Search Results

Search found 30243 results on 1210 pages for 'protein database'.

Page 417/1210 | < Previous Page | 413 414 415 416 417 418 419 420 421 422 423 424  | Next Page >

  • Ruby On Rails : db:migrate do not run

    - by user332219
    Hi, When i run this command i have an error : rake db:migrate --trace rake aborted! NoMethodError: undefined method `ord' for 0:Fixnum: SET NAMES 'utf8' see the log file here : http://patxi.mayol.free.fr/public/trace.txt my database.yml file is here : MySQL. Versions 4.1 and 5.0 are recommended. # development: adapter: mysql encoding: utf8 reconnect: false database: annuaire_development pool: 5 username: root password: host: 127.0.0.1 test: adapter: mysql encoding: utf8 reconnect: false database: annuaire_test pool: 5 username: root password: host: 127.0.0.1 production: adapter: mysql encoding: utf8 reconnect: false database: annuaire_production pool: 5 username: root password: host: 127.0.0.1 Thanks My config : WampServer 2.0 with MySQL 5.0.51a Aptana 2.0.4 Ruby 1.8.5 Gems: actionmailer (2.3.4, 2.3.2) actionpack (2.3.4, 2.3.2) activerecord (2.3.4, 2.3.2) activeresource (2.3.4, 2.3.2) activesupport (2.3.4, 2.3.2) cgi_multipart_eof_fix (2.5.0) fastthread (1.0.1) gem_plugin (0.2.3) linecache (0.43) mongrel (1.1.5) mysql (2.8.1, 2.7.3) rack (1.0.0) rails (2.3.4, 2.3.2) rake (0.8.7) ruby-debug-base (0.10.3) ruby-debug-ide (0.4.5) sqlite3-ruby (1.2.1)

    Read the article

  • SQL script to show addition to tables

    - by andreas
    Hey all I have a 2 MS SQL 2005 databases,a TEST and DEV database. Now our developer added some extra columns,tables etc in the DEV database.This created differences in the TEST database.is there a script i can write tha can tell me what the changes where in the DEV database between certain dates...i found a couple of tools but they are quite basic and dont really generate change scripts etc. Also tried the change script function in management studio but it seems to be working when the change is first made and not later. Appreciate your thoughts. A.

    Read the article

  • datagrid speed issue

    - by girish
    i m binding gridview in asp.net application... i m about to bind some thousand records in datagrid... on RowDataBound event of the grid i need to check if the log in user is authorised to view the perticuler record...so i need to send database request...like wise such other two to three operation requires to send request to database.... about three to four request are sended to database during each row bound of the gridview...is it effective on speed of the grid?

    Read the article

  • SSPI Errors for SQL Server Authentication?!

    - by Nathan
    We have several old ASP and PHP web applications which use SQL Server Authentication. Periodically, all the applications lose the ability to connect to our SQL Server 2000 database server, getting access denied. Corresponding to roughly the same times, we are getting 1115 Cannot generate SSPI Context SQLSTATE HY000 errors on the SQLServer 2000 server. And here's the weird part - rebooting the web server fixes the problem. Rebooting the database server has no effect. This makes no sense to me - I didn't think SSPI was in any way involved with SQL Server Authentication. Any ideas? Edit: Some additional details: The web server is in the DMZ. The hosts file on the web server has an entry for the database server (and the ip address is correct), so the web server (theoretically at least) shouldn't even be going to DNS to connect to the database server. It does not appear to be a firewall issue.

    Read the article

  • EXCEL import to sql returning NULL for decimals when in VARCHAR data type

    - by Daniel
    Hi, I am working on a peice of software which has expodentially grown over the last few years and the database needs to be regularly updated. Customers are providing us with data now on large spreadsheets which we format and will start importing into the database. I am using the Import and Export Data (32-bit) Wizard. One column in the database contains values like '1.1.1.2' etc and i am importing them in as a Varchar as that is the data type in the database. However, for values like '8.5', 'NULL' is getting imported insead. It only occurs when there is one decimal point. Is this a formatting error with excel or is it the wrong datatype?

    Read the article

  • Error when creating an image from a UIView

    - by Raphael Pinto
    Hi, I'm creating an image from a view whith the folowing code : UIGraphicsBeginImageContext(myView.bounds.size); [myView.layer renderInContext:UIGraphicsGetCurrentContext()]; UIImage *viewImage = UIGraphicsGetImageFromCurrentImageContext(); UIGraphicsEndImageContext(); UIImageWriteToSavedPhotosAlbum(viewImage, nil, nil, nil); The image is created in the user album but in the consol I get this : 2010-05-11 10:17:17.974 myApp[3875:1807] sqlite error 8 [attempt to write a readonly database] 2010-05-11 10:17:18.014 myApp[3875:1807] Backtrace for sqlite error: (0x34e3a909 0x34e3d87f 0x34e3b029 0x34e3b22b 0x34e2f48b 0x34e2dccb 0x34e2d2f7 0x34e2d3bb 0x34e4dcd3 0x34e50515 0x34e51351 0x34e51681 0x34e513f5 0x34e511e3 0x303af57c 0x34e51163 0x303b06e8 0x303ac8e0 0x303ac6d8 0x303ac8c8 0x303aca80 0x30350d55 0x3034a12c) 2010-05-11 10:17:18.077 myApp[3875:1807] sqlite error 8 [attempt to write a readonly database] 2010-05-11 10:17:18.087 myApp[3875:1807] Backtrace for sqlite error: (0x34e3a909 0x34e3b053 0x34e3b22b 0x34e2f48b 0x34e2dccb 0x34e2d2f7 0x34e2d3bb 0x34e4dcd3 0x34e50515 0x34e51351 0x34e51681 0x34e513f5 0x34e511e3 0x303af57c 0x34e51163 0x303b06e8 0x303ac8e0 0x303ac6d8 0x303ac8c8 0x303aca80 0x30350d55 0x3034a12c) 2010-05-11 10:17:18.091 myApp[3875:1807] sqlite error 8 [attempt to write a readonly database] 2010-05-11 10:17:18.095 myApp[3875:1807] Backtrace for sqlite error: (0x34e3a909 0x34e3b085 0x34e3b22b 0x34e2f48b 0x34e2dccb 0x34e2d2f7 0x34e2d3bb 0x34e4dcd3 0x34e50515 0x34e51351 0x34e51681 0x34e513f5 0x34e511e3 0x303af57c 0x34e51163 0x303b06e8 0x303ac8e0 0x303ac6d8 0x303ac8c8 0x303aca80 0x30350d55 0x3034a12c) 2010-05-11 10:17:18.111 myApp[3875:1807] sqlite error 1 [SQL logic error or missing database] 2010-05-11 10:17:18.115 myApp[3875:1807] Backtrace for sqlite error: (0x34e3a909 0x34e3d87f 0x34e3b029 0x34e3b4dd 0x34e2f48b 0x34e2dccb 0x34e2d2f7 0x34e2d3bb 0x34e4dcd3 0x34e50515 0x34e51351 0x34e51681 0x34e513f5 0x34e511e3 0x303af57c 0x34e51163 0x303b06e8 0x303ac8e0 0x303ac6d8 0x303ac8c8 0x303aca80 0x30350d55 0x3034a12c) 2010-05-11 10:17:18.120 myApp[3875:1807] sqlite error 1 [SQL logic error or missing database] 2010-05-11 10:17:18.124 myApp[3875:1807] Backtrace for sqlite error: (0x34e3a909 0x34e3b053 0x34e3b4dd 0x34e2f48b 0x34e2dccb 0x34e2d2f7 0x34e2d3bb 0x34e4dcd3 0x34e50515 0x34e51351 0x34e51681 0x34e513f5 0x34e511e3 0x303af57c 0x34e51163 0x303b06e8 0x303ac8e0 0x303ac6d8 0x303ac8c8 0x303aca80 0x30350d55 0x3034a12c) 2010-05-11 10:17:18.129 myApp[3875:1807] sqlite error 1 [cannot commit - no transaction is active] 2010-05-11 10:17:18.133 myApp[3875:1807] Backtrace for sqlite error: (0x34e3a909 0x34e3b085 0x34e3b4dd 0x34e2f48b 0x34e2dccb 0x34e2d2f7 0x34e2d3bb 0x34e4dcd3 0x34e50515 0x34e51351 0x34e51681 0x34e513f5 0x34e511e3 0x303af57c 0x34e51163 0x303b06e8 0x303ac8e0 0x303ac6d8 0x303ac8c8 0x303aca80 0x30350d55 I don't know where the problem come from. Can you help me?

    Read the article

  • How do I implement Hibernate Pagination using a cursor (so the results stay consistent, despite new

    - by hunterae
    Hey all, Is there any way to maintain a database cursor using Hibernate between web requests? Basically, I'm trying to implement pagination, but the data that is being paged is consistently changing (i.e. new records are added into the database). We are trying to set it up such that when you do your initial search (returning a maximum of 5000 results), and you page through the results, those same records always appear on the same page (i.e. we're not continuously running the query each time next and previous page buttons are clicked). The way we're currently implementing this is by merely selecting 5000 (at most) primary keys from the table we're paging, storing those keys in memory, and then just using 20 primary keys at a time to fetch their details from the database. However, we want to get away from having to store these keys in memory and would much prefer a database cursor that we just keep going back to and moving backwards and forwards over the cursor to generate pages. I tried doing this with Hibernate's ScrollableResults but found that I could not call methods like next() and previous() would cause an exception if you within a different web request / Hibernate session (no surprise there). Is there any way to reattach a ScrollableResults object to a Session, much the same way you would reattach a detached database object to make it persistent? Are there any other approaches to implement this data paging with consistent paging results without caching the primary keys?

    Read the article

  • Is SQLite Manager refreshing itself properly?

    - by ahmet732
    I added new rows to my database through SQLiteManager but I cannot see those values in my tableview. My old values are seen. More interestingly, I deleted my database file but I can see my old values again in my tableview. When I created new database with new name, it sees that. How can I make it perceive new values?

    Read the article

  • parse a special xml in python

    - by zhaojing
    I have s special xml file like below: <alarm-dictionary source="DDD" type="ProxyComponent"> <alarm code="402" severity="Alarm" name="DDM_Alarm_402"> <message>Database memory usage low threshold crossed</message> <description>dnKinds = database type = quality_of_service perceived_severity = minor probable_cause = thresholdCrossed additional_text = Database memory usage low threshold crossed </description> </alarm> ... </alarm-dictionary> I know in python, I can get the "alarm code", "severity" in tag alarm by: for alarm_tag in dom.getElementsByTagName('alarm'): if alarm_tag.hasAttribute('code'): alarmcode = str(alarm_tag.getAttribute('code')) And I can get the text in tag message like below: for messages_tag in dom.getElementsByTagName('message'): messages = "" for message_tag in messages_tag.childNodes: if message_tag.nodeType in (message_tag.TEXT_NODE, message_tag.CDATA_SECTION_NODE): messages += message_tag.data But I also want to get the value like dnkind(database), type(quality_of_service), perceived_severity(thresholdCrossed) and probable_cause(Database memory usage low threshold crossed ) in tag description. That is, I also want to parse the content in the tag in xml. Could anyone help me with this? Thanks a lot!

    Read the article

  • DataGridView live display of datatable using virtual mode

    - by Chris
    I have a DataGridView that will display records (log entries) from a database. The amount of records that can exist at a time is very large. I would like to use the virtual mode feature of the DataGridView to display a page of data, and to minimize the amount of data that has to be transferred across a network at a given time. Polling for data is out of the question. There will be several clients running at a time, all of which are on the same network and viewing the records. If they all poll for data, the network will run very slowly. The data is read-only to the user; they won't be able to edit any of it, just view it. I need to know when updates occur in the database, and I need to update the screen with those updates accordingly using virtual mode. If a page of data a user is viewing contains data that has change, he/she will see those updates on that page. If updates were made to data in the database, but not in the data the user is viewing, then not much really changes on the user screen (Maybe just the scroll bar if records were added or removed). My current approach is using SQL server change tracking with the sync framework. Each client has a local SQL Server CE instance and database file that is kept in sync with the main database server. I use the information from the synchronization event to see if any changes were made to the main database and were sync'ed to the client. I need to use the DataGridView virtual mode here because I can't have thousands of records loaded into the DataGridView at once, otherwise memory usage goes through the roof. The main challenge right now is knowing how to use virtual mode to provide a seamless experience to the user by allowing them to scroll up and down through the records, and also have records update on the fly without interfering with the user inappropriately. Has anybody dealt with this issue before, and if so, where I can see how they did it? I've gone through some of the MSDN documentation and examples on virtual mode. So far, I haven't found documentation and/or examples on their site that explains how to do what I am trying to accomplish.

    Read the article

  • How do I map repeating columns in NHibernate without creating duplicate properties

    - by Ian Oakes
    Given a database that has numerous repeating columns used for auditing and versioning, what is the best way to model it using NHibernate, without having to repeat each of the columns in each of the classes in the domain model? Every table in the database repeats these same nine columns, the names and types are identical and I don't want to replicate it in the domain model. I have read the docs and I saw the section on inheritance mapping but I couldn't see how to make it work in this scenario. This seems like a common scenario because nearly every database I've work on has had the four common audit columns (CreatedBy, CreateDate, UpdatedBy, UpdateDate) in nearly every table. This database is no different except that it introduces another five columns which are common to every table.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • SQL Compact performance on device

    - by Ben M
    My SQL Compact database is very simple, with just three tables and a single index on one of the tables (the table with 200k rows; the other two have less than a hundred each). The first time the .sdf file is used by my Compact Framework application on the target Windows Mobile device, the system hangs for well over a minute while "something" is done to the database: when deployed, the DB is 17 megabytes, and after this first usage, it balloons to 24 megs. All subsequent usage is pretty fast, so I'm assuming there's some sort of initialization / index building going on during this first usage. I'd rather not subject the user to this delay, so I'm wondering what this initialization process is and whether it can be performed before deployment. For now, I've copied the "initialized" database back to my desktop for use in the setup project, but I'd really like to have a better answer / solution. I've tried "full compact / repair" in the VS Database Properties dialog, but this made no difference. Any ideas? For the record, I should add that the database is only read from by the device application -- no modifications are made by that code.

    Read the article

  • How to set up a load/stress test for a web site?

    - by Ryan
    I've been tasked with stress/load testing our company web site out of the blue and know nothing about doing so. Every search I make on google for "how to load test a web site" just comes back with various companies and software to physically do the load testing. For now I'm more interested in how to actually go about setting up a load test like what I should take into account prior to load testing, what pages within my site I should be testing load against and what things I'm going to want to monitor when doing the test. Our web site is on a multi-tier system complete with a separate database server (IIS 7 Web Server, SQL Server 2000 db). I imagine I'd want to monitor both the web server and the database server for testing load however when setting up scenarios to load test the web server I'd have to use pages that query the database to see any load on the database server at the same time. Are web servers and database servers generally tested simultaneously or are they done as separate tests? As you can see I'm pretty clueless as to the whole operation so any incite as to how to go about this would be very helpful. FYI I have been tinkering with Pylot and was able to create and run a scenario against our site but I'm not sure what I should be looking for in the results or if the scenario I created is even a scenario worth measuring for our site. Thanks in advance.

    Read the article

  • get data from online once and then viewable offline

    - by user313100
    Okay, I want to have an app that takes phone numbers from an online database and displays them in a table view. When the user is not online, I want them to still be able to see the numbers they already got from the database in the table view. If the user manages to go back online, the database updates the view. My question is, is this possible to do and if so, what's the best way to approach it? (bit of a newbie, please help me out)

    Read the article

  • SQL Server 2008 R2

    - by kevchadders
    Hi all, I heard on the grapevine that Microsoft will be releasing SQL Server 2008 R2 within a year. Though I initially thought this was a patch for the just released 2008 version, I realised that it’s actually a completely different version that you would have to pay for. (Am I correct, if you had SQL Server 2008, would you have to pay again if you wanted to upgrade to 2008 R2?) If you’re already running SQL Server 2008, would you say it’s still worth the upgrade? Or does it depend on the size of your company and current setup. For what I’ve initially read, I do get the impression that this version would be more useful for the very high end hardware setup where you want to have very good scalability. With regard to programming, is there any extra enhancements/support in there which you’re aware of that will significantly help .NET Products/Web Development? Initially found a couple of links on it, but I was wondering if anyone had anymore info to share on subject as I couldn’t find nothing on SO about it? Thanks. New SQL Server R2 Microsoft Link on it. Microsoft SQL 2008 R2 EDIT: More information based on the Express Edition One very interesting thing about SQL Server 2008 R2 concerns the Express edition. Previous express versions of SQL Server Express had a database size limit of 4GB. With SQL Server Express 2008 R2, this has now been increased to 10GB !! This now makes the FREE express edition a much more viable option for small & medium sized applications that are relatively light on database requirements. Bear in mind, that this limit is per database, so if you coded your application cleverly enough to use a separate database for historical/archived data, you could squeeze even more out of it! For more information, see here: http://blogs.msdn.com/sqlexpress/archive/2010/04/21/database-size-limit-increased-to-10gb-in-sql-server-2008-r2-express.aspx

    Read the article

  • Mongodb update: how to check if an update succeeds or fails?

    - by zmg
    I think the title pretty much says it all. I'm working with Mongodb in PHP using the pecl driver. My updates are working great, but I'd like to build some error checking into my funciton(s). I've tried using lastError() in a pretty simple function: function system_db_update_object($query, $values, $database, $collection) { $connection = new Mongo(); $collection = $connection->$database->$collection; $connection->$database->resetError(); //Added for debugging $collection->update( $query, array('$set' => $values)); //$errorArray = $connection->$database->lastError(); var_dump($connection->$database->lastError());exit; // Var dump and /Exit/ } But pretty much regardless of what I try to update (whether it exists or not) I get these same basic results: array(4) { ["err"]=> NULL ["updatedExisting"]=> bool(true) ["n"]=> float(1) ["ok"]=> float(1) } Any help or direction would be greatly appreciated.

    Read the article

  • insert data using sqlite issue on iphone ( not reflecting on table)

    - by prajakta
    i can insert my data but i cant show them on my table view ..i did [tableview reload data] but of no success here is my code -(void)gButtonTapped:(id)sender { NSLog(@"right nav bar button is hit%@ ",storePaths); //[self readAnimalsFromDatabase2]; appDelegate = (DatabaseTestAppDelegate *)[[UIApplication sharedApplication] delegate]; sqlite3 *database; sqlite3_stmt *compiled_statement1; if(sqlite3_open([storePaths UTF8String], &database) == SQLITE_OK) { //const char *sqlStatement = NSString *newQuery = [NSString stringWithFormat:@"insert into cat_tbl (cat_id,names,imgs) values ('12','test1','r.png')"]; // NSString *newQuery = [NSString stringWithFormat:@"select * from list_tbl"]; const char *sql = [newQuery cStringUsingEncoding:NSASCIIStringEncoding]; NSLog(@"update query is %@",newQuery); if(sqlite3_prepare_v2(database, sql, -1, &compiled_statement1, NULL) == SQLITE_OK) { int result = sqlite3_step(compiled_statement1); sqlite3_reset(compiled_statement1); NSLog(@"result %d", result); if(result != SQLITE_ERROR) { int lastInsertId = sqlite3_last_insert_rowid(database); NSLog(@"x %d", lastInsertId); } } } sqlite3_finalize(compiled_statement1); sqlite3_close(database); [tabelView reloadData];// this is also not working }

    Read the article

  • Hibernate Annotation for Entity existing in more than 1 catalog

    - by user286395
    I have a Person entity mapped by Hibernate to a database table in a database catalog "Active". After a period of time, records in this database table in the "Active" catalog are archived/moved to an exact copy of the table in a database Catalog "History". I have the need to retrieve from both the Active and History Catalogs. Is there a better way to model this with Hibernate annotations than making an abstract class that 2 classes extend from. This is what I have now. @MappedSuperclass public abstract class Person { @Id private Integer id; private String name; } @Entity @Table(name="Person", catalog="Active") public class PersonActive extends Person { } @Entity @Table(name="Person", catalog="History") public class PersonHistory extends Person { }

    Read the article

  • Should $new_link be used in mysql_connect()?

    - by Eddie
    I'm maintaining an inherited site built on Drupal. We are currently experiencing "too many connections" to the database. In the /includes/database.mysql.inc file, @mysql_connect($url['host'], $url['user'], $url['pass'], TRUE, 2) (mysql_connect() documentation) is used to connect to the database. Should $new_link = TRUE be used? My understanding is that it will "always open a new link." Could this be causing the "too many connections"?

    Read the article

  • Django ORM dealing with MySQL BIT(1) field

    - by Carles Barrobés
    In a Django application, I'm trying to access an existing MySQL database created with Hibernate (a Java ORM). I reverse engineered the model using: $ manage.py inspectdb > models.py This created a nice models file from the Database and many things were quite fine. But I can't find how to properly access boolean fields, which were mapped by Hibernate as columns of type BIT(1). The inspectdb script by default creates these fields in the model as TextField and adds a comment saying that it couldn't reliably obtain the field type. I changed these to BooleanField but it doesn't work (the model objects always fetch a value of true for these fields). Using IntegerField won't work as well (e.g. in the admin these fields show strange non-ascii characters). Any hints of doing this without changing the database? (I need the existing Hibernate mappings and Java application to still work with the database).

    Read the article

  • Faster way to dump mysql

    - by japancheese
    This may be a dumb question, but I was just watching a screencast on MySQL replication, and I learned that a master database doesn't send SQL over to a slave for replication, it actually sends data over in binary, which makes importing extremely fast. I started wondering, "if a database can export and import binary, why do mysqldumps / imports take so long?" Is there a way to get mysql to dump a database in binary in a similar fashion to speed up that process as well?

    Read the article

< Previous Page | 413 414 415 416 417 418 419 420 421 422 423 424  | Next Page >