Uri("http://www.gadgetfind.com/rss.xml"), "TestItemID", DateTime.Now); List<SyndicationItem> items = new List<SyndicationItem>(); items.Add(item); feed.Items = items; return new RssActionResult() { Feed = feed }; }

    Read the article

  • Problem with MultiColumn Primary Key

    - by Mike
    DataTable NetPurch = new DataTable(); DataColumn[] Acct_n_Prod = new DataColumn[2]; DataColumn Account; Account = new DataColumn(); Account.DataType = typeof(string); Account.ColumnName = "Acct"; DataColumn Product; Product = new DataColumn(); Product.DataType = typeof(string); Product.ColumnName = "Prod"; NetPurch.Columns.Add(Account); NetPurch.Columns.Add(Product); Acct_n_Prod[0] = Account; Acct_n_Prod[1] = Product; NetPurch.PrimaryKey = Acct_n_Prod; NetPurch.Columns.Add(MoreColumns); the code is based on the example here When it is compiled and runs i get an error saying: "Expecting 2 values for the key being indexed but received only one" if I make Acct_n_Prod = new DataColumn[1] and comment out the line adding product to the acct-n-prod array then it runs fine I'm fairly new to this so I'm not sure where the error is Thanks, -Mike

    Read the article

  • Creating keystore for jarsigner programmatically

    - by skayred
    I'm trying to generate keystore with certificate to use it with JarSigner. Here is my code: System.out.println("Keystore generation..."); Security.addProvider(new BouncyCastleProvider()); String domainName = "example.org"; KeyPairGenerator keyGen = KeyPairGenerator.getInstance("RSA"); SecureRandom random = SecureRandom.getInstance("SHA1PRNG", "SUN"); keyGen.initialize(1024, random); KeyPair pair = keyGen.generateKeyPair(); X509V3CertificateGenerator v3CertGen = new X509V3CertificateGenerator(); int serial = new SecureRandom().nextInt(); v3CertGen.setSerialNumber(BigInteger.valueOf(serial < 0 ? -1 * serial : serial)); v3CertGen.setIssuerDN(new X509Principal("CN=" + domainName + ", OU=None, O=None L=None, C=None")); v3CertGen.setNotBefore(new Date(System.currentTimeMillis() - 1000L * 60 * 60 * 24 * 30)); v3CertGen.setNotAfter(new Date(System.currentTimeMillis() + (1000L * 60 * 60 * 24 * 365*10))); v3CertGen.setSubjectDN(new X509Principal("CN=" + domainName + ", OU=None, O=None L=None, C=None")); v3CertGen.setPublicKey(pair.getPublic()); v3CertGen.setSignatureAlgorithm("MD5WithRSAEncryption"); X509Certificate PKCertificate = v3CertGen.generateX509Certificate(pair.getPrivate()); FileOutputStream fos = new FileOutputStream("/Users/dmitrysavchenko/testCert.cert"); fos.write(PKCertificate.getEncoded()); fos.close(); KeyStore ks = KeyStore.getInstance(KeyStore.getDefaultType()); char[] password = "123".toCharArray(); ks.load(null, password); ks.setCertificateEntry("hive", PKCertificate); fos = new FileOutputStream("/Users/dmitrysavchenko/hive-keystore.pkcs12"); ks.store(fos, password); fos.close(); It works, but when I'm trying to sign my JAR with this keystore, I get the following error: jarsigner: Certificate chain not found for: hive. hive must reference a valid KeyStore key entry containing a private key and corresponding public key certificate chain. I've discovered that there must be a private key, but I don't know how to add it to certificate. Can you help me?

    Read the article

  • How to iterate loop inside a string searching for any word aftera fixed keyword?

    - by Parth
    Suppose I have a sting as "PHP Paddy,PHP Pranav,PHP Parth", now i have a count as 3,now how should I iterate loop in the string aiming on string after "PHP " to display the all the names? Alright This is the string "BEGIN IF (NEW.name != OLD.name) THEN INSERT INTO jos_menuaudit set menuid=OLD.id, oldvalue = OLD.name, newvalue = NEW.name, field = "name"; END IF; IF (NEW.alias != OLD.alias) THEN INSERT INTO jos_menuaudit set menuid=OLD.id, oldvalue = OLD.alias, newvalue = NEW.alias, field = "alias"; END IF; END" in which i am searching the particular word after " IF (NEW.", and after that particualar others strings should not b displayed, hence whenever in a loop it finds " IF (NEW." I musr get a word just next to it. and in this way an array should b ready for to use.

    Read the article

  • .NET WinForms INotifyPropertyChanged updates all bindings when one is changed. Better way?

    - by Dave Welling
    In a windows forms application, a property change that triggers INotifyPropertyChanged, will result in the form reading EVERY property from my bound object, not just the property changed. (See example code below) This seems absurdly wasteful since the interface requires the name of the changing property. It is causing a lot of clocking in my app because some of the property getters require calculations to be performed. I'll likely need to implement some sort of logic in my getters to discard the unnecessary reads if there is no better way to do this. Am I missing something? Is there a better way? Don't say to use a different presentation technology please -- I am doing this on Windows Mobile (although the behavior happens on the full framework as well). Here's some toy code to demonstrate the problem. Clicking the button will result in BOTH textboxes being populated even though one property has changed. using System; using System.ComponentModel; using System.Drawing; using System.Windows.Forms; namespace Example { public class ExView : Form { private Presenter _presenter = new Presenter(); public ExView() { this.MinimizeBox = false; TextBox txt1 = new TextBox(); txt1.Parent = this; txt1.Location = new Point(1, 1); txt1.Width = this.ClientSize.Width - 10; txt1.DataBindings.Add("Text", _presenter, "SomeText1"); TextBox txt2 = new TextBox(); txt2.Parent = this; txt2.Location = new Point(1, 40); txt2.Width = this.ClientSize.Width - 10; txt2.DataBindings.Add("Text", _presenter, "SomeText2"); Button but = new Button(); but.Parent = this; but.Location = new Point(1, 80); but.Click +=new EventHandler(but_Click); } void but_Click(object sender, EventArgs e) { _presenter.SomeText1 = "some text 1"; } } public class Presenter : INotifyPropertyChanged { public event PropertyChangedEventHandler PropertyChanged; private string _SomeText1 = string.Empty; public string SomeText1 { get { return _SomeText1; } set { _SomeText1 = value; _SomeText2 = value; // <-- To demonstrate that both properties are read OnPropertyChanged("SomeText1"); } } private string _SomeText2 = string.Empty; public string SomeText2 { get { return _SomeText2; } set { _SomeText2 = value; OnPropertyChanged("SomeText2"); } } private void OnPropertyChanged(string PropertyName) { PropertyChangedEventHandler temp = PropertyChanged; if (temp != null) { temp(this, new PropertyChangedEventArgs(PropertyName)); } } } }

    Read the article

  • Java: JAX-WS passing authentication info to a call to webservice

    - by agnieszka
    I am using JAX-WS. I am connecting to .NET webservice that requires authentication. I first call the Authentication.asmx so that I can be authenticated. The call returns me a LoginResult that contains a cookie name. Then I call another webservice and I need to somehow pass this cookie or a cookie name. and I don't know how. Here is the code: //first service that returns login information Authentication auth = new Authentication(new URL("the_url"), new QName("http://schemas.microsoft.com/sharepoint/soap/", "Authentication")); LoginResult result = auth.getAuthenticationSoap().login(HTTPuserName, HTTPpassword); //i need to pass cookie or cookie name or any other login information to call to this service Copy copyService = new Copy(new URL("service_url"), new QName("http://schemas.microsoft.com/sharepoint/soap/", "Copy")); BindingProvider p = (BindingProvider) copyService.getCopySoap();

    Read the article

  • How can i take only integer input from keyboard and if input is invalid how do i ask user agaian

    - by fari
    This is what i have written so far but when exception is raised it does not again ask teh user for input. do{ System.out.println("Enter the number of stones to play with: "); BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); String temp=br.readLine(); }while (key<0 && key>9); if(key<0 || key>10) throw new InvalidStartingStonesException(key); player1=new KeyBoardPlayer(); player2 = new KeyBoardPlayer(); this.player1=player1; this.player2=player2; state=new KalaGameState(key); } catch(NumberFormatException nFE) { System.out.println("Not an Integer");} catch(IOException e) { System.out.println(e); }

    Read the article

  • Trying to capture stage area using BitmapData

    - by Dimitree
    I am trying to grab part of stage area using BitmapData and copyPixels method: bmd = new BitmapData(stage.stageWidth, stage.stageHeight); bmdRect = new BitmapData(320, 240); rectangle = new Rectangle(360, 20, 320, 240); bmdRect.copyPixels(bmd, rectangle, new Point()); bmd.draw(bmp); bmp = new Bitmap(bmdRect); var myEncoder:JPGEncoder = new JPGEncoder(100); var byteArray:ByteArray = myEncoder.encode(bmd); The result i get is an empty .jpg I m pretty sure that the error is in the Bitmap procedure and not the saving one...

    Read the article

  • Will i need two database connection for the following created trigger in MySQL?

    - by Parth
    Will i need two database connection for the following created trigger in MySQL? "DELIMITER $$ DROP TRIGGER `update_data` $$ CREATE TRIGGER `update_data` AFTER UPDATE on `jos_menu` FOR EACH ROW BEGIN IF (NEW.menutype != OLD.menutype) THEN INSERT INTO jos_menuaudit set menuid=OLD.id, oldvalue = OLD.menutype, newvalue = NEW.menutype, field = 'menutype'; END IF; IF (NEW.name != OLD.name) THEN INSERT INTO jos_menuaudit set menuid=OLD.id, oldvalue = OLD.name, newvalue = NEW.name, field = 'name'; END IF; IF (NEW.alias != OLD.alias) THEN INSERT INTO jos_menuaudit set menuid=OLD.id, oldvalue = OLD.alias, newvalue = NEW.alias, field = 'alias'; END IF; END$$ DELIMITER ;" I am using PHP for coding.... EDITED To Execute the previous trigger, will i need to have two DB connection for it? likewise: mysql_select_db('pranav_test'); mysql_select_db('information_schema');

    Read the article

  • Vaadin: Downloaded file has whole path as file name

    - by javydreamercsw
    I have a download action implemented on my Vaadin application but for some reason the downloaded file has the original file's full path as the file name. Any idea? You can see the code on this post. Edit: Here's the important part of the code: package com.bluecubs.xinco.core.server.vaadin; import com.bluecubs.xinco.core.server.XincoConfigSingletonServer; import com.vaadin.Application; import com.vaadin.terminal.DownloadStream; import com.vaadin.terminal.FileResource; import java.io.*; import java.net.URLEncoder; import java.util.UUID; import java.util.logging.Level; import java.util.logging.Logger; import java.util.zip.CRC32; import java.util.zip.CheckedInputStream; /** * * @author Javier A. Ortiz Bultrón<[email protected]> */ public class FileDownloadResource extends FileResource { private final String fileName; private File download; private File newFile; public FileDownloadResource(File sourceFile, String fileName, Application application) { super(sourceFile, application); this.fileName = fileName; } protected void cleanup() { if (newFile != null && newFile.exists()) { newFile.delete(); } if (download != null && download.exists() && download.listFiles().length == 0) { download.delete(); } } @Override public DownloadStream getStream() { try { //Copy file to directory for downloading InputStream in = new CheckedInputStream(new FileInputStream(getSourceFile()), new CRC32()); download = new File(XincoConfigSingletonServer.getInstance().FileRepositoryPath + System.getProperty("file.separator") + UUID.randomUUID().toString()); newFile = new File(download.getAbsolutePath() + System.getProperty("file.separator") + fileName); download.mkdirs(); OutputStream out = new FileOutputStream(newFile); newFile.deleteOnExit(); download.deleteOnExit(); byte[] buf = new byte[1024]; int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } in.close(); out.close(); final DownloadStream ds = new DownloadStream( new FileInputStream(newFile), getMIMEType(), fileName); ds.setParameter("Content-Disposition", "attachment; filename=" + URLEncoder.encode(fileName, "utf-8")); ds.setCacheTime(getCacheTime()); return ds; } catch (final FileNotFoundException ex) { Logger.getLogger(FileDownloadResource.class.getName()).log(Level.SEVERE, null, ex); return null; } catch (IOException ex) { Logger.getLogger(FileDownloadResource.class.getName()).log(Level.SEVERE, null, ex); return null; } } } I already debugged and verified that fileName only contains the file's name not the whole path.

    Read the article

  • What is a custom collection?

    - by Win Coder
    A Group of objects. However i am having confusion in the following case. A sample class Class A { public string; } Class A_list { public A[] list; public A_list(A[] _list) { list = new A[_list.length]; for (int i = 0; i < _list.Length; i++) { list[i] = _list[i]; } } } static void Main(String[] args) { A[] names = new A[3] { new A("some"), new A("another"), new A("one"), }; A_list just_an_object = new A_list(names); } Which of the above is a custom collection the array or the object that holds array as a field or are both custom collections.

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Hibernate save() and transaction rollback

    - by Marco
    Hi, In Hibernate when i save() an object in a transaction, and then i rollback it, the saved object still remains in the DB. It's strange because this issue doesn't happen with the update() or delete() method, just with save(). Here is the code i'm using: DbEntity dbEntity = getDbEntity(); HibernateUtil.beginTransaction(); Session session = HibernateUtil.getCurrentSession(); session.save(dbEntity); HibernateUtil.rollbackTransaction(); And here is the HibernateUtil class (just the involved functions, i guarantee the getSessionFactory() method works well - there is an Interceptor handler, but it doesn't matter now): private static final ThreadLocal<Session> threadSession = new ThreadLocal<Session>(); private static final ThreadLocal<Transaction> threadTransaction = new ThreadLocal<Transaction>(); /** * Retrieves the current Session local to the thread. * <p/> * If no Session is open, opens a new Session for the running thread. * * @return Session */ public static Session getCurrentSession() throws HibernateException { Session s = (Session) threadSession.get(); try { if (s == null) { log.debug("Opening new Session for this thread."); if (getInterceptor() != null) { log.debug("Using interceptor: " + getInterceptor().getClass()); s = getSessionFactory().openSession(getInterceptor()); } else { s = getSessionFactory().openSession(); } threadSession.set(s); } } catch (HibernateException ex) { throw new HibernateException(ex); } return s; } /** * Start a new database transaction. */ public static void beginTransaction() throws HibernateException { Transaction tx = (Transaction) threadTransaction.get(); try { if (tx == null) { log.debug("Starting new database transaction in this thread."); tx = getCurrentSession().beginTransaction(); threadTransaction.set(tx); } } catch (HibernateException ex) { throw new HibernateException(ex); } } /** * Rollback the database transaction. */ public static void rollbackTransaction() throws HibernateException { Transaction tx = (Transaction) threadTransaction.get(); try { threadTransaction.set(null); if ( tx != null && !tx.wasCommitted() && !tx.wasRolledBack() ) { log.debug("Tyring to rollback database transaction of this thread."); tx.rollback(); } } catch (HibernateException ex) { throw new HibernateException(ex); } finally { closeSession(); } } Thanks

    Read the article

  • augment the factory pattern in java

    - by TP
    I am trying to use a factory pattern to create a QuestionTypeFactory where the instantiated classes will be like MultipleChoice, TrueFalseQuestion etc. The factory code looks something like this class QuestionFactory { public enum QuestionType { TrueFalse, MultipleChoice, Essay } public static Question createQuestion(QuestionType quesType) { switch (quesType) { case TrueFalse: return new TrueFalseQuestion(); case MultipleChoice: return new MultipleChoiceQuestion(); case Essay: return new EssayQuestion(); } throw new IllegalArgumentException("Not recognized."); } } This works ok for now. If I want to add another question type I will need to modify the factory class and I do not want to do that. How can I set it up so that each question class registers itself with the Factory so that when I add a new question type, I do not have to change the code for the factory? I am a bit new to java and am not sure how to do this.

    Read the article

  • Comparing Values with newlines in Selenium IDE

    - by Zachary
    I am writing a Selenium test case using the IDE, and I have a that I want to verify is equal to the value I expect. The newlines in the box seem to be causing some trouble, as when I use the "verifyValue" command I get this: # [info] Executing: |verifyValue | organizationContainer.organization.defaultLegalText | This is some test legal text. I just did a new line. Hopefully these new lines will get preserved. | # [error] Actual value 'This is some test legal text. I just did a new line. Hopefully these new lines will get preserved.' did not match 'This is some test legal text. I just did a new line. Hopefully these new lines will get preserved. ' Is there a better way to compare strings in the Selenium IDE

    Read the article

  • shuffling array javascript

    - by Dennis Callanan
    <!doctype html> <html lang="en"> <head> <meta charset="utf=8" /> <title>Blackjack</title> <link rel="stylesheet" href="blackjack.css" /> <script type="text/javascript"> var H2 = 2; var S2 = 2; var D2 = 2; var C2 = 2; var H3 = 3; var S3 = 3; var D3 = 3; var C3 = 3; var deck = new Array(H2, S2, D2, C2, H3, S3, D3, C3); var new_deck = new Array(); var r; document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") for (r=0;r<deck.length;r++){ var randomindex = Math.floor(Math.random()*deck.length); new_deck.push(randomindex) deck.pop(randomindex) } document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") </script> </head> <body> </body> </html> Obviously this isn't the full Blackjack game here. It's just a test to see if shuffling the array works by printing the contents of both decks (arrays) before and after the shuffle. I'm only using 8 cards at the moment, 4 2's and 4 3's. What I am getting from this is: deck = 22223333 new deck = deck = 2222 new deck = 7502 What I'm hoping to get is: deck = 22223333 new deck = deck = new deck = 23232323 (or any of the 8 numbers, generated randomly) So it should be shuffling those 8 cards, what am I doing wrong? I'm only new to javascript but I've used some python before. I've done something similar in python and worked perfectly, but I'm not sure what's wrong here. Thanks for any answers in advance!!

    Read the article

  • How to add items rows to a listview WPF and VB.net

    - by leviatan1001
    Im getting crazy with it. It is so easy in windows form, but in wpf it seems to be different. Every example i find is in C# and i cant addapt it. Well, this is the code i have. Atm, i have just defined the columns: 'diseño de las columnas Dim item As ListViewItem = New ListViewItem Dim Mi_Lista As GridView = New GridView Mi_Lista.AllowsColumnReorder = True Dim cine As New GridViewColumn() Dim Si3d As New GridViewColumn cine.Header = "Cine" cine.DisplayMemberBinding = New Binding("Cine") Si3d.DisplayMemberBinding = New Binding("si3D") cine.Width = 140 Si3d.Header = "3D" Si3d.Width = 50 Mi_Lista.Columns.Add(cine) Mi_Lista.Columns.Add(Si3d) Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Learning MVC - Maintaining model state

    - by GenericTypeTea
    First of all, I'm very new to MVC. Bought the books, but not got the T-Shirt yet. I've put together my first little application, but I'm looking at the way I'm maintaining my model and I don't think it looks right. My form contains the following: <% using (Html.BeginForm("Reconfigured", null, FormMethod.Post, new { id = "configurationForm" })) { %> <%= Html.DropDownList("selectedCompany", new SelectList(Model.Companies, Model.SelectedCompany), new { onchange = "$('#configurationForm').submit()" })%> <%= Html.DropDownList("selectedDepartment", new SelectList(Model.Departments, Model.SelectedDepartment), new { onchange = "$('#configurationForm').submit()" })%> <%=Html.TextArea("comment", Model.Comment) %> <%} %> My controller has the following: public ActionResult Index(string company, string department, string comment) { TestModel form = new TestModel(); form.Departments = _someRepository.GetList(); form.Companies = _someRepository.GetList(); form.Comment = comment; form.SelectedCompany = company; form.SelectedDepartment = department; return View(form); } [HttpPost] public ActionResult Reconfigured(string selectedCompany, string selectedDepartment, string comment) { return RedirectToAction("Index", new { company = selectedCompany, department = selectedDepartment, comment = comment}); } And finally, this is my route: routes.MapRoute( "Default", "{controller}/{company}/{department}", new { controller = "CompanyController", action = "Index", company="", department="" } ); Now, every time I change DropDownList value, all my values are maintained. I end up with a URL like the following after the Reconfigure action is called: http://localhost/Main/Index/Company/Sales?comment=Foo%20Bar Ideally I'd like the URL to remain as: http://localhost/Main/Index My routing object is probably wrong. This can't be the right way? It seems totally wrong to me as for each extra field I add, I have to add the property into the Index() method? I had a look at this answer where the form is passed through TempData. This is obviously an improvement, but it's not strongly typed? Is there a way to do something similar but have it strongly typed? This may be a simple-enough question, but the curse of 10 years of WinForms/WebForms makes this MVC malarky hard to get your head 'round.

    Read the article

  • Get the first and second objects from a list using LINQ

    - by Vahid
    I have a list of Person objects. How can I get the first and second Person objects that meet a certain criteria from List<Person> People using LINQ? Let's say here is the list I've got. How can I get the first and second persons that are over 18 that is James and Jodie. public class Person { public string Name; public int age; } var People = new List<Person> { new Person {Name = "Jack", Age = 15}, new Person {Name = "James" , Age = 19}, new Person {Name = "John" , Age = 14}, new Person {Name = "Jodie" , Age = 21}, new Person {Name = "Jessie" , Age = 19} }

    Read the article

  • Qt Qbrush issue

    - by Solitaire
    What is the difference in the following code, QGraphicsScene * scence = new QGraphicsScene(); QBrush *brush = new QBrush((QColor(60,20,20))); scence->setBackgroundBrush(*brush); QGraphicsView *view = new QGraphicsView(); view->setScene(scence); //view->setBackgroundBrush(*brush); //view->setCacheMode(QGraphicsView::CacheBackground); view->showFullScreen(); gives black color background QGraphicsScene * scence = new QGraphicsScene(); QBrush *brush = new QBrush(); brush->setColor(QColor(60,20,20)); scence->setBackgroundBrush(*brush); QGraphicsView *view = new QGraphicsView(); view->setScene(scence); //view->setBackgroundBrush(*brush); //view->setCacheMode(QGraphicsView::CacheBackground); view->showFullScreen(); it gives nothing.

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

< Previous Page | 369 370 371 372 373 374 375 376 377 378 379 380  | Next Page >