Search Results

Search found 43274 results on 1731 pages for 'single line'.

Page 416/1731 | < Previous Page | 412 413 414 415 416 417 418 419 420 421 422 423  | Next Page >

  • MVVM Binding Orthogonal Aspects in Views e.g. Application Settings

    - by chibacity
    I have an application which I am developing using WPF\Prism\MVVM. All is going well and I have some pleasing MVVM implementations. However, in some of my views I would like to be able to bind application settings e.g. when a user reloads an application, the checkbox for auto-scrolling a grid should be checked in the state it was last time the user used the application. My view needs to bind to something that holds the "auto-scroll" setting state. I could put this on the view-model, but applications settings are orthogonal to the purpose of the view-model. The "auto-scroll" setting is controlling an aspect of the view. This setting is just an example. There will be quite a number of them and splattering my view-models with properties to represent application settings (so I can bind them) feels decidedly yucky. One view-model per view seems to be de rigeuer... What is best\usual practice here? Splatter my view-models with application settings? Have multiple view-models per view so settings can be represented in their own right? Split views so that controls can bind to an ApplicationSettingsViewModel? = too many views? Something else? Edit 1 To add a little more context, I am developing a UI with a tabbed interface. Each tab will host a single widget and there a variety of widgets. Each widget is a Prism composition of individual views. Some views are common amongst widgets e.g. a file picker view. Whilst each widget is composed of several views, as a whole, conceptually a widget has a single set of user settings e.g. last file selected, auto-scroll enabled, etc. These need to be persisted and retrieved\applied when the application starts again, and the widget views are created. My question is focused on the fact that conceptually a widget has a single set of user settings which is at right-angles to the fact that a widget consists of many views. Each view in the widget has it's own view-model (which works nicely and logically) but if I stick to a one view-model per view, I would have to splatter each view-model with user settings appropriate to it. This doesn't sound right ?!?

    Read the article

  • What design considerations should one take to receive text and multiple attachments via web?

    - by ramesh.nagul
    I am developing a web application to accept a bunch of text and attachments (1 or more) via email, web and other methods. I am planning to build a single interface, mostly a web service to accept this content. What design considerations should I make? I am building the app using ASP.NET MVC 2. Should the attachments be saved to disk or in the database? Should the unified single interface be a web service? Pros and cons to using web services to upload files

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Projected Results

    - by Sylvie MacKenzie, PMP
    Excerpt from PROFIT - ORACLE - by Monica Mehta Yasser Mahmud has seen a revolution in project management over the past decade. During that time, the former Primavera product strategist (who joined Oracle when his company was acquired in 2008) has not only observed a transformation in the way IT systems support corporate projects but the role project portfolio management (PPM) plays in the enterprise. “15 years ago project management was the domain of project management office (PMO),” Mahmud recalls of earlier days. “But over the course of the past decade, we've seen it transform into a mission critical enterprise discipline, that has made Primavera indispensable in the board room. Now, as a senior manager, a board member, or a C-level executive you have direct and complete visibility into what’s kind of going on in the organization—at a level of detail that you're going to consume that information.” Now serving as Oracle’s vice president of product strategy and industry marketing, Mahmud shares his thoughts on how Oracle’s Primavera solutions have evolved and how best-in-class project portfolio management systems can help businesses stay competitive. Profit: What do you feel are the market dynamics that are changing project management today? Mahmud: First, the data explosion. We're generating data at twice the rate at which we can actually store it. The same concept applies for project-intensive organizations. A lot of data is gathered, but what are we really doing with it? Are we turning data into insight? Are we using that insight and turning it into foresight with analytics tools? This is a key driver that will separate the very good companies—the very competitive companies—from those that are not as competitive. Another trend is centered on the explosion of mobile computing. By the year 2013, an estimated 35 percent of the world’s workforce is going to be mobile. That’s one billion people. So the question is not if you're going to go mobile, it’s how fast you are going to go mobile. What kind of impact does that have on how the workforce participates in projects? What worked ten to fifteen years ago is not going to work today. It requires a real rethink around the interfaces and how data is actually presented. Profit: What is the role of project management in this new landscape? Mahmud: We recently conducted a PPM study with the Economist Intelligence Unit centered to determine how important project management is considered within organizations. Our target was primarily CFOs, CIOs, and senior managers and we discovered that while 95 percent of participants believed it critical to their business, only six percent were confident that projects were delivered on time and on budget. That’s a huge gap. Most organizations are looking for efficiency, especially in these volatile financial times. But senior management can’t keep track of every project in a large organization. As a result, executives are attempting to inventory the work being conducted under their watch. What is often needed is a very high-level assessment conducted at the board level to say, “Here are the 50 initiatives that we have underway. How do they line up with our strategic drivers?” This line of questioning can provide early warning that work and strategy are out of alignment; finding the gap between what the business needs to do and the actual performance scorecard. That’s low-hanging fruit for any executive looking to increase efficiency and save money. But it can only be obtained through proper assessment of existing projects—and you need a project system of record to get that done. Over the next decade or so, project management is going to transform into holistic work management. Business leaders will want make sure key projects align with corporate strategy, but also the ability to drill down into daily activity and smaller projects to make sure they line up as well. Keeping employees from working on tasks—even for a few hours—that don’t line up with corporate goals will, in many ways, become a competitive differentiator. Profit: How do all of these market challenges and shifting trends impact Oracle’s Primavera solutions and meeting customers’ needs? Mahmud: For Primavera, it’s a transformation from being a project management application to a PPM system in the enterprise. Also making that system a mission-critical application by connecting to other key applications within the ecosystem, such as the enterprise resource planning (ERP), supply chain, and CRM systems. Analytics have also become a huge component. Business analytics have made Oracle’s Primavera applications pertinent in the boardroom. Now, as a senior manager, a board member, a CXO, CIO, or CEO, you have direct visibility into what’s going on in the organization at a level that you're able to consume that information. In addition, all of this information pairs up really well with your financials and other data. Certainly, when you're an Oracle shop, you have that visibility that you didn’t have before from a project execution perspective. Profit: What new strategies and tools are being implemented to create a more efficient workplace for users? Mahmud: We believe very strongly that just because you call something an enterprise project portfolio management system doesn’t make it so—you have to get people to want to participate in the system. This can’t be mandated down from the top. It simply doesn’t work that way. A truly adoptable solution is one that makes it super easy for all types users to participate, by providing them interfaces where they live. Keeping that in mind, a major area of development has been alternative user interfaces. This is increasingly resulting in the creation of lighter weight, targeted interfaces such as iOS applications, and smartphones interfaces such as for iPhone and Android platform. Profit: How does this translate into the development of Oracle’s Primavera solutions? Mahmud: Let me give you a few examples. We recently announced the launch of our Primavera P6 Team Member application, which is a native iOS application for the iPhone. This interface makes it easier for team members to do their jobs quickly and effectively. Similarly, we introduced the Primavera analytics application, which can be consumed via mobile devices, and when married with Oracle Spatial capabilities, users can get a geographical view of what’s going on and which projects are occurring in various locations around the world. Lastly, we introduced advanced email integration that allows project team members to status work via E-mail. This functionality leverages the fact that users are in E-mail system throughout the day and allows them to status their work without the need to launch the Primavera application. It comes back to a mantra: provide as many alternative user interfaces as possible, so you can give people the ability to work, to participate, to raise issues, to create projects, in the places where they live. Do it in such a way that it’s non-intrusive, do it in such a way that it’s easy and intuitive and they can get it done in a short amount of time. If you do that, workers can get back to doing what they're actually getting paid for.

    Read the article

  • PASS: The Budget Process

    - by Bill Graziano
    Every fiscal year PASS creates a detailed budget.  This helps us set priorities and communicate to our members what we’re going to do in the upcoming year.  You can review the current budget on the PASS Governance page.  That page currently requires you to login but I’m talking with HQ to see if there are any legal issues with opening that up. The Accounting Team The PASS accounting team is two people.  The Executive Vice-President of Finance (“EVP”) and the PASS Accounting Manager.  Sandy Cherry is the accounting manager and works at PASS HQ.  Sandy has been with PASS since we switched management companies in 2007.  Throughout this document when I talk about any actual work related to the budget that’s all Sandy :)  She’s the glue that gets us through this process.  Last year we went through 32 iterations of the budget before the Board approved so it’s a pretty busy time for her us – well, mostly her. Fiscal Year The PASS fiscal year runs from July 1st through June 30th the following year.  Right now we’re in fiscal year 2011.  Our 2010 Summit actually occurred in FY2011.  We switched to this schedule from a calendar year in 2006.  Our goal was to have the Summit occur early in our fiscal year.  That gives us the rest of the year to handle any significant financial impact from the Summit.  If registrations are down we can reduce spending.  If registrations are up we can decide how much to increase our reserves and how much to spend.  Keep in mind that the Summit is budgeted to generate 82% of our revenue this year.  How it performs has a significant impact on our financials.  The other benefit of this fiscal year is that it matches the Microsoft fiscal year.  We sign an annual sponsorship agreement with Microsoft and it’s very helpful that our fiscal years match. This year our budget process will probably start in earnest in March or April.  I’d like to be done in early June so we can publish before July 1st.  I was late publishing it this year and I’m trying not to repeat that. Our Budget Our actual budget is an Excel spreadsheet with 36 sheets.  We remove some of those when we publish it since they include salary information.  The budget is broken up into various portfolios or departments.  We have 20 portfolios.  They include chapters, marketing, virtual chapters, marketing, etc.  Ideally each portfolio is assigned to a Board member.  Each portfolio also typically has a staff person assigned to it.  Portfolios that aren’t assigned to a Board member are monitored by HQ and the ExecVP-Finance (me).  These are typically smaller portfolios such as deferred membership or Summit futures.  (More on those in a later post.)  All portfolios are reviewed by all Board members during the budget approval process, when interim financials are released internally and at year-end. The Process Our first step is to budget revenues.  The Board determines a target attendee number.  We have formulas based on historical performance that convert that to an overall attendee revenue number.  Other revenue projections (such as vendor sponsorships) come from different parts of the organization.  I hope to have another post with more details on how we project revenues. The next step is to budget expenses.  Board members fill out a sample spreadsheet with their budget for the year.  They can add line items and notes describing what the amounts are for.  Each Board portfolio typically has from 10 to 30 line items.  Any new initiatives they want to pursue needs to be budgeted.  The Summit operations budget is managed by HQ.  It includes the cost for food, electrical, internet, etc.  Most of these come from our estimate of attendees and our contract with the convention center.  During this process the Board can ask for more or less to be spent on various line items.  For example, if we weren’t happy with the Internet at the last Summit we can ask them to look into different options and/or increasing the budget.  HQ will also make adjustments to these numbers based on what they see at the events and the feedback we receive on the surveys. After we have all the initial estimates we start reviewing the entire budget.  It is sent out to the Board and we can see what each portfolio requested and what the overall profit and loss number is.  We usually start with too much in expenses and need to cut.  In years past the Board started haggling over these numbers as a group.  This past year they decided I should take a first cut and present them with a reasonable budget and a list of what I changed.  That worked well and I think we’ll continue to do that in the future. We go through a number of iterations on the budget.  If I remember correctly, we went through 32 iterations before we passed the budget.  At each iteration various revenue and expense numbers can change.  Keep in mind that the PASS budget has 200+ line items spread over 20 portfolios.  Many of these depend on other numbers.  For example, if we decide increase the projected attendees that cascades through our budget.  At each iteration we list what changed and the impact.  Ideally these discussions will take place at a face-to-face Board meeting.  Many of them also take place over the phone.  Board members explain any increase they are asking for while performing due diligence on other budget requests.  Eventually a budget emerges and is passed. Publishing After the budget is passed we create a version without the formulas and salaries for posting on the web site.  Sandy also creates some charts to help our members understand the budget.  The EVP writes a nice little letter describing some of the changes from last year’s budget.  You can see my letter and our budget on the PASS Governance page. And then, eight months later, we start all over again.

    Read the article

  • Is there a standard way to encode a .NET string into javascript string for use in MS AJAX?

    - by Rich Andrews
    I'm trying to pass the output of a SQL Server exception to the client using the RegisterStartUpScript method of the MS ScriptManager. This works fine for some errors but when the exception contains single quotes the alert fails. I dont want to only escape single quotes though - Is there a standard function i can call to escape any special chars for use in Javascript? string scriptstring = "alert('" + ex.Message + "');"; ScriptManager.RegisterStartupScript(this, this.GetType(), "Alert", scriptstring , true); Thanks tpeczek, the code almost worked for me :) but with a slight amendment (the escaping of single quotes) it works a treat. I've included my amended version here... public class JSEncode { /// <summary> /// Encodes a string to be represented as a string literal. The format /// is essentially a JSON string. /// /// The string returned includes outer quotes /// Example Output: "Hello \"Rick\"!\r\nRock on" /// </summary> /// <param name="s"></param> /// <returns></returns> public static string EncodeJsString(string s) { StringBuilder sb = new StringBuilder(); sb.Append("\""); foreach (char c in s) { switch (c) { case '\'': sb.Append("\\\'"); break; case '\"': sb.Append("\\\""); break; case '\\': sb.Append("\\\\"); break; case '\b': sb.Append("\\b"); break; case '\f': sb.Append("\\f"); break; case '\n': sb.Append("\\n"); break; case '\r': sb.Append("\\r"); break; case '\t': sb.Append("\\t"); break; default: int i = (int)c; if (i < 32 || i > 127) { sb.AppendFormat("\\u{0:X04}", i); } else { sb.Append(c); } break; } } sb.Append("\""); return sb.ToString(); } } As mentioned below - original source: here

    Read the article

  • Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

    - by user1848361
    First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

    Read the article

  • Why are my RSpec specs running twice?

    - by James A. Rosen
    I have the following RSpec (1.3.0) task defined in my Rakefile: require 'spec/rake/spectask' Spec::Rake::SpecTask.new(:spec) do |spec| spec.libs << 'lib' << 'spec' spec.spec_files = FileList['spec/**/*_spec.rb'] end I have the following in spec/spec_helper.rb: require 'rubygems' require 'spec' require 'spec/autorun' require 'rack/test' require 'webmock/rspec' include Rack::Test::Methods include WebMock require 'omniauth/core' I have a single spec declared in spec/foo/foo_spec.rb: require File.dirname(__FILE__) + '/../spec_helper' describe Foo do describe '#bar' do it 'be bar-like' do Foo.new.bar.should == 'bar' end end end When I run rake spec, the single example runs twice. I can check it by making the example fail, giving me two red "F"s. One thing I thought was that adding spec to the SpecTask's libs was causing them to be double-defined, but removing that doesn't seem to have any effect.

    Read the article

  • ODEE Green Field (Windows) Part 4 - Documaker

    - by AndyL-Oracle
    Welcome back! We're about nearing completion of our installation of Oracle Documaker Enterprise Edition ("ODEE") in a green field. In my previous post, I covered the installation of SOA Suite for WebLogic. Before that, I covered the installation of WebLogic, and Oracle 11g database - all of which constitute the prerequisites for installing ODEE. Naturally, if your environment already has a WebLogic server and Oracle database, then you can skip all those components and go straight for the heart of the installation of ODEE. The ODEE installation is comprised of two procedures, the first covers the installation, which is running the installer and answering some questions. This will lay down the files necessary to install into the tiers (e.g. database schemas, WebLogic domains, etcetera). The second procedure is to deploy the configuration files into the various components (e.g. deploy the database schemas, WebLogic domains, SOA composites, etcetera). I will segment my posts accordingly! Let's get started, shall we? Unpack the installation files into a temporary directory location. This should extract a zip file. Extract that zip file into the temporary directory location. Navigate to and execute the installer in Disk1/setup.exe. You may have to allow the program to run if User Account Control is enabled. Once the dialog below is displayed, click Next. Select your ODEE Home - inside this directory is where all the files will be deployed. For ease of support, I recommend using the default, however you can put this wherever you want. Click Next. Select the database type, database connection type – note that the database name should match the value used for the connection type (e.g. if using SID, then the name should be IDMAKER; if using ServiceName, the name should be “idmaker.us.oracle.com”). Verify whether or not you want to enable advanced compression. Note: if you are not licensed for Oracle 11g Advanced Compression option do not use this option! Terrible, terrible calamities will befall you if you do! Click Next. Enter the Documaker Admin user name (default "dmkr_admin" is recommended for support purposes) and set the password. Update the System name and ID (must be unique) if you want/need to - since this is a green field install you should be able to use the default System ID. The only time you'd change this is if you were, for some reason, installing a new ODEE system into an existing schema that already had a system. Click Next. Enter the Assembly Line user name (default "dmkr_asline" is recommended) and set the password. Update the Assembly Line name and ID (must be unique) if you want/need to - it's quite possible that at some point you will create another assembly line, in which case you have several methods of doing so. One is to re-run the installer, and in this case you would pick a different assembly line ID and name. Click Next. Note: you can set the DB folder if needed (typically you don’t – see ODEE Installation Guide for specifics. Select the appropriate Application Server type - in this case, our green field install is going to use WebLogic - set the username to weblogic (this is required) and specify your chosen password. This credential will be used to access the application server console/control panel. Keep in mind that there are specific criteria on password choices that are required by WebLogic, but are not enforced by the installer (e.g. must contain a number, must be of a certain length, etcetera). Choose a strong password. Set the connection information for the JMS server. Note that for the 12.3.x version, the installer creates a separate JVM (WebLogic managed server) that hosts the JMS server, whereas prior editions place the JMS server on the AdminServer.  You may also specify a separate URL to the JMS server in case you intend to move the JMS resources to a separate/different server (e.g. back to AdminServer). You'll need to provide a login principal and credentials - for simplicity I usually make this the same as the WebLogic domain user, however this is not a secure practice! Make your JMS principal different from the WebLogic principal and choose a strong password, then click Next. Specify the Hot Folder(s) (comma-delimited if more than one) - this is the directory/directories that is/are monitored by ODEE for jobs to process. Click Next. If you will be setting up an SMTP server for ODEE to send emails, you may configure the connection details here. The details required are simple: hostname, port, user/password, and the sender's address (e.g. emails will appear to be sent by the address shown here so if the recipient clicks "reply", this is where it will go). Click Next. If you will be using Oracle WebCenter:Content (formerly known as Oracle UCM) you can enable this option and set the endpoints/credentials here. If you aren't sure, select False - you can always go back and enable this later. I'm almost 76% certain there will be a post sometime in the future that details how to configure ODEE + WCC:C! Click Next. If you will be using Oracle UMS for sending MMS/text messages, you can enable and set the endpoints/credentials here. As with UCM, if you're not sure, don't enable it - you can always set it later. Click Next. On this screen you can change the endpoints for the Documaker Web Service (DWS), and the endpoints for approval processing in Documaker Interactive. The deployment process for ODEE will create 3 managed WebLogic servers for hosting various Documaker components (JMS, Interactive, DWS, Dashboard, Documaker Administrator, etcetera) and it will set the ports used for each of these services. In this screen you can change these values if you know how you want to deploy these managed servers - but for now we'll just accept the defaults. Click Next. Verify the installation details and click Install. You can save the installation into a response file if you need to (which might be useful if you want to rerun this installation in an unattended fashion). Allow the installation to progress... Click Next. You can save the response file if needed (e.g. in case you forgot to save it earlier!) Click Finish. That's it, you're done with the initial installation. Have a look around the ODEE_HOME that you just installed (remember we selected c:\oracle\odee_1?) and look at the files that are laid down. Don't change anything just yet! Stay tuned for the next segment where we complete and verify the installation. 

    Read the article

  • organise javascript code based on page

    - by David
    Hi I am relatively new to javascript development. At the moment I have a single javascript file with lots of little misc bits of code that get called in different part of the website. For example I have an event handler for some google maps stuff that is only called on 1 single page, I have some validation stuff for my contact page etc etc. My question, is how best to organise this code - given that each page only requires very little code but its different and specific per page? Oh, I am using jquery if that makes a difference.

    Read the article

  • geom_tile heatmap with different high fill colours based on factor

    - by Michael
    I'm interested in building a heatmap with geom_tile in ggplot2 that uses a different gradient high color based on a factor. The plot below creates the plot where the individual tiles are colored blue or red based on the xy_type, but there is no gradient. ggplot() + geom_tile(data=mydata, aes(x=factor(myx), y=myy, fill=factor(xy_type))) + scale_fill_manual(values=c("blue", "red")) The plot below does not use the xy_type factor to choose the color, but I get a single group gradient based on the xy_avg_value. ggplot() + geom_tile(data=mydata, aes(x=factor(myx), y=myy, fill=xy_avg_value)) Is there a technique to blend these two plots? I can use a facet_grid(xy_type ~ .) to create separate plots of this data, with the gradient. As this is ultimately going to be a map (x~y coordinates), I'd like to find a way to display the different gradient together in a single geom_tile map.

    Read the article

  • What is the maximum number of virtualhosts Apache can handle?

    - by FractalizeR
    Hello. What is the maximum number of VirtualHosts Apache can handle on a single machine (I don't mean anything related to load, let's suppose it's irrelevant for the question). And we take only Apache without any proxifying things like nginx. I am asking because on one forum one guy reported that his Apache works unstable with the number of sites more than 400 on a single machine. If you have a config, that handles more than 400, please tell me here. Thanks.

    Read the article

  • IOS where to put the configuration of facebook sdk

    - by Carol Smith
    I am trying to integrated my IOS 7 application with Facebook SDK I following this official tutorial https://developers.facebook.com/docs/ios/getting-started which states Configure the .plist Follow these three steps: Create a key called FacebookAppID with a string value, and add the app ID there. Create a key called FacebookDisplayName with a string value, and add the Display Name you configured in the App Dashboard. Create an array key called URL types with a single array sub-item called URL Schemes. Give this a single item with your app ID prefixed with fb. This is used to ensure the application will receive the callback URL of the web-based OAuth flow. The finished .plist should look something like this: My question is where to put these values? They already put this image, maybe it helps you to answer me Edit The problem that I don't have any plist file in my framework in xcode and I can't add a new one because if i did, I would have to add all the variables that you see in the image but the tutorial just stated about some of them

    Read the article

  • VBS Script for modifying multi-value Active Directory display specifier

    - by sh-beta
    Following the howto Extending the Active Directory Schema To Track Custom Info I'm able to setup a single-value schema attribute that is easily changeable via a context menu in ADUC. Multi-value schema attributes get considerably more complicated. Say (for the sake of argument) my value is "Projects" and each user may be a list as many projects as necessary. Following is a sad little script that will set Project to a single value: Dim oproject Dim oUser1 Dim temp1 Set oproject = Wscript.Arguments Set oUser1 = GetObject(oproject(0)) temp1 = InputBox("Project: " & oUser1.project & vbCRLF & vbCRLF & "Project") if temp1 <> "" then oUser1.Put "project",temp1 oUser1.SetInfo Set oUser1 = Nothing Set oproject = Nothing Set temp1 = Nothing WScript.Quit How can I modify this to allow, assign, and modify multiple values?

    Read the article

  • please help me in this query

    - by testkhan
    I have three tables (user, friends, posts) and two users (user1 and user2). When user1 adds user2 as friend then user1 can see the posts of user2 just like on Facebook. But only the posts after the date when user1 added user2 as friend. My query is like this: $sql = mysql_query("SELECT * FROM posts p JOIN friends f ON p.currentuserid = f.friendid AND p.time >= f.friend_since OR p.currentuserid='user1id' WHERE f.myid='user1id' ORDER BY p.postid DESC LIMIT 20"); it is working all the way fine but with a little problem.....!! it displays user2, user3 (all the users as friends of user1) posts for single time but shows user1 posts multiple.......i.e user2. hi user1. userssfsfsfsfsdf user1. userssfsfsfsfsdf user3. dddddddd user1. sdfsdsdfsdsfsf user1. sdfsdsdfsdsfsf but i in database it is single entry/post why it is happening........!! How can I fix it?

    Read the article

  • Thread-safe queue in Javascript or jQuery

    - by at
    I have many asynchronous AJAX calls whose results will get processed. It doesn't matter what order the processing occurs, but the results need to get processed one at a time. So I'd like to simple do my AJAX calls and they all just put their results in a single queue. That queue should then get processed on a single thread. This way the results get processed one at a time as soon as possible. What's the best way to do this? I'm using jQuery, so happy to take advantage of any facilities it provides for this.

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • Entities groups in transactions

    - by Joel
    In the context of "Keys and Entity Groups" article by google: http://code.google.com/appengine/docs/python/datastore/transactions.html 1) "Only use entity groups when they are needed for transactions" 2) "Every entity belongs to an entity group, a set of one or more entities that can be manipulated in a single transaction." It seems like entity groups exist only for the use of transactions, i.e. making one transaction possible between all entities in a group. My question is then why are there parent-child relations between entities and not just a simple declaration of entities to be in a single group (that is defining A,B,C to be in the same group as opposed to defining relations between them "A (parent of) B, B (parent of C)"). What is the benefit from using parent-child relation model when the only purpose is for entities to be in the same group to make transaction possible? Thanks Joel

    Read the article

  • Java Regex for matching quoted string with escaped quotes

    - by kayahr
    I know there are already many questions like mine but I found no answer which works in Java. So I write a new question. I have text files with content like this: key1 = "This is a \"test\" text with escapes using '\\' characters"; key2 = 'It must work with \'single\' quotes and "double" quotes'; I need a regular expression which matches the values in the double-quotes (or single-quotes). This regular expression must support the escaped quotes and escaped backslashes. The regular expression must work with Java standard Pattern/Matcher classes.

    Read the article

  • Compressing three individual jpeg pics containing temporal redundancy?

    - by michael
    I am interfacing and embedded device with a camera module that returns a single jpeg compressed frame each time I trigger it. I would like to take three successive shots (approx 1 frame per 1/4 second) and further compress the images into a single file. The assumption here is that there is a lot of temporal redundancy, therefore lots of room for more compression across the three frames (compared to sending three separate jpeg images). I will be implementing the solution on an embedded device in C without any libraries and no OS. The camera will be taking pics in an area with very little movement (no visitors or screens in the background, maybe a tree with swaying branches), so I think my assumption about redundancy is pretty solid. When the file is finally viewed on a pc/mac, I don't mind having to write something to extract the three frames (so it can be a nonstandard cluge) So I guess the actual question is: What is the best way to compress these three images together given the fact that they are already in JPEG format (it is a possibly to convert back to a raw image, but if i dont have too...)

    Read the article

  • How do I setup a Criteria in nHibernate to query against multiple values

    - by AWC
    I want to query for a set of results based on the contents of a list, I've managed to do this for a single instance of the class Foo, but I'm unsure how I would do this for a IList<Foo>. So for a single instance of the class Foo, this works: public ICriteria CreateCriteria(IList<Foo> foo) { return session .CreateCriteria<Component>() .CreateCriteria("Versions") .CreateCriteria("PublishedEvents") .Add(Restrictions.And(Restrictions.InsensitiveLike("Name", foo.Name, MatchMode.Anywhere), Restrictions.InsensitiveLike("Type", foo.Type, MatchMode.Anywhere))) .SetCacheable(true); } But how do I do this when the method parameter is a list of Foo? public ICriteria CreateCriteria(IList<Foo> foos) { return session .CreateCriteria<Component>() .CreateCriteria("Versions") .CreateCriteria("PublishedEvents") .Add(Restrictions.And(Restrictions.InsensitiveLike("Name", foo.Name, MatchMode.Anywhere), Restrictions.InsensitiveLike("Type", foo.Type, MatchMode.Anywhere))) .SetCacheable(true); }

    Read the article

  • Must all Concurrent Data Store (CDB) locks be explicitly released when closing a Berkeley DB?

    - by Steve Emmerson
    I have an application that comprises multiple processes each accessing a single Berkeley DB Concurrent Data Store (CDB) database. Each process is single-threaded and does no explicit locking of the database. When each process terminates normally, it calls DB-close() and DB_ENV-close(). When all processes have terminated, there should be no locks on the database. Episodically, however, the database behaves as if some process was holding a write-lock on it even though all processes have terminated normally. Does each process need to explicitly release all locks before calling DB_ENV-close()? If so, how does the process obtain the "locker" parameter for the call to DB_ENV-loc_vec()?

    Read the article

  • Cross-database transactions from one SP

    - by Michael Bray
    I need to update multiple databases with a few simple SQL statement. The databases are configurared in SQL using 'Linked Servers', and the SQL versions are mixed (SQL 2008, SQL 2005, and SQL 2000). I intend to write a stored procedure in one of the databases, but I would like to do so using a transaction to make sure that each database gets updated consistently. Which of the following is the most accurate: Will a single BEGIN/COMMIT TRANSACTION work to guarantee that all statements across all databases are successful? Will I need multiple BEGIN TRANSACTIONS for each individual set of commands on a database? Are transactions even supported when updating remote databases? I would need to execute a remote SP with embedded transaction support. Note that I don't care about any kind of cross-database referential integrity; I'm just trying to update multiple databases at the same time from a single stored procedure if possible. Any other suggestions are welcome as well. Thanks!

    Read the article

  • Preserve "long" spaces in PDFBox text extraction

    - by Thilo
    I am using PDFBox to extract text from PDF. The PDF has a tabular structure, which is quite simple and columns are also very widely spaced from each-other This works really well, except that all kinds of horizontal space gets converted into a single space character, so that I cannot tell columns apart anymore (space within words in a column looks just like space between columns). I appreciate that a general solution is very hard, but in this case the columns are really far apart so that having a simple differentiation between "long spaces" and "space between words" would be enough. Is there a way to tell PDFBox to turn horizontal whitespace of more then x inches into something other than a single space? A proportional approach (x inch become y spaces) would also work.

    Read the article

< Previous Page | 412 413 414 415 416 417 418 419 420 421 422 423  | Next Page >