Search Results

Search found 36874 results on 1475 pages for 'string comparison'.

Page 394/1475 | < Previous Page | 390 391 392 393 394 395 396 397 398 399 400 401  | Next Page >

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • QT vs. Net - REAL comparisons for R.A.D. projects

    - by Pirate for Profit
    Man in all these Qt vs. .NET discussions 90% these people argue about the dumbest crap. Trying to get a real comparison chart here, because I know a little about both frameworks but I don't know everything. I believe Qt and .NET both have strengths and weaknesses. This is to make a comparison that highlights these so people can make more informed decisions before embarking on a project, in the spirit of R.A.D. Event Handling In Qt the event handling system is very simple. You just emit signals when something cool happens and then catch them in slots. ie. // run some calculations, then emit valueChanged(30, false, 20.2); and then catching it, any object can make a slot to recieve that message easily void MyObj::valueChanged(int percent, bool ok, float timeRemaining). It's easy to "block" an event or "disconnect" when needed, and works seamlessly across threads... once you get the hang of it, it just seems a lot more natural and intuitive than the way the .NET event handling is set up (you know, void valueChanged(object sender, CustomEventArgs e). And I'm not just talking about syntax, because in the end the .NET anonymous delegates are the bomb. I'm also talking about in more than just reflection (because, yes, .NET obviously has much stronger reflection capabilities). I'm talking about in the way the system feels to a human being. Qt wins hands down for the simplest yet still flexible event handling system ever i m o. Plugins and such I do love some of the ease of C# compared to C++, as well as .NET's assembly architecture, even though it leads to a bunch of .dll's (there's ways to combine everything into a single exe though). That is a big bonus for modular projects, which are a PITA to import stuff in C++ as far as RAD is concerned. Database Ease of Doing Crap Also what about datasets and database manipulations. I think .net wins here but I'm not sure. Threading/Conccurency How do you guys think of the threading? In .NET, all I've ever done is make like a list of master worker threads with locks. I like QConcurrentFramework, you don't worry about locks or anything, and with the ease of the signal slot system across threads it's nice to get notified about the progress of things. QConcurrent is the simplest threading mechanism I've ever played with. Memory Usage Also what do you think of the overall memory usage comparison. Is the .NET garbage collector pretty on the ball and quick compared to the instantaneous nature of native memory management? Or does it just let programs leak up a storm and lag the computer then clean it up when it's about to really lag? Doesn't the just-in-time compiler make native code that is pretty good, like and that only happens the first time the program is run? However, I am a n00b who doesn't know what I'm talking about, please school me on the subject.

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • JBoss Portals and e-commerce

    - by Fireworks
    I have a requirement to build branded e-commerce sites that have their own urls but are on the same installation. I've been looking at DNN, and Jboss portals as well as the new GateIn collaboration between Jboss portals and Exo. I really like what I see in comparison to DNN, which looks a bit rough in comparison but I haven't seen anything with respect to Jboss portals ecommerce. What has been peoples experience with using the Jboss portals or GateIn etc, for branded portals or using Jboss for selling? UPDATE: cost is an issue.

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What are the best tools for Sql Server version control

    - by Mendy
    After reading this post, and the suggestion to use Team Edition for Database Professionals, I want to know is there any equivalent to this for SQL server 2008 / Visual stuio 2010 ultimate. I'm looking for tool need to do all the thing that Jeff mention in his article: Create test data. Schema comparison. Data comparison. Database unit testing. Refactoring. Integrated T-SQL editor, a first class language construct in the IDE, just like C# and VB.NET.

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • Problem evaluating NULL in an IIF statement (Access)

    - by Mohgeroth
    Item in the recordset rstImportData("Flat Size") is = Null With that, given the following statement: IIF(IsNull(rstImportData("Flat Size")), Null, cstr(rstImportData("Flat Size"))) Result: Throws error 94: Invalid use of Null If I change the statement by removing the type conversion upon a false comparison: IIF(IsNull(rstImportData("Flat Size")), Null, 0) Result: Null It returns Null as it should have the first time. It appears that I cannot do a type conversion in an IIF if the value passed in should ever be null even if it passes an IIF test, it still attempts to evaluate it at both the true and false answer. The only reason I'm using IIF like this is because I have a 25 line comparison to compare data from an Import against a matching record in a database to see if I need to append the prior to history. Any thoughts? The way data is imported there will be null dates and where the spreadsheet import is in a string format I must convert either side to the other to compare the values properly but if either side is null this exception occurs :(

    Read the article

  • Returning references while using shared_ptrs

    - by Goose Bumper
    Suppose I have a rather large class Matrix, and I've overloaded operator== to check for equality like so: bool operator==(Matrix &a, Matrix &b); Of course I'm passing the Matrix objects by reference because they are so large. Now i have a method Matrix::inverse() that returns a new Matrix object. Now I want to use the inverse directly in a comparison, like so: if (a.inverse()==b) { ... }` The problem is, this means the inverse method needs to return a reference to a Matrix object. Two questions: Since I'm just using that reference in this once comparison, is this a memory leak? What happens if the object-to-be-returned in the inverse() method belongs to a boost::shared_ptr? As soon as the method exits, the shared_ptr is destroyed and the object is no longer valid. Is there a way to return a reference to an object that belongs to a shared_ptr?

    Read the article

  • Merging MySQL Structure and Data

    - by Shahid
    I have a MySQL database running on a deployment machine which also contains data. Then I have another MySQL database which has evolved in terms of STRUCTURE + DATA for some time. I need a way to merge the changes (ONLY) for both structure and data to the DB in deployment machine without disturbing the existing data. Does anyone know of a tool available which can do this safely. I have had a look at a few comparison tools but I need a tool which can automate the merge operation. Note also that most of the data in the tables is in BINARY so I can't use many file comparison tools. Does any one know of a solution to this? thanks

    Read the article

  • Direct comparator in Java out of the box

    - by KARASZI István
    I have a method which needs a Comparator for one of its parameters. I would like to pass a Comparator which does a normal comparison and a reverse comparator which does in reverse. java.util.Collections provides a reverseOrder() this is good for the reverse comparison, but I could not find any normal Comparator. The only solution what came into my mind is Collections.reverseOrder(Collections.reverseOrder()). but I don't like it because the double method calling inside. Of course I could write a NormalComparator like this: public class NormalComparator<T extends Comparable> implements Comparator<T> { public int compare(T o1, T o2) { return o1.compareTo(o2); } } But I'm really surprised that Java doesn't have a solution for this out of the box.

    Read the article

  • Interesting AS3 hash situation. Is it really using strict equality as the documentation says?

    - by Triynko
    AS3 Code: import flash.utils.Dictionary; var num1:Number = Number.NaN; var num2:Number = Math.sqrt(-1); var dic:Dictionary = new Dictionary( true ); trace(num1); //NaN trace(num2); //NaN dic[num1] = "A"; trace( num1 == num2 ); //false trace( num1 === num2 ); //false trace( dic[num1] ); //A trace( dic[num2] ); //A Concerning the key comparison method... "The Dictionary class lets you create a dynamic collection of properties, which uses strict equality (===) for key comparison. When an object is used as a key, the object's identity is used to look up the object, and not the value returned from calling toString() on it." If Dictionary uses strict equality, as the documentation states, then how is it that num1 === num2 is false, and yet dic[num1] resolves to the same hash slot as dic[num2]?

    Read the article

  • How to store and compare time-zone sensitive times

    - by Chad Moran
    I have a data structure where an entity has times stored as an int (minutes into the day) for fast comparison. The entity also has a Foreign Key reference back to a TimeZone table which contains the .NET CLR ID Name and it's Standard Time/Daylight Time acronyms. Since this information is stored as time-zone insensitive - I was wondering how in LINQ to SQL I could convert this into a UTC DateTime for comparison against other times that will be in UTC. Just to be clear this conversion has to be done server-side so that I can execute filtering on the SQL Server and not the client. I am using .NET 3.5 SP1 and SQL Server 2008.

    Read the article

  • Check for state change in objects using serialization?

    - by sev7n
    I have a form that is bind to an object, and when the user trying to leave the form, I want to warn them if anything on the form has been changed, and prompt them to save. My question is, is there any way to achieve this without implementing IComparar for all my classes in the binded object? I was thinking if there is a way I can serialize my object when loading the form, and do a simple comparison against the change object that also get serialized. Something like a string comparison. Hope that make sense, Thanks

    Read the article

  • Is a safe accumulator really this complicated?

    - by Martin
    I'm trying to write an accumulator that is well behaved given unconstrained inputs. This seems to not be trivial and requires some pretty strict planning. Is it really this hard? int naive_accumulator(unsigned int max, unsigned int *accumulator, unsigned int amount) { if(*accumulator + amount >= max) return 1; // could overflow *accumulator += max; // could overflow return 0; } int safe_accumulator(unsigned int max, unsigned int *accumulator, unsigned int amount) { // if amount >= max, then certainly *accumulator + amount >= max if(amount >= max) { return 1; } // based on the comparison above, max - amount is defined // but *accumulator + amount might not be if(*accumulator >= max - amount) { return 1; } // based on the comparison above, *accumulator + amount is defined // and *accumulator + amount < max *accumulator += amount; return 0; }

    Read the article

  • What is the 'noreq' Filter Type an Alias for?

    - by Alan Storm
    I'm looking in to Magento's filtering options (Ecommerce System and PHP Framekwork with an expansive ORM system). Specifically the addFieldToFilter method. In this method, you specify a SQLish filter by passing in a single element array, with the key indicating the type of filter. For example, array('eq'=>'bar') //eq means equal array('neq'=>'bar') //neq means not equal would each give you a where clause that looks like where field = 'bar'; where field != 'bar'; So, deep in the bowels of the source, I found a comparison type named 'moreq' that maps to a = comparison operator array('moreq'=>'27') where field >= 27 The weird thing is, there's already a 'gteq' comparision type array('gteq'=>'27') where field >= 27 So, my question is, what does moreq stand for? Is is some special SQL concept that's supported in other databases that the Magento guys wants to map to MySQL, or is it just "more required" and an example what happens when you're doing rapid agile and trying to maintain backwards compatibility.

    Read the article

  • Optimality of Binary Search

    - by templatetypedef
    Hello all- This may be a silly question, but does anyone know of a proof that binary search is asymptotically optimal? That is, if we are given a sorted list of elements where the only permitted operation on those objects is a comparison, how do you prove that the search can't be done in o(lg n)? (That's little-o of lg n, by the way.) Note that I'm restricting this to elements where the only operation permitted operation is a comparison, since there are well-known algorithms that can beat O(lg n) on expectation if you're allowed to do more complex operations on the data (see, for example, interpolation search). Thanks so much! This has really been bugging me since it seems like it should be simple but has managed to resist all my best efforts. :-)

    Read the article

  • Auto not being recognised by the compiler, what would be the best replacement?

    - by user1719605
    So I have wrote a program that uses auto however the compiler doesn't seem to recognize it, probably it is an earlier compiler. I was wondering for my code, with are suitable variables to fix my code so that I do not need to use the auto keyword? I'm thinking a pointer to a string? or a string iterator, though I am not sure. #include <cstdlib> #include <string> #include <iostream> #include <unistd.h> #include <algorithm> using namespace std; int main(int argc, char* argv[]) { enum MODE { WHOLE, PREFIX, SUFFIX, ANYWHERE, EMBEDDED } mode = WHOLE; bool reverse_match = false; int c; while ((c = getopt(argc, argv, ":wpsaev")) != -1) { switch (c) { case 'w': // pattern matches whole word mode = WHOLE; break; case 'p': // pattern matches prefix mode = PREFIX; break; case 'a': // pattern matches anywhere mode = ANYWHERE; break; case 's': // pattern matches suffix mode = SUFFIX; break; case 'e': // pattern matches anywhere mode = EMBEDDED; break; case 'v': // reverse sense of match reverse_match = true; break; } } argc -= optind; argv += optind; string pattern = argv[0]; string word; int matches = 0; while (cin >> word) { switch (mode) { case WHOLE: if (reverse_match) { if (pattern != word) { matches += 1; cout << word << endl; } } else if (pattern == word) { matches += 1; cout << word << endl; } break; case PREFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.begin(), pattern.end(), word.begin()); if (reverse_match) { if (res.first != word.end()) { matches += 1; cout << word << endl; } } else if (res.first == word.end()) { matches += 1; cout << word << endl; } } break; case ANYWHERE: if (reverse_match) { if (!word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } } else if (word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } break; case SUFFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.rbegin(), pattern.rend(), word.rbegin()); if (reverse_match) { if (res.first != word.rend()) { matches = +1; cout << word << endl; } } else if (res.first == word.rend()) { matches = +1; cout << word << endl; } } break; case EMBEDDED: if (reverse_match) { if (!pattern.find(word) != string::npos) { matches += 1; cout << word << endl;} } else if (pattern.find(word) != string::npos) { matches += 1; cout << word << endl; } break; } } return (matches == 0) ? 1 : 0; } Thanks in advance!

    Read the article

  • Is the "==" operator required to be defined to use std::find

    - by user144182
    Let's say I have: class myClass std::list<myClass> myList where myClass does not define the == operator and only consists of public fields. In both VS2010 and VS2005 the following does not compile: myClass myClassVal = myList.front(); std::find( myList.begin(), myList.end(), myClassVal ) complaining about lack of == operator. I naively assumed it would do a value comparison of the myClass object's public members, but I am almost positive this is not correct. I assume if I define a == operator or perhaps use a functor instead, it will solve the problem. Alternatively, if my list was holding pointers instead of values, the comparison would work. Is this right or should I be doing something else?

    Read the article

< Previous Page | 390 391 392 393 394 395 396 397 398 399 400 401  | Next Page >