Search Results

Search found 5628 results on 226 pages for 'ram kumar'.

Page 39/226 | < Previous Page | 35 36 37 38 39 40 41 42 43 44 45 46  | Next Page >

  • Android : SQL Lite insertion or create table issue

    - by Ram
    Team, can anyone please help me to understand what could be the problem in the below snippet of code? It fails after insertion 2 and insertion 3 debug statements I have the contentValues in the Array list, I am iterating the arraylist and inserting the content values in to the database. Log.d("database","before insertion 1 "); liteDatabase = this.openOrCreateDatabase("Sales", MODE_PRIVATE, null); Log.d("database","before insertion 2 "); liteDatabase .execSQL("Create table activity ( ActivityId VARCHAR,Created VARCHAR,AMTaps_X VARCHAR,AMTemperature_X VARCHAR,AccountId VARCHAR,AccountLocation VARCHAR,AccountName VARCHAR,Classification VARCHAR,ActivityType VARCHAR,COTaps_X VARCHAR,COTemperature_X VARCHAR,Comment VARCHAR,ContactWorkPhone VARCHAR,CreatedByName VARCHAR,DSCycleNo_X VARCHAR,DSRouteNo_X VARCHAR,DSSequenceNo_X VARCHAR,Description VARCHAR,HETaps_X VARCHAR,HETemperature_X VARCHAR,Pro_Setup VARCHAR,LastUpdated VARCHAR,LastUpdatedBy VARCHAR,Licensee VARCHAR,MUTaps_X VARCHAR,MUTemperature_X VARCHAR,Objective VARCHAR,OwnerFirstName VARCHAR,OwnerLastName VARCHAR,PhoneNumber VARCHAR,Planned VARCHAR,PlannedCleanActualDt_X VARCHAR,PlannedCleanReason_X VARCHAR,PrimaryOwnedBy VARCHAR,Pro_Name VARCHAR,ServiceRepTerritory_X VARCHAR,ServiceRep_X VARCHAR,Status VARCHAR,Type VARCHAR,HEINDSTapAuditDate VARCHAR,HEINEmployeeType VARCHAR)"); Log.d("database","before insertion 3 "); int counter = 0; int size = arrayList.size(); for (counter = 0; counter < size; counter++) { ContentValues contentValues = (ContentValues) arrayList .get(counter); liteDatabase.insert("activity", "activityInfo", contentValues); Log.d("database", "Database insertion is done"); } }

    Read the article

  • idle proccesses and high memory bad? uwsgi/django

    - by JimJimThe3rd
    I have a VPS with 256MB of ram. I'm running nginx, uwsgi and postgresql on Ubuntu 12.04 for a soon to be Django site. About 200MB of ram are being used despite the website not being active, the uwsgi processes seem to just be idling. Is this bad? I once heard that having a bunch of free memory isn't necessarily a good metric because it is possible that the memory in use can easily be freed up. I mean, it is possible that the server is storing commonly used "stuff" in case it is accessed but is more than happy to dump it if the ram is needed. But I'm really not sure, hence me asking this question. If it is bad I could set some of the application loading options for uwsgi like "cheap" or "idle" mode. Screenshot of my htop

    Read the article

  • Determining Performance Limits

    - by JeffV
    I have a number of windows processes that pass messages between them hat a high rate using tcp to local host. Aside from testing on actual hardware how can I assess what my hardware limit will be. These applications are not doing CPU intensive work, mostly decomposing and combining messages, scanning over them for special flag in the data etc.. The message size is typically 3k and the rate is typically ~10k messages per second. ~30MB per second between processing stages. There may be 10 or more stages depending. For this type of application, what should I look to for assessing performance? What do I look for in a server performance wise? I am currently running an XEON L5408 with 32 GB ram. But I am assuming cache is more important than actual ram size as I am barely touching the ram.

    Read the article

  • An Unexpected HTTP Error occurred during the API request in wordpress

    - by Ram Bhat
    Hey guys I get this error on my wordpress blog hosted on my server each time i search for plugins or try to upgrade wordpress and on the dashboard. I have tried changing the timeout from 5 to 30 in the http.php file in wp-includes. This did NOT help. My blog works perfectly fine. This problem is really annoying as I have to manuall copy plugins and themes and upgrades.

    Read the article

  • System.exit(0) in java

    - by Ram
    I am writing an application program in java. If i need to exit from the application can i use system.exit or should i use some other method, which is good practice. If calling system.exit is not good practice then tell the reason and tell the alternative way to exit from the application.

    Read the article

  • How to determine if an event is already subscribed

    - by Ram
    Hi, In my .NET application I am subscribing to events from another class. The subscription is conditional. I am subscribing to events when the control is visible and de-subscribing it when it become invisible. However in some conditions I do not want to de-subscribe the event even if the control is not visible as I want the result of an operation which is happening on background thread . Is there any way through which I can determine if a that class has already subscribed to that event. I know we can do it in the class which will raise that event by checking event with null but I don not know how to do it in a class which will subscribe to that event.

    Read the article

  • How do I figure out which SOC or SDK board to use?

    - by Ram Bhat
    Hey guys Basically I'm working on a model of an automated vacuum cleaner. I currently have made software simulation of the same. How do I figure out which SOC or SDK board to use for the hardware implementation? My code is mostly written in C. Will this be compatible with the sdk provided by board manufacturers? How do i know what clock speed,memory etc the hardware will need? I'm a software guy and have only basic knowledge about practical hardware implementations. Have some experience in programming the 8086 to carry out basic tasks.

    Read the article

  • Generics vs inheritance (whenh no collection classes are involved)

    - by Ram
    This is an extension of this questionand probably might even be a duplicate of some other question(If so, please forgive me). I see from MSDN that generics are usually used with collections The most common use for generic classes is with collections like linked lists, hash tables, stacks, queues, trees and so on where operations such as adding and removing items from the collection are performed in much the same way regardless of the type of data being stored. The examples I have seen also validate the above statement. Can someone give a valid use of generics in a real-life scenario which does not involve any collections ? Pedantically, I was thinking about making an example which does not involve collections public class Animal<T> { public void Speak() { Console.WriteLine("I am an Animal and my type is " + typeof(T).ToString()); } public void Eat() { //Eat food } } public class Dog { public void WhoAmI() { Console.WriteLine(this.GetType().ToString()); } } and "An Animal of type Dog" will be Animal<Dog> magic = new Animal<Dog>(); It is entirely possible to have Dog getting inherited from Animal (Assuming a non-generic version of Animal)Dog:Animal Therefore Dog is an Animal Another example I was thinking was a BankAccount. It can be BankAccount<Checking>,BankAccount<Savings>. This can very well be Checking:BankAccount and Savings:BankAccount. Are there any best practices to determine if we should go with generics or with inheritance ?

    Read the article

  • Update panel problem

    - by ram
    Here is my code: <body> <form id="form1" runat="server"> <div> <asp:ScriptManager ID="ScriptManager1" runat="server"> </asp:ScriptManager> <asp:UpdatePanel ID="UpdatePanel1" UpdateMode="Conditional" ChildrenAsTriggers="false" runat="server"> <ContentTemplate> <asp:Button ID="Button1" runat="server" Text="Click1" OnClick="Button1_Click" /> <br /> <br /> Last refresh <%=DateTime.Now.ToString() %> <br /> <br /> <asp:UpdatePanel ID="UpdatePanel2" UpdateMode="Conditional" ChildrenAsTriggers="true" runat="server"> <ContentTemplate> <asp:Button ID="Button2" runat="server" Text="Click2" OnClick="Button2_Click" /> <br /> <br /> Last refresh <%=DateTime.Now.ToString() %> <br /> <br /> </ContentTemplate> <Triggers> <asp:AsyncPostBackTrigger ControlID="Button2" EventName="Click" /> </Triggers> </asp:UpdatePanel> </ContentTemplate> <Triggers> <asp:AsyncPostBackTrigger ControlID="Button1" EventName="Click" /> </Triggers> </asp:UpdatePanel> </div> </form> </body> Im using two update panels here, when i click "Button2" then "UpdatePanel2" was refreshed, if i click "Button1" then both update panel were refreshed, but my need is if i click "Button1" then "UpdatePanel1" have to be refreshed. Thanks.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to trigger a postback using JQuery Droppable plugin ?

    - by Sandeep K Ram
    Hi, This is my script for the draggable and droppable <script type="text/javascript"> $(function() { $(".Source li").draggable({ appendTo: "body", helper: "clone", revert: "invalid" }); $(".Destination ").droppable({ activeClass: "ui-state-default", hoverClass: "ui-state-hover", accept: ".Source li", drop: function(event, ui) { $(this).find(".placeholder").remove(); $("#Hf1").val(ui.draggable.text()); $("#TxtItemId").val($("#Hf1").val()); } }); }); </script> Now I want to access the value of the "TxtItemId" control in the code-behind through a postback. How do I go about doing this ? BTW, this is for a scenario where a person will drag an item from a panel into a shopping cart and I need to capture the Id of the dropped item and trigger a postback after the drop to update the quantity of that item in the cart.

    Read the article

  • How to expose MEX when I need the service to have NTLM authentication

    - by Ram Amos
    I'm developing a WCF service that is RESTful and SOAP, now both of them needs to be with NTLM authentication. I also want to expose a MEX endpoint so that others can easily reference the service and work with it. Now when I set IIS to require windows authentication I can use the REST service and make calls to the service succesfully, but when I want to reference the service with SVCUTIL it throws an error that it requires to be anonymous. Here's my web.config: <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true"/> <bindings> <basicHttpBinding> <binding name="basicHttpBinding" maxReceivedMessageSize="214748563" maxBufferSize="214748563" maxBufferPoolSize="214748563"> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Ntlm"> </transport> </security> </binding> </basicHttpBinding> <webHttpBinding> <binding name="webHttpBinding" maxReceivedMessageSize="214748563" maxBufferSize="214748563" maxBufferPoolSize="214748563"> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Ntlm"> </transport> </security> </binding> </webHttpBinding> <mexHttpBinding> <binding name="mexHttpBinding"></binding> </mexHttpBinding> </bindings> <standardEndpoints> <webHttpEndpoint> <standardEndpoint name="" automaticFormatSelectionEnabled="true" helpEnabled="True"> </standardEndpoint> </webHttpEndpoint> </standardEndpoints> <services> <service name="Intel.ResourceScheduler.Service" behaviorConfiguration="Meta"> <clear /> <endpoint address="soap" name="SOAP" binding="basicHttpBinding" contract="Intel.ResourceScheduler.Service.IResourceSchedulerService" listenUriMode="Explicit" /> <endpoint address="" name="rest" binding="webHttpBinding" behaviorConfiguration="REST" contract="Intel.ResourceScheduler.Service.IResourceSchedulerService" /> <endpoint address="mex" name="mex" binding="mexHttpBinding" behaviorConfiguration="" contract="IMetadataExchange" /> </service> </services> <behaviors> <endpointBehaviors> <behavior name="REST"> <webHttp /> </behavior> <behavior name="WCFBehavior"> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> </endpointBehaviors> <serviceBehaviors> <behavior name="Meta"> <serviceMetadata httpGetEnabled="true"/> </behavior> <behavior name="REST"> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> <behavior name="WCFBehavior"> <serviceMetadata httpGetEnabled="true"/> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> <behavior name=""> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="false" /> </behavior> </serviceBehaviors> </behaviors> Any help will be appreciated.

    Read the article

  • Most optimal order (of joins) for left join

    - by Ram
    I have 3 tables Table1 (with 1020690 records), Table2(with 289425 records), Table 3(with 83692 records).I have something like this SELECT * FROM Table1 T1 /* OK fine select * is bad when not all columns are needed, this is just an example*/ LEFT JOIN Table2 T2 ON T1.id=T2.id LEFT JOIN Table3 T3 ON T1.id=T3.id and a query like this SELECT * FROM Table1 T1 LEFT JOIN Table3 T3 ON T1.id=T3.id LEFT JOIN Table2 T2 ON T1.id=T2.id The query plan shows me that it uses 2 Merge Join for both the joins. For the first query, the first merge is with T1 and T2 and then with T3. For the second query, the first merge is with T1 and T3 and then with T2. Both these queries take about the same time(40 seconds approx.) or sometimes Query1 takes couple of seconds longer. So my question is, does the join order matter ?

    Read the article

  • Search in multiple xml files

    - by Ram
    I have a windows Xp Sp2 system where the windows explorer search is not able to find the text in xml files. Is there some setting that enable the search in xml files? It finds in text in text / doc files in the same folder.

    Read the article

  • How to improve performance

    - by Ram
    Hi, In one of mine applications I am dealing with graphics objects. I am using open source GPC library to clip/merge two shapes. To improve accuracy I am sampling (adding multiple points between two edges) existing shapes. But before displaying back the merged shape I need to remove all the points between two edges. But I am not able to find an efficient algorithm that will remove all points between two edges which has same slope with minimum CPU utilization. Currently all points are of type PointF Any pointer on this will be a great help.

    Read the article

  • What is a good motherboard for the Intel i7 series processor?

    - by jasondavis
    I am lost on choosing a good miotherboard at a decent price for my Intel i7-930 CPU. I have read bad things about all of them so far. Issues with RAM not working correctly, Windows not loading with USB keyboards plugged in and all kinds of nightmare stories. Here is my needs. - 6g/b SATA 3 - USB 3.0 - Cheaper is better - Support for up to 24gb of RAM, I will start out with only 12gb though - I will use 64bit v. of Windows 7 so the 4gb RAM limit should not be a problem from my OS - Should be able to boot even if I have a USB keyboard plugged in. If you have experience with a motherboard that meets these specs, please do tell about it. I appreciate any help, I am stuck right now on picking a good board.

    Read the article

  • android : customer List Adatper + ArrayList

    - by Ram
    Team, Could you please help me debug the issue? ActivityAdapter activityAdapter = new ActivityAdapter(this,activityList); Log.d("list", "List Display - 1"); setListAdapter( activityAdapter ); Log.d("List", "list done"); It's throwing exception at the time of setListAdapter, 05-01 16:59:15.996: WARN/dalvikvm(251): threadid=3: thread exiting with uncaught exception (group=0x4001b188) 05-01 16:59:15.996: ERROR/AndroidRuntime(251): Uncaught handler: thread main exiting due to uncaught exception 05-01 16:59:16.204: ERROR/AndroidRuntime(251): java.lang.RuntimeException: Unable to start activity ComponentInfo{com.antennasoftware.xml/com.antennasoftware.xml.XMLParsing}: java.lang.RuntimeException: Your content must have a ListView whose id attribute is 'android.R.id.list' 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2454) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2470) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.ActivityThread.access$2200(ActivityThread.java:119) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1821) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.os.Handler.dispatchMessage(Handler.java:99) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.os.Looper.loop(Looper.java:123) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.ActivityThread.main(ActivityThread.java:4310) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at java.lang.reflect.Method.invokeNative(Native Method) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at java.lang.reflect.Method.invoke(Method.java:521) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at dalvik.system.NativeStart.main(Native Method) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): Caused by: java.lang.RuntimeException: Your content must have a ListView whose id attribute is 'android.R.id.list' 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.ListActivity.onContentChanged(ListActivity.java:236) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at com.android.internal.policy.impl.PhoneWindow.setContentView(PhoneWindow.java:201) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.Activity.setContentView(Activity.java:1622) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at com.antennasoftware.xml.XMLParsing.onCreate(XMLParsing.java:36) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2417) 05-01 16:59:16.204: ERROR/AndroidRuntime(251): ... 11 more Thanks in advance

    Read the article

  • How does an OS communicate with other hardware components?

    - by Jack
    How can a program running on a CPU (mostly OS) access other PC hardware? Such as Graphic card, HDD and so? From what I read, in DOS, this was done using BIOS calls, specifically the INT instruction. But, the INT instruction should only jump to the certain space in RAM. So how can some program stored in RAM access other computer hardware, when the CPU can only access RAM, and receive interrupts? Does Windows use INT instructions as well, or is there a new way to communicate with the hardware?

    Read the article

< Previous Page | 35 36 37 38 39 40 41 42 43 44 45 46  | Next Page >