Search Results

Search found 90467 results on 3619 pages for 'new rows'.

Page 384/3619 | < Previous Page | 380 381 382 383 384 385 386 387 388 389 390 391  | Next Page >

  • Java: JAX-WS passing authentication info to a call to webservice

    - by agnieszka
    I am using JAX-WS. I am connecting to .NET webservice that requires authentication. I first call the Authentication.asmx so that I can be authenticated. The call returns me a LoginResult that contains a cookie name. Then I call another webservice and I need to somehow pass this cookie or a cookie name. and I don't know how. Here is the code: //first service that returns login information Authentication auth = new Authentication(new URL("the_url"), new QName("http://schemas.microsoft.com/sharepoint/soap/", "Authentication")); LoginResult result = auth.getAuthenticationSoap().login(HTTPuserName, HTTPpassword); //i need to pass cookie or cookie name or any other login information to call to this service Copy copyService = new Copy(new URL("service_url"), new QName("http://schemas.microsoft.com/sharepoint/soap/", "Copy")); BindingProvider p = (BindingProvider) copyService.getCopySoap();

    Read the article

  • How can i take only integer input from keyboard and if input is invalid how do i ask user agaian

    - by fari
    This is what i have written so far but when exception is raised it does not again ask teh user for input. do{ System.out.println("Enter the number of stones to play with: "); BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); String temp=br.readLine(); }while (key<0 && key>9); if(key<0 || key>10) throw new InvalidStartingStonesException(key); player1=new KeyBoardPlayer(); player2 = new KeyBoardPlayer(); this.player1=player1; this.player2=player2; state=new KalaGameState(key); } catch(NumberFormatException nFE) { System.out.println("Not an Integer");} catch(IOException e) { System.out.println(e); }

    Read the article

  • Trying to capture stage area using BitmapData

    - by Dimitree
    I am trying to grab part of stage area using BitmapData and copyPixels method: bmd = new BitmapData(stage.stageWidth, stage.stageHeight); bmdRect = new BitmapData(320, 240); rectangle = new Rectangle(360, 20, 320, 240); bmdRect.copyPixels(bmd, rectangle, new Point()); bmd.draw(bmp); bmp = new Bitmap(bmdRect); var myEncoder:JPGEncoder = new JPGEncoder(100); var byteArray:ByteArray = myEncoder.encode(bmd); The result i get is an empty .jpg I m pretty sure that the error is in the Bitmap procedure and not the saving one...

    Read the article

  • Foreach loop is running n times

    - by Furqan Khyraj
    foreach($CarAdList as $CarAd) { echo($msg .= '<tr><td>'.$CarAd->getCarAdID().'</td><td>' .$CarAd->getBrandText().'</td><td>' .$CarAd->getDescription(). '</td><td><a href="status.php?id='.$CarAd->getCarAdID().'"><img src="../images/active.png" /></a></td><td><img src="../images/delete.png" width="30px" /></td></tr>'); } e.g, the number of rows =38 n= the number of rows * the number of rows-- it is running n times so its displaying 5 5 4 5 4 3 5 4 3 2 5 4 3 2 1

    Read the article

  • Will i need two database connection for the following created trigger in MySQL?

    - by Parth
    Will i need two database connection for the following created trigger in MySQL? "DELIMITER $$ DROP TRIGGER `update_data` $$ CREATE TRIGGER `update_data` AFTER UPDATE on `jos_menu` FOR EACH ROW BEGIN IF (NEW.menutype != OLD.menutype) THEN INSERT INTO jos_menuaudit set menuid=OLD.id, oldvalue = OLD.menutype, newvalue = NEW.menutype, field = 'menutype'; END IF; IF (NEW.name != OLD.name) THEN INSERT INTO jos_menuaudit set menuid=OLD.id, oldvalue = OLD.name, newvalue = NEW.name, field = 'name'; END IF; IF (NEW.alias != OLD.alias) THEN INSERT INTO jos_menuaudit set menuid=OLD.id, oldvalue = OLD.alias, newvalue = NEW.alias, field = 'alias'; END IF; END$$ DELIMITER ;" I am using PHP for coding.... EDITED To Execute the previous trigger, will i need to have two DB connection for it? likewise: mysql_select_db('pranav_test'); mysql_select_db('information_schema');

    Read the article

  • HTML + javascript mouse over, mouseout, onclick not working in firefox.

    - by help_inmssql
    Hello Everyone, My question is to get onMouseover,onMouseout,onMousedown,onClick on a table row. For which i am calling javascript userdefined functions. onMouseover --- Background color should change. onMouseout --- Reset to original color onClick --- First column checkbox/radio button should be set and background color should change onMousedown --- background color should change. My code in html is:- <tr onMouseOver="hover(this)" onMouseOut="hover_out(this)" onMouseDown="get_first_state(this)" onClick="checkit(this)" > and the methods in javascripts are:- var first_state = false; var oldcol = '#ffffff'; var oldcol_cellarray = new Array(); function hover(element) { if (! element) element = this; while (element.tagName != 'TR') { element = element.parentNode; } if (element.style.fontWeight != 'bold') { for (var i = 0; i<element.cells.length; i++) { if (element.cells[i].className != "no_hover") { oldcol_cellarray[i] = element.cells[i].style.backgroundColor; element.cells[i].style.backgroundColor='#e6f6f6'; } } } } // ----------------------------------------------------------------------------------------------- function hover_out(element) { if (! element) element = this; while (element.tagName != 'TR') { element = element.parentNode; } if (element.style.fontWeight != 'bold') { for (var i = 0; i<element.cells.length; i++) { if (element.cells[i].className != "no_hover") { if (typeof oldcol_cellarray != undefined) { element.cells[i].style.backgroundColor=oldcol_cellarray[i]; } else { element.cells[i].style.backgroundColor='#ffffff'; } //var oldcol_cellarray = new Array(); } } } } // ----------------------------------------------------------------------------------------------- function get_first_state(element) { while (element.tagName != 'TR') { element = element.parentNode; } first_state = element.cells[0].firstChild.checked; } // ----------------------------------------------------------------------------------------------- function checkit (element) { while (element.tagName != 'TR') { element = element.parentNode; } if (element.cells[0].firstChild.type == 'radio') { var typ = 0; } else if (element.cells[0].firstChild.type == 'checkbox') { typ = 1; } if (element.cells[0].firstChild.checked == true && typ == 1) { if (element.cells[0].firstChild.checked == first_state) { element.cells[0].firstChild.checked = false; } set_rowstyle(element, element.cells[0].firstChild.checked); } else { if (typ == 0 || element.cells[0].firstChild.checked == first_state) { element.cells[0].firstChild.checked = true; } set_rowstyle(element, element.cells[0].firstChild.checked); } if (typ == 0) { var table = element.parentNode; if (table.tagName != "TABLE") { table = table.parentNode; } if (table.tagName == "TABLE") { table=table.tBodies[0].rows; //var table = document.getElementById("js_tb").tBodies[0].rows; for (var i = 1; i< table.length; i++) { if (table[i].cells[0].firstChild.checked == true && table[i] != element) { table[i].cells[0].firstChild.checked = false; } if (table[i].cells[0].firstChild.checked == false) { set_rowstyle(table[i], false); } } } } } function set_rowstyle(r, on) { if (on == true) { for (var i =0; i < r.cells.length; i++) { r.style.fontWeight = 'bold'; r.cells[i].style.backgroundColor = '#f2f2c2'; } } else { for ( i =0; i < r.cells.length; i++) { r.style.fontWeight = 'normal'; r.cells[i].style.backgroundColor = '#ffffff'; } } } It is working as expected in IE. But coming to firefox i am surprised on seeing the output after so much of coding. In Firefox:-- onMouseOver is working as expected. color change of that particular row. onClick -- Setting the background color permenantly..eventhough i do onmouseover on different rows. the clicked row color is not reset to white. -- not as expected onclick on 2 rows..the background of both the rows is set...not as expected i.e if i click on all the rows..background color of everything is changed... Eventhough i click on the row. First column i.e radio button or checkbox is not set.. Please help me to solve this issue in firefox. Do let me know where my code needs to be changed... Thanks in advance!!

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • What is a custom collection?

    - by Win Coder
    A Group of objects. However i am having confusion in the following case. A sample class Class A { public string; } Class A_list { public A[] list; public A_list(A[] _list) { list = new A[_list.length]; for (int i = 0; i < _list.Length; i++) { list[i] = _list[i]; } } } static void Main(String[] args) { A[] names = new A[3] { new A("some"), new A("another"), new A("one"), }; A_list just_an_object = new A_list(names); } Which of the above is a custom collection the array or the object that holds array as a field or are both custom collections.

    Read the article

  • Vaadin: Downloaded file has whole path as file name

    - by javydreamercsw
    I have a download action implemented on my Vaadin application but for some reason the downloaded file has the original file's full path as the file name. Any idea? You can see the code on this post. Edit: Here's the important part of the code: package com.bluecubs.xinco.core.server.vaadin; import com.bluecubs.xinco.core.server.XincoConfigSingletonServer; import com.vaadin.Application; import com.vaadin.terminal.DownloadStream; import com.vaadin.terminal.FileResource; import java.io.*; import java.net.URLEncoder; import java.util.UUID; import java.util.logging.Level; import java.util.logging.Logger; import java.util.zip.CRC32; import java.util.zip.CheckedInputStream; /** * * @author Javier A. Ortiz Bultrón<[email protected]> */ public class FileDownloadResource extends FileResource { private final String fileName; private File download; private File newFile; public FileDownloadResource(File sourceFile, String fileName, Application application) { super(sourceFile, application); this.fileName = fileName; } protected void cleanup() { if (newFile != null && newFile.exists()) { newFile.delete(); } if (download != null && download.exists() && download.listFiles().length == 0) { download.delete(); } } @Override public DownloadStream getStream() { try { //Copy file to directory for downloading InputStream in = new CheckedInputStream(new FileInputStream(getSourceFile()), new CRC32()); download = new File(XincoConfigSingletonServer.getInstance().FileRepositoryPath + System.getProperty("file.separator") + UUID.randomUUID().toString()); newFile = new File(download.getAbsolutePath() + System.getProperty("file.separator") + fileName); download.mkdirs(); OutputStream out = new FileOutputStream(newFile); newFile.deleteOnExit(); download.deleteOnExit(); byte[] buf = new byte[1024]; int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } in.close(); out.close(); final DownloadStream ds = new DownloadStream( new FileInputStream(newFile), getMIMEType(), fileName); ds.setParameter("Content-Disposition", "attachment; filename=" + URLEncoder.encode(fileName, "utf-8")); ds.setCacheTime(getCacheTime()); return ds; } catch (final FileNotFoundException ex) { Logger.getLogger(FileDownloadResource.class.getName()).log(Level.SEVERE, null, ex); return null; } catch (IOException ex) { Logger.getLogger(FileDownloadResource.class.getName()).log(Level.SEVERE, null, ex); return null; } } } I already debugged and verified that fileName only contains the file's name not the whole path.

    Read the article

  • Hibernate save() and transaction rollback

    - by Marco
    Hi, In Hibernate when i save() an object in a transaction, and then i rollback it, the saved object still remains in the DB. It's strange because this issue doesn't happen with the update() or delete() method, just with save(). Here is the code i'm using: DbEntity dbEntity = getDbEntity(); HibernateUtil.beginTransaction(); Session session = HibernateUtil.getCurrentSession(); session.save(dbEntity); HibernateUtil.rollbackTransaction(); And here is the HibernateUtil class (just the involved functions, i guarantee the getSessionFactory() method works well - there is an Interceptor handler, but it doesn't matter now): private static final ThreadLocal<Session> threadSession = new ThreadLocal<Session>(); private static final ThreadLocal<Transaction> threadTransaction = new ThreadLocal<Transaction>(); /** * Retrieves the current Session local to the thread. * <p/> * If no Session is open, opens a new Session for the running thread. * * @return Session */ public static Session getCurrentSession() throws HibernateException { Session s = (Session) threadSession.get(); try { if (s == null) { log.debug("Opening new Session for this thread."); if (getInterceptor() != null) { log.debug("Using interceptor: " + getInterceptor().getClass()); s = getSessionFactory().openSession(getInterceptor()); } else { s = getSessionFactory().openSession(); } threadSession.set(s); } } catch (HibernateException ex) { throw new HibernateException(ex); } return s; } /** * Start a new database transaction. */ public static void beginTransaction() throws HibernateException { Transaction tx = (Transaction) threadTransaction.get(); try { if (tx == null) { log.debug("Starting new database transaction in this thread."); tx = getCurrentSession().beginTransaction(); threadTransaction.set(tx); } } catch (HibernateException ex) { throw new HibernateException(ex); } } /** * Rollback the database transaction. */ public static void rollbackTransaction() throws HibernateException { Transaction tx = (Transaction) threadTransaction.get(); try { threadTransaction.set(null); if ( tx != null && !tx.wasCommitted() && !tx.wasRolledBack() ) { log.debug("Tyring to rollback database transaction of this thread."); tx.rollback(); } } catch (HibernateException ex) { throw new HibernateException(ex); } finally { closeSession(); } } Thanks

    Read the article

  • How to reuse a dropdownlist each row of a table instead of rebuilding it.

    - by Praesagus
    I have a table the uses the same dropdown list in each row. I thought that I could just create one dropdown list and then reuse it in each new row, but the table only ends up with one row unless I create "new" dropdownlist. Am I approaching this all wrong? Thanks private void UserRoles() { Table table = MakeTable(); Ewo.sqlDataStore.Administrator sql = new Ewo.sqlDataStore.Administrator(); DataSet dataset =sql.SiteUserRoleList(); DropDownList sel = RoleList(dataset.Tables[0]); if(tools.validDataSet(dataset)) { if (dataset.Tables.Count > 1)//existing roles are #2, show the roles the user is part of { foreach (DataRow dRow in dataset.Tables[1].Rows) { table.Rows.Add(CreateRoleRow(Convert.ToString(dRow["SitePageGroupName"]), sel));//add a row with data } } table.Rows.Add(CreateRoleRow(sel));//add a blank row on the bottom } AdminSiteUerRoles.Controls.Add(table);//add it all to the page }

    Read the article

  • augment the factory pattern in java

    - by TP
    I am trying to use a factory pattern to create a QuestionTypeFactory where the instantiated classes will be like MultipleChoice, TrueFalseQuestion etc. The factory code looks something like this class QuestionFactory { public enum QuestionType { TrueFalse, MultipleChoice, Essay } public static Question createQuestion(QuestionType quesType) { switch (quesType) { case TrueFalse: return new TrueFalseQuestion(); case MultipleChoice: return new MultipleChoiceQuestion(); case Essay: return new EssayQuestion(); } throw new IllegalArgumentException("Not recognized."); } } This works ok for now. If I want to add another question type I will need to modify the factory class and I do not want to do that. How can I set it up so that each question class registers itself with the Factory so that when I add a new question type, I do not have to change the code for the factory? I am a bit new to java and am not sure how to do this.

    Read the article

  • MySQL - how long to create an index?

    - by user293594
    Can anyone tell me how adding a key scales in MySQL? I have 500,000,000 rows in a database, trans, with columns i (INT UNSIGNED), j (INT UNSIGNED), nu (DOUBLE), A (DOUBLE). I try to index a column, e.g. ALTER TABLE trans ADD KEY idx_A (A); and I wait. For a table of 14,000,000 rows it took about 2 minutes to execute on my MacBook Pro, but for the whole half a billion, it's taking 15hrs and counting. Am I doing something wrong, or am I just being naive about how indexing a database scales with the number of rows?

    Read the article

  • Comparing Values with newlines in Selenium IDE

    - by Zachary
    I am writing a Selenium test case using the IDE, and I have a that I want to verify is equal to the value I expect. The newlines in the box seem to be causing some trouble, as when I use the "verifyValue" command I get this: # [info] Executing: |verifyValue | organizationContainer.organization.defaultLegalText | This is some test legal text. I just did a new line. Hopefully these new lines will get preserved. | # [error] Actual value 'This is some test legal text. I just did a new line. Hopefully these new lines will get preserved.' did not match 'This is some test legal text. I just did a new line. Hopefully these new lines will get preserved. ' Is there a better way to compare strings in the Selenium IDE

    Read the article

  • shuffling array javascript

    - by Dennis Callanan
    <!doctype html> <html lang="en"> <head> <meta charset="utf=8" /> <title>Blackjack</title> <link rel="stylesheet" href="blackjack.css" /> <script type="text/javascript"> var H2 = 2; var S2 = 2; var D2 = 2; var C2 = 2; var H3 = 3; var S3 = 3; var D3 = 3; var C3 = 3; var deck = new Array(H2, S2, D2, C2, H3, S3, D3, C3); var new_deck = new Array(); var r; document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") for (r=0;r<deck.length;r++){ var randomindex = Math.floor(Math.random()*deck.length); new_deck.push(randomindex) deck.pop(randomindex) } document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") </script> </head> <body> </body> </html> Obviously this isn't the full Blackjack game here. It's just a test to see if shuffling the array works by printing the contents of both decks (arrays) before and after the shuffle. I'm only using 8 cards at the moment, 4 2's and 4 3's. What I am getting from this is: deck = 22223333 new deck = deck = 2222 new deck = 7502 What I'm hoping to get is: deck = 22223333 new deck = deck = new deck = 23232323 (or any of the 8 numbers, generated randomly) So it should be shuffling those 8 cards, what am I doing wrong? I'm only new to javascript but I've used some python before. I've done something similar in python and worked perfectly, but I'm not sure what's wrong here. Thanks for any answers in advance!!

    Read the article

  • What is the scope of JS variables in anonymous functions

    - by smorhaim
    Why does this code returns $products empty? If I test for $products inside the function it does show data... but once it finishes I can't seem to get the data. var $products = new Array(); connection.query($sql, function(err, rows, fields) { if (err) throw err; for(i=0; i< rows.length; i++) { $products[rows[i].source_identifier] = "xyz"; } }); connection.end(); console.log($products); // Shows empty.

    Read the article

  • Error : while creating a file.

    - by Harikrishna
    I am storing records of datatable to csv file with the help of the following code : // we'll use these to check for rows with nulls var columns = yourTable.Columns .Cast<DataColumn>(); using (var writer = new StreamWriter(yourPath)) { for (int i = 0; i < yourTable.Rows.Count; i++) { DataRow row = yourTable.Rows[i]; // check for any null cells if (columns.Any(column => row.IsNull(column))) continue; string[] textCells = row.ItemArray .Select(cell => cell.ToString()) // may need to pick a text qualifier here .ToArray(); // check for non-null but EMPTY cells if (textCells.Any(text => string.IsNullOrEmpty(text))) continue; writer.WriteLine(string.Join(",", textCells)); } } But I get the error like System.UnauthorizedAccessException was unhandled Message="Access to the path 'D:\\Harikrishna\\Monthly Reports' is denied." What can be the problem and solution ?

    Read the article

  • how to get group total in self refrenced data in data table ?

    - by Nikhil Vaghela
    I have three columns in my data table. 1) ProductID 2) ProductParentID 3) ProductTotal ProductID and ProductParentID are self refrencing columns where i can set parent child relationship and get child rows based on my relationship. Let us say i have following data Product1     Product11     Product12     Product13         Product131         Product132         Product133 Product2     Product21     Product22     Product23 Next to above hierarchy in Product total column what i want is total of each child rows and sum of those child rows product total should be rolled up to it parent product. E.g if Product 131 total is 10,Product 13 total is 15 and Product 133 total is 5 then the product 13 total should be 30. The logic should work for n number of self hierarchy. Is there any functionality in data table itself where i can achieve this without iterating through each row and do it manually ? Thanks.

    Read the article

  • Learning MVC - Maintaining model state

    - by GenericTypeTea
    First of all, I'm very new to MVC. Bought the books, but not got the T-Shirt yet. I've put together my first little application, but I'm looking at the way I'm maintaining my model and I don't think it looks right. My form contains the following: <% using (Html.BeginForm("Reconfigured", null, FormMethod.Post, new { id = "configurationForm" })) { %> <%= Html.DropDownList("selectedCompany", new SelectList(Model.Companies, Model.SelectedCompany), new { onchange = "$('#configurationForm').submit()" })%> <%= Html.DropDownList("selectedDepartment", new SelectList(Model.Departments, Model.SelectedDepartment), new { onchange = "$('#configurationForm').submit()" })%> <%=Html.TextArea("comment", Model.Comment) %> <%} %> My controller has the following: public ActionResult Index(string company, string department, string comment) { TestModel form = new TestModel(); form.Departments = _someRepository.GetList(); form.Companies = _someRepository.GetList(); form.Comment = comment; form.SelectedCompany = company; form.SelectedDepartment = department; return View(form); } [HttpPost] public ActionResult Reconfigured(string selectedCompany, string selectedDepartment, string comment) { return RedirectToAction("Index", new { company = selectedCompany, department = selectedDepartment, comment = comment}); } And finally, this is my route: routes.MapRoute( "Default", "{controller}/{company}/{department}", new { controller = "CompanyController", action = "Index", company="", department="" } ); Now, every time I change DropDownList value, all my values are maintained. I end up with a URL like the following after the Reconfigure action is called: http://localhost/Main/Index/Company/Sales?comment=Foo%20Bar Ideally I'd like the URL to remain as: http://localhost/Main/Index My routing object is probably wrong. This can't be the right way? It seems totally wrong to me as for each extra field I add, I have to add the property into the Index() method? I had a look at this answer where the form is passed through TempData. This is obviously an improvement, but it's not strongly typed? Is there a way to do something similar but have it strongly typed? This may be a simple-enough question, but the curse of 10 years of WinForms/WebForms makes this MVC malarky hard to get your head 'round.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Get the first and second objects from a list using LINQ

    - by Vahid
    I have a list of Person objects. How can I get the first and second Person objects that meet a certain criteria from List<Person> People using LINQ? Let's say here is the list I've got. How can I get the first and second persons that are over 18 that is James and Jodie. public class Person { public string Name; public int age; } var People = new List<Person> { new Person {Name = "Jack", Age = 15}, new Person {Name = "James" , Age = 19}, new Person {Name = "John" , Age = 14}, new Person {Name = "Jodie" , Age = 21}, new Person {Name = "Jessie" , Age = 19} }

    Read the article

  • PostgreSQL - disabling constraints

    - by azp74
    I have a table with approx 5 million rows which has a fk constraint referencing the primary key of another table (also approx 5 million rows). I need to delete about 75000 rows from both tables. I know that if I try doing this with the fk constraint enabled it's going to take an unacceptable amount of time. Coming from an Oracle background my first thought was to disable the constraint, do the delete & then reenable the constraint. PostGres appears to let me disable constraint triggers if I am a super user (I'm not, but I am logging in as the user that owns/created the objects) but that doesn't seem to be quite what I want. The other option is to drop the constraint and then reinstate it. I'm worried that rebuilding the constraint is going to take ages given the size of my tables. Any thoughts?

    Read the article

  • Qt Qbrush issue

    - by Solitaire
    What is the difference in the following code, QGraphicsScene * scence = new QGraphicsScene(); QBrush *brush = new QBrush((QColor(60,20,20))); scence->setBackgroundBrush(*brush); QGraphicsView *view = new QGraphicsView(); view->setScene(scence); //view->setBackgroundBrush(*brush); //view->setCacheMode(QGraphicsView::CacheBackground); view->showFullScreen(); gives black color background QGraphicsScene * scence = new QGraphicsScene(); QBrush *brush = new QBrush(); brush->setColor(QColor(60,20,20)); scence->setBackgroundBrush(*brush); QGraphicsView *view = new QGraphicsView(); view->setScene(scence); //view->setBackgroundBrush(*brush); //view->setCacheMode(QGraphicsView::CacheBackground); view->showFullScreen(); it gives nothing.

    Read the article

  • Can't find which row is causing conversion error

    - by Marwan
    I have the following table: CREATE TABLE [dbo].[Accounts1]( [AccountId] [nvarchar](50) NULL, [ExpiryDate] [nvarchar](50) NULL ) I am trying to convert nvarchar to datetime using this query: select convert(datetime, expirydate) from accounts I get this error: Conversion failed when converting datetime from character string. The status bar says "2390 rows". I go to rows 2390, 2391 and 2392. There is nothing wrong with the data there. I even try to convert those particular rows and it works. How can I find out which row(s) is causing the conversion error?

    Read the article

  • windows phone deserialization json

    - by user2042227
    I have a weird issue. so I am making a few calls in my app to a webservice, which replies with data. However I am using a token based login system, so the first time the user enters the app I get a token from the webservice to login for that specific user and that token returns only that users details. The problem I am having is when the user changes I need to make the calls again, to get the new user's details, but using visual studio's breakpoint debugging, it shows the new user's token making the call however the problem is when the json is getting deserialized, it is as if it still reads the old data and deserializes that, when I exit my app with the new user it works fine, so its as if it is reading cached values, but I have no idea how to clear it? I am sure the new calls are being made and the problem lies with the deserializing, but I have tried clearing the values before deserializing them again, however nothing works. am I missing something with the json deserializer, how van I clear its cached values? here I make the call and set it not to cache so it makes a new call everytime: client.Headers[HttpRequestHeader.CacheControl] = "no-cache"; var token_details = await client.DownloadStringTaskAsync(uri); and here I deserialize the result, it is at this section the old data gets shown, so the raw json being shown inside "token_details" is correct, only once I deserialize the token_details, it shows the wrong data. deserialized = JsonConvert.DeserializeObject(token_details); and the class I am deserializing into is a simple class nothing special happening here, I have even tried making the constructor so that it clears the values each time it gets called. public class test { public string status { get; set; } public string name{ get; set; } public string birthday{ get; set; } public string errorDes{ get; set; } public test() { status = ""; name= ""; birthday= ""; errorDes= ""; } } uri's before making the calls: {https://whatever.co.za/token/?code=BEBCg==&id=WP7&junk=121edcd5-ad4d-4185-bef0-22a4d27f2d0c} - old call "UBCg==" - old reply {https://whatever.co.za/token/?code=ABCg==&id=WP7&junk=56cc2285-a5b8-401e-be21-fec8259de6dd} - new call "UBCg==" - new response which is the same response as old call as you can see i did attach a new GUID everytime i make the call, but then the new uri is read before making the downloadstringtaskasync method call, but it returns with the old data

    Read the article

< Previous Page | 380 381 382 383 384 385 386 387 388 389 390 391  | Next Page >