Search Results

Search found 20359 results on 815 pages for 'fixed length record'.

Page 420/815 | < Previous Page | 416 417 418 419 420 421 422 423 424 425 426 427  | Next Page >

  • Ajax gets nothing back from the php.

    - by ShaMun
    Jquery i dont have alert and firefox i dont have anything in return. The code was working before, database query have successfull records also. What i am missing??? Jquery ajax. $.ajax({ type : "POST", url : "include/add_edit_del.php?model=teksten_display", data : "oper=search&ids=" + _id , dataType: "json", success : function(msg){ alert(msg); } }); PHP case 'teksten_display': $id = $_REQUEST['ids']; $res = $_dclass-_query_sql( "select a,b,id,wat,c,d from tb1 where id='" . $id . "'" ); $_rows = array(); while ( $rows = mysql_fetch_array ($res) ) { $_rows = $rows; } //header('Cache-Control: no-cache, must-revalidate'); //header('Expires: Mon, 26 Jul 1997 05:00:00 GMT'); header('Content-type: application/json'); echo utf8_encode( json_encode($_rows) ) ; //echo json_encode($_rows); //var_dump($_rows); //print_r ($res); break; Firefox response/request header Date Sat, 24 Apr 2010 22:34:55 GMT Server Apache/2.2.3 (CentOS) X-Powered-By PHP/5.1.6 Expires Thu, 19 Nov 1981 08:52:00 GMT Cache-Control no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma no-cache Content-Length 0 Connection close Content-Type application/json Host www.xxxx.be User-Agent Mozilla/5.0 (X11; U; Linux i686; en-US; rv:1.9.1.9) Gecko/20100330 Fedora/3.5.9-2.fc12 Firefox/3.5.9 Accept application/json, text/javascript, */* Accept-Language en-us,en;q=0.5 Accept-Encoding gzip,deflate Accept-Charset ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive 300 Connection keep-alive Content-Type application/x-www-form-urlencoded; charset=UTF-8 X-Requested-With XMLHttpRequest Referer http://www.xxxx.be/xxxxx Content-Length 17 Cookie csdb=2; codb=5; csdbb=1; codca=1.4; csdca=3; PHPSESSID=benunvkpecqh3pmd8oep5b55t7; CAKEPHP=3t7hrlc89emvg1hfsc45gs2bl2

    Read the article

  • Weird constants

    - by Quassnoi
    I've seen these in real code: #define SCREEN_DIMENSIONS 2 #define THREE_THOUSAND_FIVE_HUNDRED_TWENTY_TWO 3522 What is the weirdest constant you've ever seen? P. S. And of course my favorite in JScript: bool b; switch (b.ToString().length) { case 4: // true ... break; case 5: // false ... break; )

    Read the article

  • Is it safe to modify CCK tables by hand?

    - by LanguaFlash
    I'm not intimately familiar with CCK but I have a one-time custom setup and know that I could get some performance gains if I created indexes and changed the field type and length of some of the fields in my CCK table. Is it save to modify this table at all or will I end up destroying something in the process? Thanks

    Read the article

  • Checking if folder has files

    - by phenevo
    Hi, I have program which writes to database which folders are full or empty. Now I'm using bool hasFiles=false; (Directory.GetFiles(path).Length 0) ? hasFiles=true: hasFiles=false; but it takes almost one hour, and I can't do anything in this time. Is there any fastest way to check if folder has any file ?

    Read the article

  • Why the generated key size is not constant?

    - by Tom Brito
    The following code prints randomly 634, 635, 636, each time I run it. Why its not constant? public static void main(String[] args) throws Exception { KeyPairGenerator keyPairGen = KeyPairGenerator.getInstance("RSA", "BC"); keyPairGen.initialize(1024); RsaKeyPair keyPair = new RsaKeyPair(keyPairGen.generateKeyPair()); System.out.println(keyPair.getPrivate().getEncoded().length); }

    Read the article

  • Xml with spaces as InnerText

    - by David Rutten
    I'm parsing Xml data which has entries like this: <item name="UserText" type_name="gh_string" type_code="10"> </item> I'm supposed to read the 6 spaces as a String, but both the InnerText and InnerXml values of the System.Xml.XmlNode are zero length Strings. Is there any way I can get at this whitespace data in existing files and what do I need to do in the future to prevent this sort of screw up?

    Read the article

  • Getting a substring in Ruby by x number of chars

    - by wotaskd
    I'm trying to produce some Ruby code that will take a string and return a new one, with a number x number of characters removed from its end - these can be actual letters, numbers, spaces etc. Ex: given the following string a_string = "a1wer4zx" I need a simple way to get the same string, minus - say - the 3 last digits. In the case above, that would be "a1wer". The way I'm doing it right now seems very convoluted: an_array = a_string.split(//,(a_string.length-2)) an_array.pop new_string = an_array.join Any ideas?

    Read the article

  • Security against IP spoofing [on hold]

    - by user1369975
    I am pursuing a college project, in which I am running three fake services on three ports to protect the main service (say running at port 80). The concept is that if the user is malicious, he'll try to bring the services down and access the fake services. These ports adopt a blocking process of a connection request and record the IP and port of the client. These are logged and aren't granted access on service on port 80. But what to do if the client spoofs his IP? How can I modify my system?

    Read the article

  • Linux Permissions

    - by Tres
    I am running Fedora 12 and I've setup a partition separate from my root partition to keep shared files and home directories. Now, I've been having permission issues where it says the user cannot chdir into their home directory (/files/home/*). Now, I fixed this originally by chmodding / to 0755 and the home directories also to 0755. And yes, the user is the owner:group of their home directory. Now get this, I didn't change a thing, rebooted, everything still works. Great, right? I boot the server up a day later, and now same ol issue. This is a home server that wasn't on at all at any point in between the working state and non-working state. Also, nothing else was modified. Any ideas? Thanks!

    Read the article

  • Permissions issue on Fedora with separate home partition

    - by Tres
    I am running Fedora 12 and I've setup a partition separate from my root partition to keep shared files and home directories. Now, I've been having permission issues where it says the user cannot chdir into their home directory (/files/home/*). Now, I fixed this originally by chmodding / to 0755 and the home directories also to 0755. And yes, the user is the owner:group of their home directory. Now get this, I didn't change a thing, rebooted, everything still works. Great, right? I boot the server up a day later, and now same ol issue. This is a home server that wasn't on at all at any point in between the working state and non-working state. Also, nothing else was modified. Any ideas? Thanks!

    Read the article

  • How to setup dns to redirect app.example.com to another ip?

    - by AZ.
    I have a site www.example.com running on a hosting company. Now I want to create a separate web app on my VPS and let it accessible via app.example.com How can I set the DNS to redirect app.example.com to my VPS' ip address? CNAME or A Record? Also, If I want to do a mail server on my VPS too, how to setup the DNS? EDIT: Existing site: www.example.com Location: some hosting company that I don't control. It's running PHP with nginx I guess (or aphache) New site (that I'm working on): app.example.com Location: my VPS, it has an IP address, the VPS is running nodejs. It can run along with nginx but currently it's not. I want the existing website continue working (as customer visit www.example.com) and I want customer to visit app.example.com for some new features. The two websites are NOT on the same server and not using the same IP address.

    Read the article

  • How to use substring in vbscript within a xsl page.

    - by dipesh
    I am trying to replace the double quotes in a string with a single quote, got the following code but get error message saying "Object Required strLocation" Sub UpdateAdvancedDecisions(strLocation) Dim d Dim strLLength strLLength = Len(strLocation) - 1 For d = 0 To strLLength alert strLocation strValue = strLocation.Substring(2,3) If strLocation.substring(d,d+1)=" " " Then strLLength = strLLength.substring(0, d) + "'" + strLLength.substring(d + 1,strLLength.length) Next End Sub

    Read the article

  • C#: check if a string start with any character in a list

    - by JoesyXHN
    Hi, I want to check whether a string starts with any character in a list. My current implementation in C# is as follows: char[] columnChars = new char[] { 'A', 'B', 'C', 'D', 'E' }; private bool startWithColumn(string toCheck) { for(int i=0; i<columnChars.Length; i++) if (toCheck.StartsWith(columnChars[i]+"")) { return true; } return false; } I would like to know if any solution is better?

    Read the article

  • Why is my (Type).GetFields(BindingFlags.Instance | BindingFlags.Public) not working?

    - by granadaCoder
    My code can see the NonPublic members, but not the Public ones. (???) Full sample code below. FieldInfo[] publicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.Public); is returning nothing. Note, I'm trying to get at the properties on the abstract class as well as the 1 concrete class. (And read the attributes as well). I'm going bonkers on this one....the msdn example works with the 2 flags (BindingFlags.Instance | BindingFlags.Public).....but my mini inheritance example below is not. THANKS in advance. /////////////START CODE private void RunTest1() { try { textBox1.Text = string.Empty; Type t = typeof(MyInheritedClass); //Look at the BindingFlags *** NonPublic *** int fieldCount = 0; while (null != t) { fieldCount += t.GetFields(BindingFlags.Instance | BindingFlags.NonPublic).Length; FieldInfo[] nonPublicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.NonPublic); foreach (FieldInfo field in nonPublicFieldInfos) { if (null != field) { Console.WriteLine(field.Name); } } t = t.BaseType; } Console.WriteLine("\n\r------------------\n\r"); //Look at the BindingFlags *** Public *** t = typeof(MyInheritedClass); FieldInfo[] publicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.Public); foreach (FieldInfo field in publicFieldInfos) { if (null != field) { Console.WriteLine(field.Name); object[] attributes = field.GetCustomAttributes(t, true); if (attributes != null && attributes.Length > 0) { foreach (Attribute att in attributes) { Console.WriteLine(att.GetType().Name); } } } } } catch (Exception ex) { ReportException(ex); } } private void ReportException(Exception ex) { Exception innerException = ex; while (innerException != null) { Console.WriteLine(innerException.Message + System.Environment.NewLine + innerException.StackTrace + System.Environment.NewLine + System.Environment.NewLine); innerException = innerException.InnerException; } } public abstract class MySuperType { public MySuperType(string st) { this.STString = st; } public string STString { get; set; } public abstract string MyAbstractString {get;set;} } public class MyInheritedClass : MySuperType { public MyInheritedClass(string ic) : base(ic) { this.ICString = ic; } [Description("This is an important property"),Category("HowImportant")] public string ICString { get; set; } private string _oldSchoolPropertyString = string.Empty; public string OldSchoolPropertyString { get { return _oldSchoolPropertyString; } set { _oldSchoolPropertyString = value; } } [Description("This is a not so importarnt property"), Category("HowImportant")] public override string MyAbstractString { get; set; } }

    Read the article

  • trouble accessing mail server from outside domain

    - by cinqoTimo
    Our organization just moved our Website/Domain to a hosted VPS. We elected, for the time being, to keep our email (Exchange) running at our office. On our new VPS, we simply add a DNS record to redirect our mail to our on-site exchange server. This worked out well, as mail is coming and going with no problems. Recently, we ran across an issue when setting up outlook from outside of our office (Not on same network as exchange server). When configuring mail server address, it keeps prompting for credentials. Anyone got any ideas on why this is happening? Is our VPS not allowing Outlook to find our exchange server? If so, how can we bypass it?

    Read the article

  • JavaScript IF with AND/OR.. not working

    - by nobosh
    Can someone who is a master at JS tell me what's wrong with this? if ( $.trim($("#add-box-text").val()).length < 2 && $.trim($("#add-box-text").val()) != "Click here to add an item" ) { // If it's LT than 1 Character, don't submit $("#add-box-text").effect('highlight', {color: '#BDC1C7'}, 500); // Refocus $("#add-box-text").focus(); }

    Read the article

  • string and z-depth animation, as3

    - by VideoDnd
    How do I pass this string to my children? formatCount(fcount) is the value I'm trying to pass to children timer is the value the children are recieving now Timer that loops through an array of displayObjects var timer:Timer = new Timer(100); var count:int = 0; var fcount:int = 0; timer.addEventListener(TimerEvent.TIMER, countdown); function countdown(event:TimerEvent) { count++; fcount=int(count*count/1000); //myText.text = formatCount(fcount); //LOOPS THROUGH MY LIST ITEMS 'see array at bottom' var currentFrame:int = timer.currentCount % frames.length; for (var i:int = 0; i < frames.length; ++i) { frames[i].visible = (i == currentFrame); } } timer.start(); //SUBSTRING AND ZERO PLACEHOLDER function formatCount(i:int):String { var fraction:int = i % 100; var whole:int = i / 100; return ("0000000" + whole).substr(-7, 7) + "." + (fraction < 10 ? "0" + fraction : fraction); } //PASS MATH TO SPRITE HANDLER function spriteHandler(e:Event):void { numbers.setTime(formatCount(fcount)); } //LOST ARGUMENT==>GOES TO NUMBERSVIEW //var numbers:NumbersView; var numbers:*; //MY ARRAY 'list of numbers, one-to-zero' var frames:Array = [new Frame1(),new Frame2(),new Frame3(), new Frame4(),new Frame5(),new Frame6(),new Frame7(),new Frame8(),new Frame9(), new Frame0()]; for each (var frame:Sprite in frames) { addChild(frame); } Example of NumbersView 'increment and place display objects across the stage' function NumbersView() { _listItems = new Array(); previousNums = new Array(); var item:NumberImage; for (var i:Number = 0; i <= 9; i++) { item = new NumberImage(); addChild(item); item.x = i * item.width; _listItems.push(item); } }

    Read the article

  • textbox issue regarding shrinking first time input text

    - by picnic4u
    i have a problem regarding the textbox. i have done the textbox auto expandable but when i insert the text first time then the textbox shrink in size from their original size.but my requirement is that when my text is exceeding the text box length then it auto expand. my code is <script type="text/javascript"> $(document).ready(function() { $('.txtStyle').autogrow(); }); </script> pls somebody suggest how ot is possible

    Read the article

  • Python : Convert from C-Char to Int

    - by cuband
    I have a string read in from a binary file that is unpacked using struct.unpack as a string of length n. Each byte in the string is a single integer (1-byte) representing 0-255. So for each character in the string I want to convert it to an integer. I can't figure out how to do this. Using ord doesn't seem to be on the right track...

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Does Asus F8SV supports 1920*1080 resolution through DVI output? [closed]

    - by Col
    Devices: Asus F8Sv Laptop (Windows 7 ultimate, GeForce 8600m GT, display driver is 301.42, detected and downloaded from nvidia.com, VGA and DVI output interface) Gateway 23 inches LCD monitor (VGA, DVI-D with HDCP, and HDMI input) 18 pins DVI cable, VGA cable, both new. Problems: When connect laptop to monitor by VGA, resolution is automatically adapted to 1920*1080; but when using DVI connection, resolution on monitor is fixed to 1024*768, which is lower than my laptop default 1280*800. The maximum resolution in windows control panel is only 1024*768, while the Nvidia control panel provides options 1920*1080p and 1920*1080i, but clicking apply button does not work, the resolution just can not change. Possibly reason I guess: GeForce 8600m GT does not support 1920*1080 resolution through DVI outputs. Can anyone confirm it or give the real reason? edit: Problem solved by buying a HDMI to DVI-D adapter. Using this adapter and a HDMI cable, I can now enjoy 1080p movie.

    Read the article

< Previous Page | 416 417 418 419 420 421 422 423 424 425 426 427  | Next Page >