Search Results

Search found 31360 results on 1255 pages for 'virtual address space'.

Page 412/1255 | < Previous Page | 408 409 410 411 412 413 414 415 416 417 418 419  | Next Page >

  • compiler warning at C++ template base class

    - by eike
    I get a compiler warning, that I don't understand in that context, when I compile the "Child.cpp" from the following code. (Don't wonder: I stripped off my class declarations to the bare minuum, so the content will not make much sense, but you will see the problem quicker). I get the warning with VS2003 and VS2008 on the highest warning level. The code AbstractClass.h : #include <iostream> template<typename T> class AbstractClass { public: virtual void Cancel(); // { std::cout << "Abstract Cancel" << std::endl; }; virtual void Process() = 0; }; //outside definition. if I comment out this and take the inline //definition like above (currently commented out), I don't get //a compiler warning template<typename T> void AbstractClass<T>::Cancel() { std::cout << "Abstract Cancel" << std::endl; } Child.h : #include "AbstractClass.h" class Child : public AbstractClass<int> { public: virtual void Process(); }; Child.cpp : #include "Child.h" #include <iostream> void Child::Process() { std::cout << "Process" << std::endl; } The warning The class "Child" is derived from "AbstractClass". In "AbstractClass" there's the public method "AbstractClass::Cancel()". If I define the method outside of the class body (like in the code you see), I get the compiler warning... AbstractClass.h(7) : warning C4505: 'AbstractClass::Cancel' : unreferenced local function has been removed with [T=int] ...when I compile "Child.cpp". I do not understand this, because this is a public function and the compiler can't know if I later reference this method or not. And, in the end, I reference this method, because I call it in main.cpp and despite this compiler warning, this method works if I compile and link all files and execute the program: //main.cpp #include <iostream> #include "Child.h" int main() { Child child; child.Cancel(); //works, despite the warning } If I do define the Cancel() function as inline (you see it as out commented code in AbstractClass.h), then I don't get the compiler warning. Of course my program works, but I want to understand this warning or is this just a compiler mistake? Furthermore, if do not implement AbsctractClass as a template class (just for a test purpose in this case) I also don't get the compiler warning...?

    Read the article

  • Pros and cons of ways of storing an unsigned int without an unsigned int data type

    - by fields
    I have values that are 64-bit unsigned ints, and I need to store them in mongodb, which has no unsigned int type. I see three main possibilities for storing them in other field types, and converting on going in and out: Using a signed int is probably easiest and most space efficient, but has the disadvantage that they're not human readable and if someone forgets to do the conversion, some of them will work, which may obscure errors. Raw binary is probably most difficult for inexperienced programmers to deal with, and also suffers from non-human-readability. A string representation is the least space efficient (~40 bytes in unicode vs 8 bytes per field), but then at least all of the possible values will map properly, and for querying only a conversion to string is required instead of a more complicated conversion. I need these values to be available from different platforms, so a single driver-specific solution isn't an option. Any major pros and cons I've missed? Which one would you use?

    Read the article

  • APS.NET MVC Ajax: Passing a IList from the View to the Controller

    - by Bpimenta
    I need to pass the grid rows from the view to the controller using POST. The idea is to pass an IList of objects (people) that have the following structure: String Name String Address String ID I want to read the data from the JQGrid and pass it to the controller to fill the IList. I'm trying to build the data object to pass through the Ajax data parameter. Here is the Javascript code: $("#saveButton").click( function() { var returnData = '{'; var existingIDs = $('#listPeople').getDataIDs(); if (idsPeople.length > 0) { for (i=0;i<idsPeople.length;i++) { //Trying to build the obejct data ret = ret + '"people['+ i +'].Name":' $('#listPeople').getRowData(idsPeople[i]).Name + ','; ret = ret + '"people['+ i +'].Address":' $('#listPeople').getRowData(idsPeople[i]).Address+ ','; ret = ret + '"people['+ i +'].Id":' $('#listPeople').getRowData(idsPeople[i]).Id+ ','; //If it has more than one element if (idsPeople.length>1 && (i+1)<idsPeople.length) { ret = ret + ','; } } } ret = ret + '}'; My Ajax function for sending: var url_all = '<%=Url.Action("SaveData") %>; $.ajax({ type: "POST", url: url_all, data: ret, dataType: "json", success: function(){ alert("OK"); }, error: function(){ alert("Error: check SaveData"); } }); My controller: public ActionResult SaveData(IList<PeopleHeader> people){ // using debug to know if "people" variable has any values return Json(true); } The problem I'm getting is an error: "System.NotSupportedException: Fixed size collection", and no data is being delivered. I think my problem relies on creating the object... is there any simpler way of doing this procedure? Thanks in advance,

    Read the article

  • Enabling full documentation for J2EE in eclipse

    - by maayank
    I'm new to Eclipse and am using it currently to play with J2EE. When using Ctrl+Space for types/functions from the regular Java libraries I get a full description (i.e. general description of the type, what are the arguments of the method for, etc.). However I don't get the same for J2EE types. For example, when using Ctrl+Space on methods of the HttpSession class I get only names like "arg0" or "obj" and no description. Is there some kind of a package I can install to remedy this?

    Read the article

  • ffmpeg screen capture

    - by Mirai
    I wrote this script for some basic screen capture; it gets the window dimensions then uses the ffmpeg binary to record. I suspect there is a better way (maybe with the ffmpeg library), but scripting is what I know and ffmpeg generally works. Any software (other than recordmydesktop), or improvements to the script are welcome. info=`xwininfo -frame` H=`echo "$info" | grep Height | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` W=`echo "$info" | grep Width | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` offset=:0.0+`echo "$info" | grep Corners | sed -E "s/^.*:[[:space:]]+\+([[:digit:]]+\+[[:digit:]]+)[[:space:]]+.+/\1/" | tr + ,` /usr/local/bin/ffmpeg -f x11grab -s ${W}x${H} -r 45 -i $offset -sameq -f avi ~/videos/`date +%Y-%m-%d-%H%M%s`_vid & echo $! > /tmp/$(basename $0)-$USER

    Read the article

  • Doubts in System call mechanism in linux

    - by bala1486
    We transit from ring3 to ring0 using 'int' or the new 'syscall/sysenter' instruction. Does that mean that the page tables and other stuffs that needs to be modified for the kernel is automatically done by the 'int' instruction or the interrupt handler for the 'int 0x80' will do the required stuff and jump to the respective system call. Also when returning from a system call, we again need to go to user space. For this we need to know the instruction address in the user space to continue the user application. Where is that address stored. Does the 'ret' instruction automatically changes the ring from ring3 to ring0 or where/how this ring changing mechanism takes place? Then, i read that changing from ring3 to ring0 is not as costly as changing from ring0 to ring3. Why is this so?? Thanks, Bala

    Read the article

  • Oracle Hash Cluster Overflow Blocks

    - by Andrew
    When inserting a large number of rows into a single table hash cluster in Oracle, it will fill up the block with any values that hash to that hash-value and then start using overflow blocks. These overflow blocks are listed as chained off the main block, but I can not find detailed information on the way in which they are allocated or chained. When an overflow block is allocated for a hash value, is that block exclusively allocated to that hash value, or are the overflow blocks used as a pool and different hash values can then start using the same overflow block. How is the free space of the chain monitored - in that, as data is continued to be inserted, does it have to traverse the entire chain to find out if it has some free space in the current overflow chain, and then if it finds none, it then chooses to allocate a new block?

    Read the article

  • Implementing ma? osx loop device driver.

    - by Inso Reiges
    Hello, I am aware that there is a native implementation of loop device system on osx, the hdiutil/hdix driver. But due to a number of reasons i need to roll out my own custom loop driver. Since hdix is closed-source can anyone give some starting pointers, links, advises, etc. on the subject? I had expirience implementing loop drivers on linux and windows but i don't really have a clue where to start from on osx. The basic functionality i need to implement is the same: given any file on disk, simulate a virtual block device interface for it. I also would like my loop driver to use all the native partition filter stacking available for real and hdix virtual block devices on osx.

    Read the article

  • parsing string off a configuration using strtok in C

    - by Jessica
    in the configuration file i have entries similar to this one: filepath = c:\Program Files\some value Where the path can contain spaces and there are no quotes on that string. I tried parsing this with strtok like: char *option; char *value; value = strtok(line, " ="); strcpy(option, value); value = strtok(NULL, " ="); where line is the line I am reading from the file, option will contain the left side of the equal (filepath) and value will contain the right side (c:\program files\some value). I know, it's poor coding, but I haven't found something better. sorry... In any case, for those options where there's no space in the right side it works great, but in those containing spaces it only return the string until the 1st space: c:\Program. Is there any other way to do this? Code is appreciated. Jessica

    Read the article

  • HTML Agility Pack

    - by Harikrishna
    I have html tables in one webpage like <table border=1> <tr><td>sno</td><td>sname</td></tr> <tr><td>111</td><td>abcde</td></tr> <tr><td>213</td><td>ejkll</td></tr> </table> <table border=1> <tr><td>adress</td><td>phoneno</td><td>note</td></tr> <tr><td>asdlkj</td><td>121510</td><td>none</td></tr> <tr><td>asdlkj</td><td>214545</td><td>none</td></tr> </table> Now from this webpage using html agility pack I want to extract the data of the column address and phone no only. It means for that I have find first in which table there is column address and phoneno.After finding that table I want to extract the data of that column address and phoneno what should I do ? I can get the table. But after that what should I do don't understand.

    Read the article

  • C++ type-checking at compile-time

    - by Masterofpsi
    Hi, all. I'm pretty new to C++, and I'm writing a small library (mostly for my own projects) in C++. In the process of designing a type hierarchy, I've run into the problem of defining the assignment operator. I've taken the basic approach that was eventually reached in this article, which is that for every class MyClass in a hierarchy derived from a class Base you define two assignment operators like so: class MyClass: public Base { public: MyClass& operator =(MyClass const& rhs); virtual MyClass& operator =(Base const& rhs); }; // automatically gets defined, so we make it call the virtual function below MyClass& MyClass::operator =(MyClass const& rhs); { return (*this = static_cast<Base const&>(rhs)); } MyClass& MyClass::operator =(Base const& rhs); { assert(typeid(rhs) == typeid(*this)); // assigning to different types is a logical error MyClass const& casted_rhs = dynamic_cast<MyClass const&>(rhs); try { // allocate new variables Base::operator =(rhs); } catch(...) { // delete the allocated variables throw; } // assign to member variables } The part I'm concerned with is the assertion for type equality. Since I'm writing a library, where assertions will presumably be compiled out of the final result, this has led me to go with a scheme that looks more like this: class MyClass: public Base { public: operator =(MyClass const& rhs); // etc virtual inline MyClass& operator =(Base const& rhs) { assert(typeid(rhs) == typeid(*this)); return this->set(static_cast<Base const&>(rhs)); } private: MyClass& set(Base const& rhs); // same basic thing }; But I've been wondering if I could check the types at compile-time. I looked into Boost.TypeTraits, and I came close by doing BOOST_MPL_ASSERT((boost::is_same<BOOST_TYPEOF(*this), BOOST_TYPEOF(rhs)>));, but since rhs is declared as a reference to the parent class and not the derived class, it choked. Now that I think about it, my reasoning seems silly -- I was hoping that since the function was inline, it would be able to check the actual parameters themselves, but of course the preprocessor always gets run before the compiler. But I was wondering if anyone knew of any other way I could enforce this kind of check at compile-time.

    Read the article

  • Looking for some thoughts on an image printing app

    - by Alex
    Hey All, Im looking for thoughts/advice. I have an upcoming project (all .net) that will require the following: pulls data once a day from an online service provider based on certain criteria. saves data locally for reference and reporting the data thats pulled will be used to create gift cards. So after the data is loaded, a process will run to generate "virtual cards" and send them to a network printer. Once printed, the system will updated the local data recording a successful or failed print. My initial thought was to create a windows service to pull the data...but then I couldnt decide how I was going to put a "virtual card" together and get it to print. Then I considered doing it as a WPF app. I figure that will give me access to the graphics and printing ability. Maybe neither of these are the right direction....Any ideas or thoughts would be greatly appreciated. Alex

    Read the article

  • FluentNhibernate many-to-many mapping - resolving record is not inserted

    - by Dmitriy Nagirnyak
    Hi, I have a many-to-many mapping defined (only relevant fields included): // MODEL: public class User : IPersistentObject { public User() { Permissions = new HashedSet<Permission>(); } public virtual int Id { get; protected set; } public virtual ISet<Permission> Permissions { get; set; } } public class Permission : IPersistentObject { public Permission() { } public virtual int Id { get; set; } } // MAPPING: public class UserMap : ClassMap<User> { public UserMap() { Id(x => x.Id); HasManyToMany(x => x.Permissions).Cascade.All().AsSet(); } } public class PermissionMap : ClassMap<Permission> { public PermissionMap() { Id(x => x.Id).GeneratedBy.Assigned(); Map(x => x.Description); } } The following test fails as there is no record inserted into User_Permission table: [Test] public void AddingANewUserPrivilegeShouldSaveIt() { var p1 = new Permission { Id = 123, Description = "p1" }; Session.Save(p1); var u = new User { Email = "[email protected]" }; u.Permissions.Add(p1); Session.Save(u); var userId = u.Id; Session.Evict(u); Session.Get<User>(userId).Permissions.Should().Not.Be.Empty(); } The SQL executed is (SQLite): INSERT INTO "Permission" (Description, Id) VALUES (@p0, @p1);@p0 = 'p1', @p1 = 1 INSERT INTO "User" (Email) VALUES (@p0); select last_insert_rowid();@p0 = '[email protected]' SELECT user0_.Id as Id2_0_, user0_.Email as Email2_0_ FROM "User" user0_ WHERE user0_.Id=@p0;@p0 = 1 SELECT permission0_.UserId as UserId1_, permission0_.PermissionId as Permissi2_1_, permission1_.Id as Id4_0_, permission1_.Description as Descript2_4_0_ FROM User_Permissions permission0_ left outer join "Permission" permission1_ on permission0_.PermissionId=permission1_.Id WHERE permission0_.UserId=@p0;@p0 = 1 We can clearly see that there is no record inserted into the User_Permissions table where it should be. Not sure what I am doing wrong and need an advice. So can you please help me to pass this test. Thanks, Dmitriy.

    Read the article

  • Modifying my website to allow anonymous comments

    - by David
    I write the code for my own website as an educational/fun exercise. Right now part of the website is a blog (like every other site out there :-/) which supports the usual basic blog features, including commenting on posts. But I only have comments enabled for logged-in users; I want to alter the code to allow anonymous comments - that is, I want to allow people to post comments without first creating a user account on my site, although there will still be some sort of authentication involved to prevent spam. Question: what information should I save for anonymous comments? I'm thinking at least display name and email address (for displaying a Gravatar), and probably website URL because I eventually want to accept OpenID as well, but would anything else make sense? Other question: how should I modify the database to store this information? The schema I have for the comment table is currently comment_id smallint(5) // The unique comment ID post_id smallint(5) // The ID of the post the comment was made on user_id smallint(5) // The ID of the user account who made the comment comment_subject varchar(128) comment_date timestamp comment_text text Should I add additional fields for name, email address, etc. to the comment table? (seems like a bad idea) Create a new "anonymous users" table? (and if so, how to keep anonymous user ids from conflicting with regular user ids) Or create fake user accounts for anonymous users in my existing users table? Part of what's making this tricky is that if someone tries to post an anonymous comment using an email address (or OpenID) that's already associated with an account on my site, I'd like to catch that and prompt them to log in.

    Read the article

  • How to sort in-place using the merge sort algorithm?

    - by eSKay
    I know the question is too open. All I want is someone to tell me how to convert a normal merge sort into an in-place merge sort (or a merge sort with constant extra space overhead). All I can find (on the net) is pages saying "it is too complex" or "out of scope of this text". "The only known ways to merge in-place (without any extra space) are too complex to be reduced to practical program." (from here) Even if it is too complex, can somebody outline the basic concept of how to make the merge sort in-place?

    Read the article

  • How to convert an existing callback interface to use boost signals & slots

    - by the_mandrill
    I've currently got a class that can notify a number of other objects via callbacks: class Callback { virtual NodulesChanged() =0; virtual TurkiesTwisted() =0; }; class Notifier { std::vector<Callback*> m_Callbacks; void AddCallback(Callback* cb) {m_Callbacks.push(cb); } ... void ChangeNodules() { for (iterator it=m_Callbacks.begin(); it!=m_Callbacks.end(); it++) { (*it)->NodulesChanged(); } } }; I'm considering changing this to use boost's signals and slots as it would be beneficial to reduce the likelihood of dangling pointers when the callee gets deleted, among other things. However, as it stands boost's signals seems more oriented towards dealing with function objects. What would be the best way of adapting my code to still use the callback interface but use signals and slots to deal with the connection and notification aspects?

    Read the article

  • Validate XSD with XML .

    - by munish
    I want to know how to validate XML with XSD . XML is not of an element type but a complex type . Since validator class's validate method compare only element type. So basically I want to valide XSD's complex type with an XML. e.g. Basic XSD below xs:element name="Customer"> <xs:complexType> <xs:sequence> <xs:element name="Dob" type="xs:date" /> <xs:element name="Address"> <xs:complexType> <xs:sequence> <xs:element name="Line1" type="xs:string" /> <xs:element name="Line2" type="xs:string" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> We can assume we have multiple complex type in the Customer element. MY XML is <Address> <Line1>34 thingy street, someplace</Line1> <Line2>sometown, w1w8uu </Line2> </Address> How I validate my XML with XSD. Kindly post your suggestions in java

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Deploy custom web service to sharepoint server(2007/2010)?

    - by leif
    According to MSDN, for deploying custom web service, we need to create *wsdl.aspx and *disco.aspx files, and put them with .asmx together under _vti_bin folder (C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\14\isapi). And put the dll under bin folder of the root of sharepoint virtual directory. It works correctly for me. However, i also found that if i put .asmx file under the root virtual directory without creating those *wsdl.aspx and *disco.aspx files. It can work as well and much easier than the above way. So i'm wondering what's the potential issues in this way?

    Read the article

  • How to restart a wcf server from within a client?

    - by djerry
    Hey guys, I'm using Wcf for server - client communication. The server will need to run as a service, so there's no GUI. The admin can change settings using the client program and for those changes to be made on server, it needs to restart. This is my server setup NetTcpBinding binding = new NetTcpBinding(SecurityMode.Message); Uri address = new Uri("net.tcp://localhost:8000"); //_svc = new ServiceHost(typeof(MonitoringSystemService), address); _monSysService = new MonitoringSystemService(); _svc = new ServiceHost(_monSysService, address); publishMetaData(_svc, "http://localhost:8001"); _svc.AddServiceEndpoint(typeof(IMonitoringSystemService), binding, "Monitoring Server"); _svc.Open(); MonitoringSystemService is a class i'm using to handle client - server comm. It looks like this: [CallbackBehavior(ConcurrencyMode = ConcurrencyMode.Reentrant)] [ServiceBehavior(InstanceContextMode = InstanceContextMode.Single, MaxItemsInObjectGraph = 2147483647)] public class MonitoringSystemService : IMonitoringSystemService {} So i need to call a restart method on the client to the server, but i don't know how to restart (even stop - start) the server. I hope i'm not missing any vital information. Thanks in advance.

    Read the article

  • Anonymous union definition/declaration in a macro GNU vs VS2008

    - by Alan_m
    I am attempting to alter an IAR specific header file for a lpc2138 so it can compile with Visual Studio 2008 (to enable compatible unit testing). My problem involves converting register definitions to be hardware independent (not at a memory address) The "IAR-safe macro" is: #define __IO_REG32_BIT(NAME, ADDRESS, ATTRIBUTE, BIT_STRUCT) \ volatile __no_init ATTRIBUTE union \ { \ unsigned long NAME; \ BIT_STRUCT NAME ## _bit; \ } @ ADDRESS //declaration //(where __gpio0_bits is a structure that names //each of the 32 bits as P0_0, P0_1, etc) __IO_REG32_BIT(IO0PIN,0xE0028000,__READ_WRITE,__gpio0_bits); //usage IO0PIN = 0x0xAA55AA55; IO0PIN_bit.P0_5 = 0; This is my comparable "hardware independent" code: #define __IO_REG32_BIT(NAME, BIT_STRUCT)\ volatile union \ { \ unsigned long NAME; \ BIT_STRUCT NAME##_bit; \ } NAME; //declaration __IO_REG32_BIT(IO0PIN,__gpio0_bits); //usage IO0PIN.IO0PIN = 0xAA55AA55; IO0PIN.IO0PIN_bit.P0_5 = 1; This compiles and works but quite obviously my "hardware independent" usage does not match the "IAR-safe" usage. How do I alter my macro so I can use IO0PIN the same way I do in IAR? I feel this is a simple anonymous union matter but multiple attempts and variants have proven unsuccessful. Maybe the IAR GNU compiler supports anonymous unions and vs2008 does not. Thank you.

    Read the article

  • Is it possible to store pointers in shared memory without using offsets?

    - by Joseph Garvin
    When using shared memory, each process may mmap the shared region into a different area of their address space. This means that when storing pointers within the shared region, you need to store them as offsets of the start of the shared region. Unfortunately, this complicates use of atomic instructions (e.g. if you're trying to write a lock free algorithm). For example, say you have a bunch of reference counted nodes in shared memory, created by a single writer. The writer periodically atomically updates a pointer 'p' to point to a valid node with positive reference count. Readers want to atomically write to 'p' because it points to the beginning of a node (a struct) whose first element is a reference count. Since p always points to a valid node, incrementing the ref count is safe, and makes it safe to dereference 'p' and access other members. However, this all only works when everything is in the same address space. If the nodes and the 'p' pointer are stored in shared memory, then clients suffer a race condition: x = read p y = x + offset Increment refcount at y During step 2, p may change and x may no longer point to a valid node. The only workaround I can think of is somehow forcing all processes to agree on where to map the shared memory, so that real pointers rather than offsets can be stored in the mmap'd region. Is there any way to do that? I see MAP_FIXED in the mmap documentation, but I don't know how I could pick an address that would be safe.

    Read the article

  • What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

    - by Edward Tanguay
    I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

    Read the article

< Previous Page | 408 409 410 411 412 413 414 415 416 417 418 419  | Next Page >