Search Results

Search found 45690 results on 1828 pages for 'limbic system'.

Page 425/1828 | < Previous Page | 421 422 423 424 425 426 427 428 429 430 431 432  | Next Page >

  • Hang while starting several daemons [solved]

    - by Adrian Lang
    I’m running a Debian Squeeze AMD64 server. Target runlevel after boot is runlevel 2, which includes rsyslogd, cron, sshd and some other stuff, but not dovecot, postfix, apache2, etc. The system fails to reach runlevel 2 with several symptoms: The system hangs at trying to start rsyslogd Booting into runlevel 1 works, then login from the console works Starting rsyslogd from runlevel 1 via /etc/init.d/rsyslog hangs Starting runlevel 2 with rsyslogd disabled works But then, logging in via console fails: I get the motd, and then nothing Starting sshd from runlevel 1 succeeds But then, I cannot login via ssh. Sometimes password ssh login gives me the motd and then nothing, sometimes not even this. Trying to offer a public key seems to annoy the sshd enough to not talk to me any further. When rebooting from runlevel 1, the server hangs at trying to stop apache2 (which is not running, so this really should be trivial). Trying to stop apache2 when logged in in runleve 1 does hang as well. And that’s just the stuff which fails all the time. RAM has been tested, dmesg shows no problems. I have no clue. Update: (shortened) output from rsyslogd -c4 -d called in runlevel 1 rsyslogd 4.6.4 startup, compatibility mode 4, module path '' caller requested object 'net', not found (iRet -3003) Requested to load module 'lmnet' loading module '/user/lib/rsyslog/lmnet.so' module of type 2 being loaded conf.c requested ref for 'lmnet', refcount 1 rsylog runtime initialized, version 4.6.4, current users 1 syslogd.c requested ref for 'lmnet', refcount now 2 I can kill rsyslogd with Strg+C, then. /var/log shows none of the configured log files, though. Update2: Thanks to @DerfK I still have no clue, but at least I narrowed down the problem. I’m now testing with /etc/init.d/apache2 stop (without an apache2 running, of course) which hangs as well and looks like an even more obvious failure. After some testing I found out that a file with one single line: /usr/sbin/apache2ctl configtest /dev/null 2&1 hangs, while the same line executed in an interactive shell works. I was not able to further reduce this line while, i. e. every single part, the stream redirections and the commando itself is necessary to reproduce the hang. @DerfK also pointed me to strace which gave a shallow hint about what kind of hang we have here: wait4(-1for the init scripts futex(0xsomepointer, FUTEX_WAIT_PRIVATE, 2, NULL for rsyslogd / apache2 binaries called by the init scripts The system was installed as a Debian Lenny by my hoster in autumn 2011, I upgraded it to Squeeze immediately and kept it up to date with Squeeze, which then used to be testing. There were no big changes, though. I guess I never tried to reboot the system before. Update3: I found the problem. My /etc/nsswitch.conf specified ldap as hosts lookup backup, which is not available at that time of the boot. Relying on dns solely fixes my boot problems.

    Read the article

  • How can you extend the Bitmap class

    - by vrish88
    Hello, I am trying to extend the Bitmap class so that I can apply my own effects to an image. When I use this code: namespace ImageEditor { public class Effects : System.Drawing.Bitmap { public void toBlackAndWhite() { System.Drawing.Bitmap image = (Bitmap)this; AForge.Imaging.Filters.Grayscale filter = new AForge.Imaging.Filters.Grayscale(); this = filter.Apply(this); } } } I get the following error: 'ImageEditor.Effects': cannot derive from sealed type 'System.Drawing.Bitmap' So is there a way to get around this or is it simply not possible to extend the class? Thanks.

    Read the article

  • VB.net Cross-Thread

    - by PandaNL
    Hello, I have a cmd command that needs to be executed, when the command starts it starts to fill a progressbar. When the cmd command is done the progressbar needs to fill up to 100. This is the code i use, but it gives me an error when the progressbar.Value = 100 comes up. Public Class Form1 Dim teller As Integer Private Sub Timer1_Tick(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles TimerProgressbar.Tick teller += 1 ProgressBar1.Value = teller If ProgressBar1.Value = ProgressBar1.Maximum Then TimerProgressbar.Stop() End If End Sub This are the tow commands in another private sub where the app is crashing on ProgressBar1.Value = 100 TimerProgressbar.Stop() When i debug it and i try it out it crashes on ProgressBar1.Value = 100 But when i build it under Windows 7 it runs fine without crashing, however a few people reported me it crashes on there Windows xp system. VB gives me a suggestions about Cross Thread, but i don't know how i could make it work with this.

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • Java - getClassLoader().getResource() driving me bonkers

    - by Click Upvote
    I have this test app: import java.applet.*; import java.awt.*; import java.net.URL; public class Test extends Applet { public void init() { URL some=Test.class.getClass().getClassLoader().getResource("/assets/pacman.png"); System.out.println(some.toString()); System.out.println(some.getFile()); System.out.println(some.getPath()); } } When I run it from Eclipse, I get the error: java.lang.NullPointerException at Test.init(Test.java:9) at sun.applet.AppletPanel.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Classpath (from .CLASSPATH file) <classpathentry kind="src" path="src"/> In my c:\project\src folder, I have only the Test.java file and the 'assets' directory which contains pacman.png. What am I doing wrong and how to resolve it?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Generate SQL Server Express database from Entity Framework 4 model

    - by Cranialsurge
    I am able to auto-generate a SQL Server CE 4.0 *.sdf file using code-first generation as explained by Scott Guthrie here. The connection string for the same is as follows: <add name="NerdDinners" providerName="System.Data.SqlServerCe.4.0" connectionString="data source=|DataDirectory|NerdDinner.sdf"/> However if I try to generate an mdf instead using the following connection string, it fails to do so with the following error - "The provider did not return a ProviderManifestToken string.". <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="data source=|DataDirectory|NerdDinner.mdf"/> Even directly hooking into a SQLEXPRESS instance using the following connection string fails <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=NerdDinner;Integrated Security=True"/> Does EF 4 only support SQL CE 4.0 for database creation from a model for now or am I doing something wrong here?

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • Routing and Remote Access Service won't start after full disk

    - by NKCSS
    The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

    Read the article

  • Traditional ASP.NET application in subdirectory of an MVC application

    - by David
    Windows Server 2003, IIS6. We're trying to deploy a non-MVC ASP.NET web application as a subdirectory of an MVC application. However the ASP.NET application in the subdirectory is failing with the message "Could not load file or assembly 'System.Web.Mvc, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. The system cannot find the file specified." which is bizarre because it's not an MVC application.

    Read the article

  • Storing millions of URLs in a database for fast pattern matching

    - by Paras Chopra
    I am developing a web analytics kind of system which needs to log referring URL, landing page URL and search keywords for every visitor on the website. What I want to do with this collected data is to allow end-user to query the data such as "Show me all visitors who came from Bing.com searching for phrase that contains 'red shoes'" or "Show me all visitors who landed on URL that contained 'campaign=twitter_ad'", etc. Because this system will be used on many big websites, the amount of data that needs to log will grow really, really fast. So, my question: a) what would be the best strategy for logging so that scaling the system doesn't become a pain; b) how to use that architecture for rapid querying of arbitrary requests? Is there a special method of storing URLs so that querying them gets faster? In addition to MySQL database that I use, I am exploring (and open to) other alternatives better suited for this task.

    Read the article

  • mvc components in codeigniter?

    - by ajsie
    in yii i could have mvc components (acts like an own application). could i have this too in codeigniter? eg. in SYSTEM/APPLICATION have a folder called COMPONENTS and in there i put stand-alone applications that would be a part of the application. components like ADDRESS BOOK, MAIL, TWITTER and so on. every component folder has folders like: models, views, controllers, config etc. so a component model extends the application model which in turn extends system's (code igniter) model. the same goes for view and controller. i've already got a lot of these components which i want to use in codeigniter. is it good idea to place them as i said in SYSTEM/APPLICATION/COMPONENTS or is there best practice for this?

    Read the article

  • Parsing String to Time and insert in mysqldatabase

    - by kawtousse
    Goal: Parse a string from an input type text into TIME type to be inserted in MYSQL Database. String start= request.getParameter("startp"); System.out.println("start:" +start); SimpleDateFormat sdf = new SimpleDateFormat("HH:mm:ss"); long ms=0; try { ms = sdf.parse(start).getTime(); System.out.println(" the value of ms is:" +ms); } catch (ParseException e1) { // TODO Auto-generated catch block e1.printStackTrace(); } Time ts = new Time(ms); System.out.println("the value of ts is:" +ts); start:14:12 (value witch i entered actually in the form at the start field named startp) the value of ts is :01:00:00 java.text.ParseException: Unparseable date: "14:12" at java.text.DateFormat.parse(Unknown Source) ms not displayed I ensure that database type of the following parameter is TIME. Thanks.

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • How to find all the file handles by a process programmatically?

    - by kumar
    I have a process "x" which uses "system" C function to start ntpd daemon. I observed that ntpd are passed the open file descriptors of "x". ntpd holds on to the file descriptors even after original file is deleted. for ex: Some log files used by "x" are rotated out after sometime, but "ntpd" has file handle opened for these deleted files. Will it cause any problem? Alternatively I thought of setting "FD_CLOEXEC" flag for all the file descriptors before calling "system" function. But as we are running as an extension library to third process "x"( "x" loads our library based on some condition), there is no easy way to know about all the file descriptors process has opened. One way is to read /proc//fd and set "FD_CLOEXEC" for each file handle and reset it back after "system" function returns. I'm using Linux 2.16. Is there any other easy way to find all the file handlers? Thanks,

    Read the article

  • Forbid access to DVD/CD/USB for some users

    - by alex2k8
    I need to forbid all users except administrators to write into DVD/CD/USB drives on Windows XP. Googled around and there is a way to disable devices completely: Cdrom: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\cdrom\Start (from 1 to 4) Usb: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\USBSTOR (from 3 to 4) but I need to disable them only for particular users.

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

  • SSH Advanced Logging

    - by Radek Šimko
    I've installed OpenSUSE on my server and want to set ssh to log every command, which is send to system over it. I've found this in my sshd_config: # Logging # obsoletes QuietMode and FascistLogging #SyslogFacility AUTH #LogLevel INFO I guess that both of those directives has to be uncommented, but I'd like to log every command, not only authorization (login/logout via SSH). I just want to know, if someone breaks into my system, what did he do.

    Read the article

  • What is the Worst Depiction of Computer Use in a Movie

    - by Robert Cartaino
    You know the type: "It's a Unix system. I know this" -- in Jurassic park where a computer-genius girl sees a computer and quickly takes over like a 3-D video game, flying through the file system to shut down the park. [video link to the scene] So what's your favorite movie gaff that shows Hollywood can be completely clueless when it comes to portraying technology?

    Read the article

  • NDepend: How to not display 'tier' assemblies in dependency graph?

    - by Edward Buatois
    I was able to do this in an earlier version of nDepend by going to tools-options and setting which assemblies would be part of the analysis (and ignore the rest). The latest version of the trial version of nDepend lets me set it, but it seems to ignore the setting and always analyze all assemblies whether I want it to or not. I tried to delete the "tier" assemblies by moving them over to the "application assemblies" list, but when I delete them out of there, they just get added back to the "tier" list, which I can't ignore. I don't want my dependency graph to contain assemblies like "system," "system.xml," and "system.serialization!" I want only MY assemblies in the dependency graph! Or is that a paid-version feature now? Is there a way to do what I'm talking about?

    Read the article

  • Why do some games randomly turn my screen a random solid color?

    - by Emlena.PhD
    When playing some games my computer will randomly have an error that I cannot fix without turning it off and back on again. The screen changes to one solid color, which varies (off the top of my head I can remember seeing solid green, magenta, etc..) and the sound blares a single tone. The sound sometimes briefly restores and I can still hear the game sounds and even hear and still be heard by people in my Mumble channel, but the screen doesn't right itself so I'm still blind. What's more is this happens in some games but not in others. While the game is actually running, not while I'm still in the menu. However, it does happen if I'm afk or idle but the game world is still rendering. Games where the error occurs: League of Legends World of Warcraft Trine The Sims 2 Dungeon Defenders Safe games: games where it has never occurred: Tribes: Ascend Star Wars: the Old Republic Battlefield 3 So relatively older games cause the problem while newer games do not? I cannot predict when it will happen, it just seems random. However, if it happens and I try playing the same game further after restart it does appear to occur more frequently after the first time. But if I switch to a safe game it doesn't continue happening. Both of my RAM sticks appear fine, flipped position or either one on their own and games still run, computer still boots. I would think over-heating, but then why not all games? ALso, sometimes it happens immediately after I start playing, within seconds of the 3D world booting up. I'm looking to upgrade very soon so I want to figure out what component or software is fubar and replace/repair it. Any suggestions or recommendations of tools would be helpful. Below is some system information. Dxdiag does not detect any problems. Operating System: Windows 7 Home Premium 64-bit (6.1, Build 7601) Service Pack 1 (7601.win7sp1_gdr.120305-1505) System Manufacturer: Gigabyte Technology Co., Ltd. System Model: EP45-UD3R BIOS: Award Modular BIOS v6.00PG Processor: Intel(R) Core(TM)2 Duo CPU E8500 @ 3.16GHz (2 CPUs), ~3.2GHz Memory: 4096MB RAM DirectX Version: DirectX 11 DxDiag Version: 6.01.7601.17514 64bit Unicode Graphics card name: NVIDIA GeForce GTX 285 Driver Version: 8.17.12.9610 (error has occurred w/several driver versions) Sound: I do not have a sound card, been using motherboard's built in sound)

    Read the article

< Previous Page | 421 422 423 424 425 426 427 428 429 430 431 432  | Next Page >