Search Results

Search found 21197 results on 848 pages for 'webcenter content'.

Page 416/848 | < Previous Page | 412 413 414 415 416 417 418 419 420 421 422 423  | Next Page >

  • Gzip not working in browser

    - by Cathal
    According to whatsmyip.org none of my browsers (Firefox, Chrome etc) on W7 are gzip enabled, it's saying 'NO, your browser is not requesting compressed content' which agrees with Chrome developer tools as I was testing a site and it was complaining that the page and css etc weren't compressed. I've searched for an answer but cannot find anything for this. I've tested from another pc connected to the router and that works fine, something on this pc is broke.... Any help tia

    Read the article

  • Force www. on multi domain site and retain http or https [closed]

    - by John Isaacks
    I am using CakePHP which already contains an .htaccess file that looks like: <IfModule mod_rewrite.c> RewriteEngine on RewriteRule ^$ app/webroot/ [L] RewriteRule (.*) app/webroot/$1 [L] </IfModule> I want to force www. (unless it is a subdomain) to avoid duplicate content penalties. It needs to retain http or https Also This application will have multiple domains pointing to it. So the code needs to be able to work with any domain.

    Read the article

  • How can I configure OSX/Windows7 to send ALL traffic though VPN tunnel?

    - by lrrrgg
    While connected to a VPN (SwissVPN service), a content filter at a site I'm working at blocked a web page. This was perplexing, since the local site's filter should not be able to see my traffic, right? So I assume my web browsing activity was not going through the VPN tunnel. How can I configure the OS to send ALL traffic though the currently connected VPN tunnel? I'm using OSX Lion and Windows 7. Thanks!

    Read the article

  • Encrypt windows 8 file history

    - by SnippetSpace
    File history is great but it saves your files on the external drive without any encryption and stores them using the exact same folder structure as the originals. If a bad guy gets his hands on the hard drive it could basically not be easier to get to your important files. Is there any way to encrypt the file history backup without breaking its functionality and without having to encrypt the original content itself? Thanks for your input!

    Read the article

  • How to allow only specific directories to use htaccess?

    - by DisgruntledGoat
    Currently in apache2.conf I have AllowOverride all set for /var/www which simply allows htaccess for all the sites on the server (which is Ubuntu, 9.04). However, I'd rather only allow overrides in each site root directory and nothing else. In other words, /var/www/site1, /var/www/site2, etc. can have a htaccess, but all other directories including /var/www and /var/www/site1/content cannot. Is there a way to do this without having to write a rule for every site on the server?

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Streaming from a second computer

    - by techgod52
    I play games on my laptop, and they run at about 30-45 fps, which is bearable for me. But when I try to stream, the frame rate drops to 20 or lower, which is unplayable for me. I have a second computer though (a Mac, the laptop is Win7), and I'm wondering if there is anyway to stream the game content (onto Twitch.tv) from my laptop using my Mac. Is this possible, and how would I go about doing it?

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • Windows XP restarts itself suddenly

    - by LaD
    My computer (Windows XP sp3) gets stuck suddenly and restarts itself. When Windows loads I get the following message: error Signature: BCCode : 100000d1 BCP1 : 0000674B BCP2 : 00000002 BCP3 : 00000000 BCP4 : BA9910DC OSVer : 5_1_2600 SP : 3_0 Product : 256_1 error report content: C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\Mini090909-02.dmp C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\sysdata.xml Help! Thanks.

    Read the article

  • How to schedule server jobs more intelligently than with cron?

    - by John
    I run a job every minute to reindex my site's content. Today, the search engine died, and when I logged in there were hundreds of orphan processes that had been started by cron. Is there another way using some kind of existing software that will let me execute a job every minute, but that won't launch another instance if that job doesn't return (i.e. because the search engine process has failed)?

    Read the article

  • Which guide do you recommend on setting up Nginx

    - by Saif Bechan
    I am setting up an LEMP (Nginx, MySQL, PHP on Linux) from scratch. There are a lot of guides available online in all different forms. Now I want a setup with virtual hosts, and only serve dynamic content (PHP). My static files(images,css,js) are on a CDN. Do you know of a good guide on setting up the LEMP installation.

    Read the article

  • How to append to a file as sudo? [closed]

    - by obvio171
    Possible Duplicate: sudo unable to write to /etc/profile I want to do: echo "something" >> /etc/config_file But, since only the root user has write permission to this file, I can't do that. But this: sudo echo "something" >> /etc/config_file also doesn't work. Is there any way to append to a file in that situation without having to first open it with a sudo'd editor and then appending the new content by hand?

    Read the article

  • How to register rss for a website?

    - by domainking
    I am not sure if I ask this question in the right place, because I am new to it. What I want to ask is, do I need to register/create RSS for my website? I have a website, lets say: [http://blog.domain.com] = its a 2.9.2 wordpress blog So, if I want to display the latest content in another subdomain, for example: [news.domain.com], how do I do that? I know a little bit of php and mysql.

    Read the article

  • Invalid command 'SSLRequireSSL',

    - by Bad Programmer
    An svn server that I managed crashed. The server is up and running again, but I can't manage to get svn running anymore. I followed the instructions listed here: http://mark.koli.ch/2010/03/howto-setting-up-your-own-svn-server-using-apache-and-mod-dav-svn.html Yet when I try to start apache using /etc/init.d/httpd start I get a [FAILED] message. There is no content in the error logs. Any suggestions?

    Read the article

  • How can I tell if I'm behind a portal or proxy

    - by user19269
    I'm testing out a Content management system on my computer and have emailed their support for a problem regarding login.. They've replied back and asked if my CMS is behind a portal or proxy. I feel kind of stupid for not knowing this, but how do I find out? Everything is local (eg, hosted on my computer, etc). Thanks in advance!

    Read the article

  • what TERM to use to get rid of color escape codes?

    - by slivu
    Is there a way to get rid of escape codes in terminal output? Say even if the script are sending that codes they are ignored by terminal and text displayed as is, without colors, bolds etc. I need to display terminal output on a HTML page. For now i'm using javascript to remove escape codes, but it becomes clunky cause i receive output by chars, and have to wait until all content received then update it, leading in weird effects.

    Read the article

  • Export Specific Page from MediaWiki

    - by wag2639
    We have an internal document wiki running on MediaWiki (latest stable). Is there a way we can export a specific page for a customer without giving them access to the entire wiki (which is currently behind a PAM-based authentication). Edit1: Sorry for the vagueness, I meant is there a way to syndicate a specific page so that they don't actually have access to the wiki but the content is still available and up-to-date. For example, the page I want them to see http://mysite.com/wiki/page_to_see Can I have it available at http://mysite.com/outsite_wiki

    Read the article

  • Svn hook on commit makes lock

    - by dynback.com
    My post-commit hook looks like this: pushd C:\Websites\Project svn update I am updating my server copy of repository. When I commit client stopped on sending content and locked or I dont know. Its is waiting for something. So when I cancel and try to update manually on server, I see: Working copy "." lockedsvn And only after manual cleanup and update again, I get updated revision, that was really commited. What I do wrong?

    Read the article

  • Problem connecting to Hsqldb via Hibernate when running a Eclipse GWT project.

    - by Toby
    Hi, I'm trying to run a simple GWT project where I'm trying to do a simple persitence via hibernate to a HSQLDB database. The database I'm using I have been using for at least 2 years with several osgi applications without any problems. So all I done is reused the same configuration and added a simple object mapping file. The problem I have is that I get a socket creation error when ever I try to persist the object with in GWT jetty. I now the database is up and running, I can telnet to it, run OSGI projects that uses the same config with out problems. This is the stack I get when running 25 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Environment - Hibernate 3.3.1.GA 30 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Environment - hibernate.properties not found 34 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Environment - Bytecode provider name : javassist 42 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Environment - using JDK 1.4 java.sql.Timestamp handling 162 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Configuration - configuring from resource: hibernate.cfg.xml 162 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Configuration - Configuration resource: hibernate.cfg.xml 268 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Configuration - Reading mappings from resource : hbm-mappings/project.hbm.xml 382 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.HbmBinder - Mapping class: se.kanit.projectmgr.db.ProjectDAO - T_PROJECT 419 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Configuration - Configured SessionFactory: null 3534 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - Using Hibernate built-in connection pool (not for production use!) 3534 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - Hibernate connection pool size: 1 3534 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - autocommit mode: false 3537 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - using driver: org.hsqldb.jdbcDriver at URL: jdbc:hsqldb:hsql://localhost:1476/dirtyharry 3537 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - connection properties: {user=sa, password=****} 3594 [21704474@qtp-26509496-0] WARN org.hibernate.cfg.SettingsFactory - Could not obtain connection metadata java.sql.SQLException: socket creation error at org.hsqldb.jdbc.Util.sqlException(Unknown Source) at org.hsqldb.jdbc.jdbcConnection.(Unknown Source) at org.hsqldb.jdbcDriver.getConnection(Unknown Source) at org.hsqldb.jdbcDriver.connect(Unknown Source) at java.sql.DriverManager.getConnection(DriverManager.java:582) at java.sql.DriverManager.getConnection(DriverManager.java:154) at org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) at org.hibernate.cfg.SettingsFactory.buildSettings(SettingsFactory.java:111) at org.hibernate.cfg.Configuration.buildSettings(Configuration.java:2101) at org.hibernate.cfg.Configuration.buildSessionFactory(Configuration.java:1325) at se.kanit.projectmgr.db.HibernateUtil.(HibernateUtil.java:24) at se.kanit.web.projectmgr.server.issues.IssuesService.addIssue(IssuesService.java:26) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at com.google.gwt.user.server.rpc.RPC.invokeAndEncodeResponse(RPC.java:562) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processCall(RemoteServiceServlet.java:188) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processPost(RemoteServiceServlet.java:224) at com.google.gwt.user.server.rpc.AbstractRemoteServiceServlet.doPost(AbstractRemoteServiceServlet.java:62) at javax.servlet.http.HttpServlet.service(HttpServlet.java:713) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.content(HttpConnection.java:938) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:755) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:218) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) 3626 [21704474@qtp-26509496-0] INFO org.hibernate.dialect.Dialect - Using dialect: org.hibernate.dialect.HSQLDialect 3640 [21704474@qtp-26509496-0] INFO org.hibernate.transaction.TransactionFactoryFactory - Using default transaction strategy (direct JDBC transactions) 3644 [21704474@qtp-26509496-0] INFO org.hibernate.transaction.TransactionManagerLookupFactory - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 3644 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Automatic flush during beforeCompletion(): disabled 3644 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Automatic session close at end of transaction: disabled 3645 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Scrollable result sets: disabled 3645 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - JDBC3 getGeneratedKeys(): disabled 3645 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Connection release mode: auto 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Default batch fetch size: 1 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Generate SQL with comments: disabled 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Order SQL updates by primary key: disabled 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Order SQL inserts for batching: disabled 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Query translator: org.hibernate.hql.ast.ASTQueryTranslatorFactory 3651 [21704474@qtp-26509496-0] INFO org.hibernate.hql.ast.ASTQueryTranslatorFactory - Using ASTQueryTranslatorFactory 3651 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Query language substitutions: {} 3652 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - JPA-QL strict compliance: disabled 3652 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Second-level cache: enabled 3652 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Query cache: disabled 3664 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Cache region factory : org.hibernate.cache.impl.bridge.RegionFactoryCacheProviderBridge 3665 [21704474@qtp-26509496-0] INFO org.hibernate.cache.impl.bridge.RegionFactoryCacheProviderBridge - Cache provider: org.hibernate.cache.NoCacheProvider 3666 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Optimize cache for minimal puts: disabled 3666 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Structured second-level cache entries: disabled 3678 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Statistics: disabled 3678 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Deleted entity synthetic identifier rollback: disabled 3678 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Default entity-mode: pojo 3679 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Named query checking : enabled 3775 [21704474@qtp-26509496-0] INFO org.hibernate.impl.SessionFactoryImpl - building session factory 4155 [21704474@qtp-26509496-0] INFO org.hibernate.impl.SessionFactoryObjectFactory - Not binding factory to JNDI, no JNDI name configured 4170 [21704474@qtp-26509496-0] INFO org.hibernate.tool.hbm2ddl.SchemaUpdate - Running hbm2ddl schema update 4170 [21704474@qtp-26509496-0] INFO org.hibernate.tool.hbm2ddl.SchemaUpdate - fetching database metadata 4171 [21704474@qtp-26509496-0] ERROR org.hibernate.tool.hbm2ddl.SchemaUpdate - could not get database metadata java.sql.SQLException: socket creation error at org.hsqldb.jdbc.Util.sqlException(Unknown Source) at org.hsqldb.jdbc.jdbcConnection.(Unknown Source) at org.hsqldb.jdbcDriver.getConnection(Unknown Source) at org.hsqldb.jdbcDriver.connect(Unknown Source) at java.sql.DriverManager.getConnection(DriverManager.java:582) at java.sql.DriverManager.getConnection(DriverManager.java:154) at org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) at org.hibernate.tool.hbm2ddl.SuppliedConnectionProviderConnectionHelper.prepare(SuppliedConnectionProviderConnectionHelper.java:51) at org.hibernate.tool.hbm2ddl.SchemaUpdate.execute(SchemaUpdate.java:168) at org.hibernate.impl.SessionFactoryImpl.(SessionFactoryImpl.java:346) at org.hibernate.cfg.Configuration.buildSessionFactory(Configuration.java:1327) at se.kanit.projectmgr.db.HibernateUtil.(HibernateUtil.java:24) at se.kanit.web.projectmgr.server.issues.IssuesService.addIssue(IssuesService.java:26) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at com.google.gwt.user.server.rpc.RPC.invokeAndEncodeResponse(RPC.java:562) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processCall(RemoteServiceServlet.java:188) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processPost(RemoteServiceServlet.java:224) at com.google.gwt.user.server.rpc.AbstractRemoteServiceServlet.doPost(AbstractRemoteServiceServlet.java:62) at javax.servlet.http.HttpServlet.service(HttpServlet.java:713) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.content(HttpConnection.java:938) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:755) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:218) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) 4172 [21704474@qtp-26509496-0] ERROR org.hibernate.tool.hbm2ddl.SchemaUpdate - could not complete schema update java.sql.SQLException: socket creation error at org.hsqldb.jdbc.Util.sqlException(Unknown Source) at org.hsqldb.jdbc.jdbcConnection.(Unknown Source) at org.hsqldb.jdbcDriver.getConnection(Unknown Source) at org.hsqldb.jdbcDriver.connect(Unknown Source) at java.sql.DriverManager.getConnection(DriverManager.java:582) at java.sql.DriverManager.getConnection(DriverManager.java:154) at org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) at org.hibernate.tool.hbm2ddl.SuppliedConnectionProviderConnectionHelper.prepare(SuppliedConnectionProviderConnectionHelper.java:51) at org.hibernate.tool.hbm2ddl.SchemaUpdate.execute(SchemaUpdate.java:168) at org.hibernate.impl.SessionFactoryImpl.(SessionFactoryImpl.java:346) at org.hibernate.cfg.Configuration.buildSessionFactory(Configuration.java:1327) at se.kanit.projectmgr.db.HibernateUtil.(HibernateUtil.java:24) at se.kanit.web.projectmgr.server.issues.IssuesService.addIssue(IssuesService.java:26) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at com.google.gwt.user.server.rpc.RPC.invokeAndEncodeResponse(RPC.java:562) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processCall(RemoteServiceServlet.java:188) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processPost(RemoteServiceServlet.java:224) at com.google.gwt.user.server.rpc.AbstractRemoteServiceServlet.doPost(AbstractRemoteServiceServlet.java:62) at javax.servlet.http.HttpServlet.service(HttpServlet.java:713) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.content(HttpConnection.java:938) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:755) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:218) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) 4293 [21704474@qtp-26509496-0] WARN org.hibernate.util.JDBCExceptionReporter - SQL Error: -80, SQLState: 08000 4293 [21704474@qtp-26509496-0] ERROR org.hibernate.util.JDBCExceptionReporter - socket creation error Cannot open connection org.hibernate.exception.JDBCConnectionException: Cannot open connection at org.hibernate.exception.SQLStateConverter.convert(SQLStateConverter.java:97) at org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:66) at org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:52) at org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:449) at org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) at org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) at org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) at org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1353) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:342) at $Proxy7.beginTransaction(Unknown Source) at se.kanit.projectmgr.db.HibernateUtil.saveOrUpdate(HibernateUtil.java:115) at se.kanit.web.projectmgr.server.issues.IssuesService.addIssue(IssuesService.java:26) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at com.google.gwt.user.server.rpc.RPC.invokeAndEncodeResponse(RPC.java:562) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processCall(RemoteServiceServlet.java:188) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processPost(RemoteServiceServlet.java:224) at com.google.gwt.user.server.rpc.AbstractRemoteServiceServlet.doPost(AbstractRemoteServiceServlet.java:62) at javax.servlet.http.HttpServlet.service(HttpServlet.java:713) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.content(HttpConnection.java:938) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:755) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:218) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) Caused by: java.sql.SQLException: socket creation error at org.hsqldb.jdbc.Util.sqlException(Unknown Source) at org.hsqldb.jdbc.jdbcConnection.(Unknown Source) at org.hsqldb.jdbcDriver.getConnection(Unknown Source) at org.hsqldb.jdbcDriver.connect(Unknown Source) at java.sql.DriverManager.getConnection(DriverManager.java:582) at java.sql.DriverManager.getConnection(DriverManager.java:154) at org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) at org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:446) ... 49 more Any tips and ideas are greatly appreciated. Cheers. Toby.

    Read the article

  • Android app crashes on emulator - logCat shows no errors

    - by David Miler
    I have just added the SherlockActionBar library to my android project. After some small changes (FragmentActivity - SherlockFragmentActivity, getActionBar() - getSupportActionBar(), imports) it all compiled nicely. After I run the app, however, the debugger stops, as though it had encountered an exception. However, there are no errors shown in the LogCat output. I just can't wrap my head around what's going on. Here is the logCat output after I terminate the app. 10-02 14:11:19.227: I/SystemUpdateService(174): UpdateTask at time 1349187079227 10-02 14:11:19.237: I/ActivityThread(328): Pub com.android.email.attachmentprovider: com.android.email.provider.AttachmentProvider 10-02 14:11:19.687: I/dalvikvm(81): Jit: resizing JitTable from 512 to 1024 10-02 14:11:19.809: D/MediaScannerService(150): start scanning volume internal: [/system/media] 10-02 14:11:20.047: V/AlarmClock(239): AlarmInitReceiver finished 10-02 14:11:20.087: I/ActivityManager(81): Start proc com.android.quicksearchbox for broadcast com.android.quicksearchbox/.SearchWidgetProvider: pid=346 uid=10012 gids={3003} 10-02 14:11:20.127: D/ExchangeService(320): !!! EAS ExchangeService, onStartCommand, startingUp = false, running = false 10-02 14:11:20.427: I/ActivityThread(346): Pub com.android.quicksearchbox.google: com.android.quicksearchbox.google.GoogleSuggestionProvider 10-02 14:11:20.497: I/ActivityThread(346): Pub com.android.quicksearchbox.shortcuts: com.android.quicksearchbox.ShortcutsProvider 10-02 14:11:20.657: I/ActivityManager(81): Start proc com.android.music for broadcast com.android.music/.MediaAppWidgetProvider: pid=358 uid=10028 gids={3003, 1015} 10-02 14:11:20.927: D/ExchangeService(320): !!! EAS ExchangeService, onCreate 10-02 14:11:20.967: D/dalvikvm(260): GC_CONCURRENT freed 213K, 6% free 6409K/6791K, paused 5ms+101ms 10-02 14:11:21.077: D/ExchangeService(320): !!! EAS ExchangeService, onStartCommand, startingUp = true, running = false 10-02 14:11:21.567: D/GTalkService(174): [ReonnectMgr] ### report Inet condition: status=false, networkType=0 10-02 14:11:21.587: D/ConnectivityService(81): reportNetworkCondition(0, 0) 10-02 14:11:21.597: D/ConnectivityService(81): Inet connectivity change, net=0, condition=0,mActiveDefaultNetwork=0 10-02 14:11:21.597: D/ConnectivityService(81): starting a change hold 10-02 14:11:21.697: D/GTalkService(174): [RawStanzaProvidersMgr] ##### searchProvidersFromIntent 10-02 14:11:21.697: D/GTalkService(174): [RawStanzaProvidersMgr] no intent receivers found 10-02 14:11:21.847: I/SystemUpdateService(174): cancelUpdate (empty URL) 10-02 14:11:21.847: E/TelephonyManager(174): Hidden constructor called more than once per process! 10-02 14:11:21.867: D/dalvikvm(174): GC_CONCURRENT freed 337K, 7% free 6561K/7047K, paused 5ms+4ms 10-02 14:11:21.917: D/GTalkService(174): [ReonnectMgr] ### report Inet condition: status=false, networkType=0 10-02 14:11:21.917: D/ConnectivityService(81): reportNetworkCondition(0, 0) 10-02 14:11:21.917: D/ConnectivityService(81): Inet connectivity change, net=0, condition=0,mActiveDefaultNetwork=0 10-02 14:11:21.917: D/ConnectivityService(81): currently in hold - not setting new end evt 10-02 14:11:21.990: E/TelephonyManager(174): Original: com.google.android.location, new: com.google.android.gsf 10-02 14:11:22.027: I/SystemUpdateService(174): removeAllDownloads (cancelUpdate) 10-02 14:11:22.127: D/dalvikvm(328): GC_CONCURRENT freed 205K, 6% free 6506K/6855K, paused 660ms+3ms 10-02 14:11:22.197: D/Eas Debug(320): Logging: 10-02 14:11:22.319: D/dalvikvm(81): GREF has increased to 401 10-02 14:11:22.947: D/ExchangeService(320): !!! EAS ExchangeService, onStartCommand, startingUp = true, running = false 10-02 14:11:23.130: D/Eas Debug(320): Logging: 10-02 14:11:23.307: I//system/bin/fsck_msdos(29): Attempting to allocate 2044 KB for FAT 10-02 14:11:23.560: I/ActivityManager(81): Starting: Intent { flg=0x10000000 cmp=com.google.android.gsf/.update.SystemUpdateInstallDialog } from pid 174 10-02 14:11:23.587: I/ActivityManager(81): Starting: Intent { flg=0x10000000 cmp=com.google.android.gsf/.update.SystemUpdateDownloadDialog } from pid 174 10-02 14:11:24.087: W/ActivityManager(81): Activity pause timeout for ActivityRecord{407c7320 com.android.launcher/com.android.launcher2.Launcher} 10-02 14:11:24.237: E/TelephonyManager(174): Hidden constructor called more than once per process! 10-02 14:11:24.237: E/TelephonyManager(174): Original: com.google.android.location, new: com.google.android.gsf 10-02 14:11:24.507: D/dalvikvm(174): GC_EXPLICIT freed 231K, 7% free 6596K/7047K, paused 4ms+6ms 10-02 14:11:24.607: D/ConnectivityService(81): Inet hold end, net=0, condition =0, published condition =0 10-02 14:11:24.607: D/ConnectivityService(81): no change in condition - aborting 10-02 14:11:24.707: D/dalvikvm(174): GC_EXPLICIT freed 17K, 7% free 6579K/7047K, paused 4ms+4ms 10-02 14:11:24.947: I//system/bin/fsck_msdos(29): ** Phase 2 - Check Cluster Chains 10-02 14:11:25.117: I//system/bin/fsck_msdos(29): ** Phase 3 - Checking Directories 10-02 14:11:25.128: I//system/bin/fsck_msdos(29): ** Phase 4 - Checking for Lost Files 10-02 14:11:25.167: I//system/bin/fsck_msdos(29): 12 files, 1044448 free (522224 clusters) 10-02 14:11:25.227: I/Vold(29): Filesystem check completed OK 10-02 14:11:25.227: I/Vold(29): Device /dev/block/vold/179:0, target /mnt/sdcard mounted @ /mnt/secure/staging 10-02 14:11:25.237: D/Vold(29): Volume sdcard state changing 3 (Checking) -> 4 (Mounted) 10-02 14:11:25.257: I/PackageManager(81): Updating external media status from unmounted to mounted 10-02 14:11:25.457: D/dalvikvm(303): GC_EXPLICIT freed 35K, 6% free 6242K/6595K, paused 3ms+312ms 10-02 14:11:25.987: D/ExchangeService(320): !!! EAS ExchangeService, onStartCommand, startingUp = true, running = false 10-02 14:11:26.157: D/MediaScanner(150): prescan time: 2905ms 10-02 14:11:26.167: D/MediaScanner(150): scan time: 148ms 10-02 14:11:26.167: D/MediaScanner(150): postscan time: 2ms 10-02 14:11:26.167: D/MediaScanner(150): total time: 3055ms 10-02 14:11:26.197: D/MediaScannerService(150): done scanning volume internal 10-02 14:11:26.237: D/MediaScannerService(150): start scanning volume external: [/mnt/sdcard] 10-02 14:11:26.497: D/dalvikvm(143): GC_EXPLICIT freed 234K, 8% free 7735K/8327K, paused 3ms+5ms 10-02 14:11:27.180: D/dalvikvm(143): GC_CONCURRENT freed 150K, 4% free 8004K/8327K, paused 7ms+3ms 10-02 14:11:27.397: D/dalvikvm(143): GC_FOR_ALLOC freed 96K, 6% free 8310K/8775K, paused 76ms 10-02 14:11:27.580: D/dalvikvm(143): GC_FOR_ALLOC freed 515K, 11% free 8135K/9095K, paused 79ms 10-02 14:11:27.829: D/dalvikvm(143): GC_CONCURRENT freed 3K, 5% free 8694K/9095K, paused 7ms+6ms 10-02 14:11:28.137: V/TLINE(143): new: android.text.TextLine@4065b280 10-02 14:11:28.527: D/dalvikvm(143): GC_CONCURRENT freed 729K, 10% free 8764K/9671K, paused 5ms+13ms 10-02 14:11:28.677: D/dalvikvm(143): GC_FOR_ALLOC freed 152K, 11% free 8683K/9671K, paused 99ms 10-02 14:11:28.717: I/dalvikvm-heap(143): Grow heap (frag case) to 11.434MB for 2975968-byte allocation 10-02 14:11:28.807: D/dalvikvm(143): GC_FOR_ALLOC freed 0K, 9% free 11589K/12615K, paused 84ms 10-02 14:11:29.159: D/dalvikvm(143): GC_CONCURRENT freed 197K, 7% free 12195K/12999K, paused 8ms+6ms 10-02 14:11:29.647: D/dalvikvm(143): GC_EXPLICIT freed 351K, 6% free 12790K/13511K, paused 8ms+17ms 10-02 14:11:29.717: I/SurfaceFlinger(32): Boot is finished (70768 ms) 10-02 14:11:29.877: I/ARMAssembler(32): generated scanline__00000177:03010104_00000002_00000000 [ 44 ipp] (66 ins) at [0x407c7290:0x407c7398] in 990662 ns 10-02 14:11:29.907: I/ARMAssembler(32): generated scanline__00000177:03515104_00000001_00000000 [ 73 ipp] (95 ins) at [0x407c73a0:0x407c751c] in 989381 ns 10-02 14:11:30.287: D/dalvikvm(174): GC_EXPLICIT freed 25K, 8% free 6554K/7047K, paused 4ms+32ms 10-02 14:11:30.380: D/dalvikvm(143): GC_EXPLICIT freed 349K, 6% free 13124K/13895K, paused 5ms+25ms 10-02 14:11:30.957: D/dalvikvm(143): GC_FOR_ALLOC freed 1069K, 10% free 13860K/15239K, paused 81ms 10-02 14:11:32.177: D/dalvikvm(150): GC_CONCURRENT freed 183K, 6% free 6438K/6791K, paused 5ms+4ms 10-02 14:11:32.187: W/ActivityManager(81): No content provider found for: 10-02 14:11:32.607: V/MediaScanner(150): pruneDeadThumbnailFiles... android.database.sqlite.SQLiteCursor@406724a8 10-02 14:11:32.617: V/MediaScanner(150): /pruneDeadThumbnailFiles... android.database.sqlite.SQLiteCursor@406724a8 10-02 14:11:32.640: W/ActivityManager(81): No content provider found for: 10-02 14:11:32.640: D/VoldCmdListener(29): asec list 10-02 14:11:32.647: I/PackageManager(81): No secure containers on sdcard 10-02 14:11:32.667: D/MediaScanner(150): prescan time: 107ms 10-02 14:11:32.667: D/MediaScanner(150): scan time: 89ms 10-02 14:11:32.667: D/MediaScanner(150): postscan time: 61ms 10-02 14:11:32.667: D/MediaScanner(150): total time: 257ms 10-02 14:11:32.697: W/PackageManager(81): Unknown permission android.permission.ADD_SYSTEM_SERVICE in package com.android.phone 10-02 14:11:32.707: W/PackageManager(81): Unknown permission com.android.smspush.WAPPUSH_MANAGER_BIND in package com.android.phone 10-02 14:11:32.737: W/PackageManager(81): Not granting permission android.permission.SEND_DOWNLOAD_COMPLETED_INTENTS to package com.android.browser (protectionLevel=2 flags=0x9be45) 10-02 14:11:32.737: W/PackageManager(81): Not granting permission android.permission.BIND_APPWIDGET to package com.android.widgetpreview (protectionLevel=3 flags=0x28be44) 10-02 14:11:32.767: W/PackageManager(81): Unknown permission android.permission.READ_OWNER_DATA in package com.android.exchange 10-02 14:11:32.778: W/PackageManager(81): Unknown permission android.permission.READ_OWNER_DATA in package com.android.email 10-02 14:11:32.788: W/PackageManager(81): Unknown permission com.android.providers.im.permission.READ_ONLY in package com.google.android.apps.maps 10-02 14:11:32.797: W/PackageManager(81): Not granting permission android.permission.DEVICE_POWER to package com.android.deskclock (protectionLevel=2 flags=0x8be45) 10-02 14:11:33.137: D/MediaScannerService(150): done scanning volume external 10-02 14:11:33.197: D/PackageParser(81): Scanning package: /data/app/vmdl257911298.tmp 10-02 14:11:33.837: I/InputReader(81): Device reconfigured: id=0, name='qwerty2', surface size is now 1024x800 10-02 14:11:34.097: D/dalvikvm(81): GC_CONCURRENT freed 12185K, 47% free 13966K/26311K, paused 8ms+23ms 10-02 14:11:36.798: I/TabletStatusBar(124): DISABLE_CLOCK: no 10-02 14:11:36.798: I/TabletStatusBar(124): DISABLE_NAVIGATION: no 10-02 14:11:37.348: I/ARMAssembler(32): generated scanline__00000177:03515104_00001001_00000000 [ 91 ipp] (114 ins) at [0x407c7520:0x407c76e8] in 919320 ns 10-02 14:11:37.598: I/TabletStatusBar(124): DISABLE_BACK: no 10-02 14:11:37.710: I/ActivityManager(81): Displayed com.android.launcher/com.android.launcher2.Launcher: +46s212ms 10-02 14:11:38.817: D/dalvikvm(143): GC_CONCURRENT freed 969K, 8% free 14867K/16007K, paused 4ms+10ms 10-02 14:11:39.437: I/dalvikvm(81): Jit: resizing JitTable from 1024 to 2048 10-02 14:11:40.267: D/dalvikvm(143): GC_FOR_ALLOC freed 2357K, 16% free 14395K/17031K, paused 80ms 10-02 14:11:40.717: D/dalvikvm(143): GC_EXPLICIT freed 742K, 16% free 14358K/17031K, paused 8ms+4ms 10-02 14:11:41.617: D/dalvikvm(81): GC_CONCURRENT freed 1955K, 48% free 13869K/26311K, paused 9ms+10ms 10-02 14:11:42.559: D/dalvikvm(81): GC_CONCURRENT freed 1830K, 48% free 13881K/26311K, paused 9ms+9ms 10-02 14:11:42.758: I/PackageManager(81): Removing non-system package:cz.trilimi.sfaui 10-02 14:11:42.758: I/ActivityManager(81): Force stopping package cz.trilimi.sfaui uid=10036 10-02 14:11:42.967: D/PackageManager(81): Scanning package cz.trilimi.sfaui 10-02 14:11:42.967: I/PackageManager(81): Package cz.trilimi.sfaui codePath changed from /data/app/cz.trilimi.sfaui-1.apk to /data/app/cz.trilimi.sfaui-2.apk; Retaining data and using new 10-02 14:11:42.967: I/PackageManager(81): Unpacking native libraries for /data/app/cz.trilimi.sfaui-2.apk 10-02 14:11:43.097: D/installd(35): DexInv: --- BEGIN '/data/app/cz.trilimi.sfaui-2.apk' --- 10-02 14:11:45.317: D/dalvikvm(391): DexOpt: load 434ms, verify+opt 1260ms 10-02 14:11:45.407: D/installd(35): DexInv: --- END '/data/app/cz.trilimi.sfaui-2.apk' (success) --- 10-02 14:11:45.407: W/PackageManager(81): Code path for pkg : cz.trilimi.sfaui changing from /data/app/cz.trilimi.sfaui-1.apk to /data/app/cz.trilimi.sfaui-2.apk 10-02 14:11:45.407: W/PackageManager(81): Resource path for pkg : cz.trilimi.sfaui changing from /data/app/cz.trilimi.sfaui-1.apk to /data/app/cz.trilimi.sfaui-2.apk 10-02 14:11:45.407: D/PackageManager(81): Activities: cz.trilimi.sfaui.ItemListActivity cz.trilimi.sfaui.ItemDetailActivity 10-02 14:11:45.427: I/ActivityManager(81): Force stopping package cz.trilimi.sfaui uid=10036 10-02 14:11:45.657: I/installd(35): move /data/dalvik-cache/data@[email protected]@classes.dex -> /data/dalvik-cache/data@[email protected]@classes.dex 10-02 14:11:45.657: D/PackageManager(81): New package installed in /data/app/cz.trilimi.sfaui-2.apk 10-02 14:11:45.997: I/ActivityManager(81): Force stopping package cz.trilimi.sfaui uid=10036 10-02 14:11:46.147: D/dalvikvm(143): GC_EXPLICIT freed 3K, 16% free 14356K/17031K, paused 10ms+9ms 10-02 14:11:46.237: D/PackageManager(81): generateServicesMap(android.accounts.AccountAuthenticator): 3 services unchanged 10-02 14:11:46.277: D/PackageManager(81): generateServicesMap(android.content.SyncAdapter): 5 services unchanged 10-02 14:11:46.337: D/PackageManager(81): generateServicesMap(android.accounts.AccountAuthenticator): 3 services unchanged 10-02 14:11:46.347: D/PackageManager(81): generateServicesMap(android.content.SyncAdapter): 5 services unchanged 10-02 14:11:46.437: D/dalvikvm(208): GC_EXPLICIT freed 258K, 7% free 6488K/6919K, paused 3ms+5ms 10-02 14:11:46.477: W/RecognitionManagerService(81): no available voice recognition services found 10-02 14:11:46.897: I/ActivityManager(81): Start proc com.svox.pico for broadcast com.svox.pico/.VoiceDataInstallerReceiver: pid=398 uid=10006 gids={} 10-02 14:11:47.087: I/ActivityThread(398): Pub com.svox.pico.providers.SettingsProvider: com.svox.pico.providers.SettingsProvider 10-02 14:11:47.138: D/GTalkService(174): [GTalkService.1] handlePackageInstalled: re-initialize providers 10-02 14:11:47.147: D/GTalkService(174): [RawStanzaProvidersMgr] ##### searchProvidersFromIntent 10-02 14:11:47.147: D/GTalkService(174): [RawStanzaProvidersMgr] no intent receivers found 10-02 14:11:47.718: I/AccountTypeManager(208): Loaded meta-data for 1 account types, 0 accounts in 186ms 10-02 14:11:48.377: D/dalvikvm(143): GC_CONCURRENT freed 1865K, 15% free 14513K/17031K, paused 7ms+4ms 10-02 14:11:48.917: D/dalvikvm(208): GC_CONCURRENT freed 219K, 6% free 6788K/7175K, paused 7ms+73ms 10-02 14:11:49.207: D/dalvikvm(143): GC_FOR_ALLOC freed 4558K, 31% free 11866K/17031K, paused 89ms 10-02 14:11:49.587: D/dalvikvm(143): GC_CONCURRENT freed 713K, 24% free 13010K/17031K, paused 5ms+4ms 10-02 14:11:49.967: D/dalvikvm(143): GC_CONCURRENT freed 1046K, 19% free 13922K/17031K, paused 5ms+4ms 10-02 14:11:50.437: D/dalvikvm(81): GC_EXPLICIT freed 898K, 47% free 13955K/26311K, paused 6ms+39ms 10-02 14:11:50.467: I/installd(35): unlink /data/dalvik-cache/data@[email protected]@classes.dex 10-02 14:11:50.477: D/AndroidRuntime(227): Shutting down VM 10-02 14:11:50.507: D/dalvikvm(227): GC_CONCURRENT freed 97K, 84% free 331K/2048K, paused 1ms+2ms 10-02 14:11:50.507: I/AndroidRuntime(227): NOTE: attach of thread 'Binder Thread #3' failed 10-02 14:11:50.517: D/jdwp(227): adbd disconnected 10-02 14:11:51.177: D/AndroidRuntime(410): >>>>>> AndroidRuntime START com.android.internal.os.RuntimeInit <<<<<< 10-02 14:11:51.177: D/AndroidRuntime(410): CheckJNI is ON 10-02 14:11:51.897: D/AndroidRuntime(410): Calling main entry com.android.commands.am.Am 10-02 14:11:51.937: I/ActivityManager(81): Force stopping package cz.trilimi.sfaui uid=10036 10-02 14:11:51.937: I/ActivityManager(81): Starting: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=cz.trilimi.sfaui/.ItemListActivity } from pid 410 10-02 14:11:51.968: W/WindowManager(81): Failure taking screenshot for (230x179) to layer 21005 10-02 14:11:51.997: I/ActivityManager(81): Start proc cz.trilimi.sfaui for activity cz.trilimi.sfaui/.ItemListActivity: pid=418 uid=10036 gids={} 10-02 14:11:52.007: D/AndroidRuntime(410): Shutting down VM 10-02 14:11:52.057: I/AndroidRuntime(410): NOTE: attach of thread 'Binder Thread #3' failed 10-02 14:11:52.097: D/dalvikvm(410): GC_CONCURRENT freed 98K, 83% free 360K/2048K, paused 1ms+0ms 10-02 14:11:52.097: D/jdwp(410): adbd disconnected 10-02 14:11:53.147: W/ActivityThread(418): Application cz.trilimi.sfaui is waiting for the debugger on port 8100... 10-02 14:11:53.207: I/System.out(418): Sending WAIT chunk 10-02 14:11:53.217: I/dalvikvm(418): Debugger is active 10-02 14:11:53.447: I/System.out(418): Debugger has connected 10-02 14:11:53.457: I/System.out(418): waiting for debugger to settle... 10-02 14:11:53.637: I/ARMAssembler(32): generated scanline__00000177:03515104_00001002_00000000 [ 87 ipp] (110 ins) at [0x407c76f0:0x407c78a8] in 598498 ns 10-02 14:11:53.660: I/System.out(418): waiting for debugger to settle... 10-02 14:11:53.857: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.057: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.257: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.317: V/TLINE(81): new: android.text.TextLine@4155dde8 10-02 14:11:54.467: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.667: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.870: I/System.out(418): waiting for debugger to settle... 10-02 14:11:55.027: D/dalvikvm(143): GC_EXPLICIT freed 900K, 16% free 14420K/17031K, paused 7ms+4ms 10-02 14:11:55.067: I/System.out(418): waiting for debugger to settle... 10-02 14:11:55.292: I/System.out(418): debugger has settled (1315) 10-02 14:12:02.008: W/ActivityManager(81): Launch timeout has expired, giving up wake lock! 10-02 14:12:02.971: W/ActivityManager(81): Activity idle timeout for ActivityRecord{4078c6b0 cz.trilimi.sfaui/.ItemListActivity} 10-02 14:12:08.359: D/ExchangeService(320): Received deviceId from Email app: androidc259148960 10-02 14:12:08.507: D/ExchangeService(320): Reconciling accounts... 10-02 14:16:11.437: D/SntpClient(81): request time failed: java.net.SocketException: Address family not supported by protocol 10-02 14:17:21.573: W/jdwp(418): Debugger is telling the VM to exit with code=1 10-02 14:17:21.573: I/dalvikvm(418): GC lifetime allocation: 8642 bytes 10-02 14:17:21.637: D/Zygote(33): Process 418 exited cleanly (1) 10-02 14:17:21.651: I/ActivityManager(81): Process cz.trilimi.sfaui (pid 418) has died. 10-02 14:17:21.847: D/dalvikvm(143): GC_EXPLICIT freed <1K, 16% free 14420K/17031K, paused 7ms+7ms 10-02 14:17:21.917: W/InputManagerService(81): Window already focused, ignoring focus gain of: com.android.internal.view.IInputMethodClient$Stub$Proxy@40bfbf28

    Read the article

  • Problems with inheritance query view and one to many association in entity framework 4

    - by Kazys
    Hi, I have situation in with I stucked and don't know way out. The problem is in my bigger model, but I have made small example which shows the same problem. I have 4 tables. I called them SuperParent, NamedParent, TypedParent and ParentType. NamedParent and TypedParent derives from superParent. TypedParent has one to many association with ParentType. I describe mapping for entities using queryView. The problem is then I want to get TypedParents and Include ParentType I get the following exception: An error occurred while preparing the command definition. See the inner exception for details. --- System.ArgumentException: The ResultType of the specified expression is not compatible with the required type. The expression ResultType is 'Transient.reference[PasibandymaiModel.SuperParent]' but the required type is 'Transient.reference[PasibandymaiModel.TypedParent]'. Parameter name: arguments[1] To get TypedParents I use following code: context.SuperParent.OfType().Include("ParentType"); my edmx file: <edmx:Edmx Version="2.0" xmlns:edmx="http://schemas.microsoft.com/ado/2008/10/edmx"> <!-- EF Runtime content --> <edmx:Runtime> <!-- SSDL content --> <edmx:StorageModels> <Schema Namespace="PasibandymaiModel.Store" Alias="Self" Provider="System.Data.SqlClient" ProviderManifestToken="2005" xmlns:store="http://schemas.microsoft.com/ado/2007/12/edm/EntityStoreSchemaGenerator" xmlns="http://schemas.microsoft.com/ado/2009/02/edm/ssdl"> <EntityContainer Name="PasibandymaiModelStoreContainer"> <EntitySet Name="NamedParent" EntityType="PasibandymaiModel.Store.NamedParent" store:Type="Tables" Schema="dbo" /> <EntitySet Name="ParentType" EntityType="PasibandymaiModel.Store.ParentType" store:Type="Tables" Schema="dbo" /> <EntitySet Name="SuperParent" EntityType="PasibandymaiModel.Store.SuperParent" store:Type="Tables" Schema="dbo" /> <EntitySet Name="TypedParent" EntityType="PasibandymaiModel.Store.TypedParent" store:Type="Tables" Schema="dbo" /> <AssociationSet Name="fk_NamedParent_SuperParent" Association="PasibandymaiModel.Store.fk_NamedParent_SuperParent"> <End Role="SuperParent" EntitySet="SuperParent" /> <End Role="NamedParent" EntitySet="NamedParent" /> </AssociationSet> <AssociationSet Name="fk_TypedParent_ParentType" Association="PasibandymaiModel.Store.fk_TypedParent_ParentType"> <End Role="ParentType" EntitySet="ParentType" /> <End Role="TypedParent" EntitySet="TypedParent" /> </AssociationSet> <AssociationSet Name="fk_TypedParent_SuperParent" Association="PasibandymaiModel.Store.fk_TypedParent_SuperParent"> <End Role="SuperParent" EntitySet="SuperParent" /> <End Role="TypedParent" EntitySet="TypedParent" /> </AssociationSet> </EntityContainer> <EntityType Name="NamedParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" /> <Property Name="Name" Type="nvarchar" Nullable="false" MaxLength="100" /> </EntityType> <EntityType Name="ParentType"> <Key> <PropertyRef Name="ParentTypeId" /> </Key> <Property Name="ParentTypeId" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="Name" Type="nvarchar" MaxLength="100" /> </EntityType> <EntityType Name="SuperParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="SomeAttribute" Type="nvarchar" Nullable="false" MaxLength="100" /> </EntityType> <EntityType Name="TypedParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" /> <Property Name="ParentTypeId" Type="int" Nullable="false"/> </EntityType> <Association Name="fk_NamedParent_SuperParent"> <End Role="SuperParent" Type="PasibandymaiModel.Store.SuperParent" Multiplicity="1" /> <End Role="NamedParent" Type="PasibandymaiModel.Store.NamedParent" Multiplicity="0..1" /> <ReferentialConstraint> <Principal Role="SuperParent"> <PropertyRef Name="ParentId" /> </Principal> <Dependent Role="NamedParent"> <PropertyRef Name="ParentId" /> </Dependent> </ReferentialConstraint> </Association> <Association Name="fk_TypedParent_ParentType"> <End Role="ParentType" Type="PasibandymaiModel.Store.ParentType" Multiplicity="1" /> <End Role="TypedParent" Type="PasibandymaiModel.Store.TypedParent" Multiplicity="*" /> <ReferentialConstraint> <Principal Role="ParentType"> <PropertyRef Name="ParentTypeId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentTypeId" /> </Dependent> </ReferentialConstraint> </Association> <Association Name="fk_TypedParent_SuperParent"> <End Role="SuperParent" Type="PasibandymaiModel.Store.SuperParent" Multiplicity="1" /> <End Role="TypedParent" Type="PasibandymaiModel.Store.TypedParent" Multiplicity="0..1" /> <ReferentialConstraint> <Principal Role="SuperParent"> <PropertyRef Name="ParentId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentId" /> </Dependent> </ReferentialConstraint> </Association> <Function Name="ChildDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ChildId" Type="int" Mode="In" /> </Function> <Function Name="ChildInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="ChildUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ChildId" Type="int" Mode="In" /> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="NamedParentDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="NamedParentInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> </Function> <Function Name="NamedParentUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="ParentTypeDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> </Function> <Function Name="ParentTypeInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="ParentTypeUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="TypedParentDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="TypedParentInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> </Function> <Function Name="TypedParentUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> </Function> </Schema> </edmx:StorageModels> <!-- CSDL content --> <edmx:ConceptualModels> <Schema Namespace="PasibandymaiModel" Alias="Self" xmlns:annotation="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns="http://schemas.microsoft.com/ado/2008/09/edm"> <EntityContainer Name="PasibandymaiEntities" annotation:LazyLoadingEnabled="true"> <EntitySet Name="ParentType" EntityType="PasibandymaiModel.ParentType" /> <EntitySet Name="SuperParent" EntityType="PasibandymaiModel.SuperParent" /> <AssociationSet Name="ParentTypeTypedParent" Association="PasibandymaiModel.ParentTypeTypedParent"> <End Role="ParentType" EntitySet="ParentType" /> <End Role="TypedParent" EntitySet="SuperParent" /> </AssociationSet> </EntityContainer> <EntityType Name="NamedParent" BaseType="PasibandymaiModel.SuperParent"> <Property Type="String" Name="Name" Nullable="false" MaxLength="100" FixedLength="false" Unicode="true" /> </EntityType> <EntityType Name="ParentType"> <Key> <PropertyRef Name="ParentTypeId" /> </Key> <Property Type="Int32" Name="ParentTypeId" Nullable="false" annotation:StoreGeneratedPattern="Identity" /> <Property Type="String" Name="Name" MaxLength="100" FixedLength="false" Unicode="true" /> <NavigationProperty Name="TypedParent" Relationship="PasibandymaiModel.ParentTypeTypedParent" FromRole="ParentType" ToRole="TypedParent" /> </EntityType> <EntityType Name="SuperParent" Abstract="true"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Type="Int32" Name="ParentId" Nullable="false" annotation:StoreGeneratedPattern="Identity" /> <Property Type="String" Name="SomeAttribute" Nullable="false" MaxLength="100" FixedLength="false" Unicode="true" /> </EntityType> <EntityType Name="TypedParent" BaseType="PasibandymaiModel.SuperParent"> <NavigationProperty Name="ParentType" Relationship="PasibandymaiModel.ParentTypeTypedParent" FromRole="TypedParent" ToRole="ParentType" /> <Property Type="Int32" Name="ParentTypeId" Nullable="false" /> </EntityType> <Association Name="ParentTypeTypedParent"> <End Type="PasibandymaiModel.ParentType" Role="ParentType" Multiplicity="1" /> <End Type="PasibandymaiModel.TypedParent" Role="TypedParent" Multiplicity="*" /> <ReferentialConstraint> <Principal Role="ParentType"> <PropertyRef Name="ParentTypeId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentTypeId" /> </Dependent> </ReferentialConstraint> </Association> </Schema> </edmx:ConceptualModels> <!-- C-S mapping content --> <edmx:Mappings> <Mapping Space="C-S" xmlns="http://schemas.microsoft.com/ado/2008/09/mapping/cs"> <EntityContainerMapping StorageEntityContainer="PasibandymaiModelStoreContainer" CdmEntityContainer="PasibandymaiEntities"> <EntitySetMapping Name="ParentType"> <QueryView> SELECT VALUE PasibandymaiModel.ParentType(tp.ParentTypeId, tp.Name) FROM PasibandymaiModelStoreContainer.ParentType AS tp </QueryView> </EntitySetMapping> <EntitySetMapping Name="SuperParent"> <QueryView> SELECT VALUE CASE WHEN (np.ParentId IS NOT NULL) THEN PasibandymaiModel.NamedParent(sp.ParentId, sp.SomeAttribute, np.Name) WHEN (tp.ParentId IS NOT NULL) THEN PasibandymaiModel.TypedParent(sp.ParentId, sp.SomeAttribute, tp.ParentTypeId) END FROM PasibandymaiModelStoreContainer.SuperParent AS sp LEFT JOIN PasibandymaiModelStoreContainer.NamedParent AS np ON sp.ParentId = np.ParentId LEFT JOIN PasibandymaiModelStoreContainer.TypedParent AS tp ON sp.ParentId = tp.ParentId </QueryView> <QueryView TypeName="PasibandymaiModel.TypedParent"> SELECT VALUE PasibandymaiModel.TypedParent(sp.ParentId, sp.SomeAttribute, tp.ParentTypeId) FROM PasibandymaiModelStoreContainer.SuperParent AS sp INNER JOIN PasibandymaiModelStoreContainer.TypedParent AS tp ON sp.ParentId = tp.ParentId </QueryView> <QueryView TypeName="PasibandymaiModel.NamedParent"> SELECT VALUE PasibandymaiModel.NamedParent(sp.ParentId, sp.SomeAttribute, np.Name) FROM PasibandymaiModelStoreContainer.SuperParent AS sp INNER JOIN PasibandymaiModelStoreContainer.NamedParent AS np ON sp.ParentId = np.ParentId </QueryView> </EntitySetMapping> </EntityContainerMapping> </Mapping> </edmx:Mappings> </edmx:Runtime> </edmx:Edmx> I have tried using AssociationSetMapping instead of using Association with ReferentialConstraint. But then couldn't insert related entities at once, becouse entity framework didn't provided entity key of inserted entities for related entities. Thanks for any idea

    Read the article

< Previous Page | 412 413 414 415 416 417 418 419 420 421 422 423  | Next Page >