Search Results

Search found 45689 results on 1828 pages for 'system serviceprocess'.

Page 425/1828 | < Previous Page | 421 422 423 424 425 426 427 428 429 430 431 432  | Next Page >

  • Problem with EditText.requestFocus()

    - by synic
    In the onCreate() of an activity, I've got a call to requestFocus() on an EditText. Immediately after, I've got the following: System.out.println(mEdit.isFocusableInTouchMode()); System.out.println(mEdit.isFocusable()); System.out.println(mEdit.isFocused()); These were just put in while I was trying to figure out what is wrong with this activity... they all print "true". However, as you may have guessed, the EditText does NOT have focus, and if I try to start typing, nothing happens. I have to click on the EditText to being typing. I can't see that anything else has focus, but obviously something has to have it.. how can I find out what it is?

    Read the article

  • Trying to execute netdom.exe from a ruby script or IRB does nothing

    - by Joraff
    I'm trying to write a script that will rename a computer and join it to a domain, and was planning to call on netdom.exe to do the dirty work. However, trying to run this utility in the script (same results in irb) does absolutely nothing. No output, no execution. I tried with backticks and with the system() method. System() returns false for everything but system("netdom") (which returns true). Backticks never return anything but an empty string. I have verified that netdom runs and works in the environment the script will be running in, and I'm calling other command-line utilities earlier in the script that work (w32tm, getmac, ping). Here's the exact line that gets executed: `netdom renamecomputer %COMPUTERNAME% /NewName:#{newname} /force` FYI, This is windows 7 x64

    Read the article

  • How can you extend the Bitmap class

    - by vrish88
    Hello, I am trying to extend the Bitmap class so that I can apply my own effects to an image. When I use this code: namespace ImageEditor { public class Effects : System.Drawing.Bitmap { public void toBlackAndWhite() { System.Drawing.Bitmap image = (Bitmap)this; AForge.Imaging.Filters.Grayscale filter = new AForge.Imaging.Filters.Grayscale(); this = filter.Apply(this); } } } I get the following error: 'ImageEditor.Effects': cannot derive from sealed type 'System.Drawing.Bitmap' So is there a way to get around this or is it simply not possible to extend the class? Thanks.

    Read the article

  • Black berry: Getting NULL string for exception message.

    - by vikram deshpande
    I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread( String textMsg, String mobileNumber ) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+"+ mobilenumber); TextMessage text = (TextMessage) msgConn.newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); }catch (IOCancelledException ioce){ System.out.println("IOCancelledException: " + ioce.getMessage()); }catch(IOException ioe){ System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

    Read the article

  • Is it possible to write C# code as below and send email using my home network?

    - by kedar karthik
    Is it possible to write C# code as below and send email using my home network? I have a valid user name and password on that exchange server. Is there any configuration that I can set to achieve this? BTW this code blow works when I run it within office network. I want this code to work when run from any network. String cMSExchangeWebServiceURL = (String)System.Configuration.ConfigurationSettings.AppSettings["MSExchangeWebServiceURL"]; String cEmail = (String)System.Configuration.ConfigurationSettings.AppSettings["Cemail"]; String cPassword = (String)System.Configuration.ConfigurationSettings.AppSettings["Cpassword"]; String cTo = (String)System.Configuration.ConfigurationSettings.AppSettings["CTo"]; ExchangeServiceBinding esb = new ExchangeServiceBinding(); esb.Timeout = 1800000; esb.AllowAutoRedirect = true; esb.UseDefaultCredentials = false; esb.Credentials = new NetworkCredential(cEmail, cPassword); esb.Url = cMSExchangeWebServiceURL; ServicePointManager.ServerCertificateValidationCallback += delegate(object sender1, X509Certificate certificate, X509Chain chain, SslPolicyErrors sslPolicyErrors) { return true; }; // Create a CreateItem request object CreateItemType request = new CreateItemType(); // Setup the request: // Indicate that we only want to send the message. No copy will be saved. request.MessageDisposition = MessageDispositionType.SendOnly; request.MessageDispositionSpecified = true; // Create a message object and set its properties MessageType message = new MessageType(); message.Subject = subject; message.Body = new TestOutgoingEmailServer.com.cogniti.mail1.BodyType(); message.Body.BodyType1 = BodyTypeType.HTML; message.Body.Value = body; message.ToRecipients = new EmailAddressType[3]; message.ToRecipients[0] = new EmailAddressType(); //message.ToRecipients[1] = new EmailAddressType(); //message.ToRecipients[2] = new EmailAddressType(); message.ToRecipients[0].EmailAddress = "[email protected]"; message.ToRecipients[0].RoutingType = "SMTP"; //message.CcRecipients = new EmailAddressType[1]; //message.CcRecipients[0] = new EmailAddressType(); //message.CcRecipients[0].EmailAddress = toEmailAddress.ElementAt(1).ToString(); //message.CcRecipients[0].RoutingType = "SMTP"; //There are some more properties in MessageType object //you can set all according to your requirement // Construct the array of items to send request.Items = new NonEmptyArrayOfAllItemsType(); request.Items.Items = new ItemType[1]; request.Items.Items[0] = message; // Call the CreateItem EWS method. CreateItemResponseType response = esb.CreateItem(request);

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • Best way to store sales tax information

    - by Seph
    When designing a stock management database system (sales / purchases) what would be the best way to store the various taxes and other such amounts? A few of the fields that could be saved are: Unit price excluding tax Unit price including tax Tax per item Total excluding tax (rounded to 2 decimals) Total including tax (rounded to 2 decimals) Total tax (rounded to 2 decimals) Currently the most reasonable solution so far is storing down (roughly) item, quantity, total excluding tax (rounded) and the total tax (rounded). Can anyone suggest some better way of storing this details for a generic system? Also, given the system needs to be robust, what should be done if there were multiple tax values (eg: state and city) which might need to be separated, in this case a separate table would be in order, but would it be considered excessive to just have a rowID and some taxID mapping to a totalTax column?

    Read the article

  • Hang while starting several daemons [solved]

    - by Adrian Lang
    I’m running a Debian Squeeze AMD64 server. Target runlevel after boot is runlevel 2, which includes rsyslogd, cron, sshd and some other stuff, but not dovecot, postfix, apache2, etc. The system fails to reach runlevel 2 with several symptoms: The system hangs at trying to start rsyslogd Booting into runlevel 1 works, then login from the console works Starting rsyslogd from runlevel 1 via /etc/init.d/rsyslog hangs Starting runlevel 2 with rsyslogd disabled works But then, logging in via console fails: I get the motd, and then nothing Starting sshd from runlevel 1 succeeds But then, I cannot login via ssh. Sometimes password ssh login gives me the motd and then nothing, sometimes not even this. Trying to offer a public key seems to annoy the sshd enough to not talk to me any further. When rebooting from runlevel 1, the server hangs at trying to stop apache2 (which is not running, so this really should be trivial). Trying to stop apache2 when logged in in runleve 1 does hang as well. And that’s just the stuff which fails all the time. RAM has been tested, dmesg shows no problems. I have no clue. Update: (shortened) output from rsyslogd -c4 -d called in runlevel 1 rsyslogd 4.6.4 startup, compatibility mode 4, module path '' caller requested object 'net', not found (iRet -3003) Requested to load module 'lmnet' loading module '/user/lib/rsyslog/lmnet.so' module of type 2 being loaded conf.c requested ref for 'lmnet', refcount 1 rsylog runtime initialized, version 4.6.4, current users 1 syslogd.c requested ref for 'lmnet', refcount now 2 I can kill rsyslogd with Strg+C, then. /var/log shows none of the configured log files, though. Update2: Thanks to @DerfK I still have no clue, but at least I narrowed down the problem. I’m now testing with /etc/init.d/apache2 stop (without an apache2 running, of course) which hangs as well and looks like an even more obvious failure. After some testing I found out that a file with one single line: /usr/sbin/apache2ctl configtest /dev/null 2&1 hangs, while the same line executed in an interactive shell works. I was not able to further reduce this line while, i. e. every single part, the stream redirections and the commando itself is necessary to reproduce the hang. @DerfK also pointed me to strace which gave a shallow hint about what kind of hang we have here: wait4(-1for the init scripts futex(0xsomepointer, FUTEX_WAIT_PRIVATE, 2, NULL for rsyslogd / apache2 binaries called by the init scripts The system was installed as a Debian Lenny by my hoster in autumn 2011, I upgraded it to Squeeze immediately and kept it up to date with Squeeze, which then used to be testing. There were no big changes, though. I guess I never tried to reboot the system before. Update3: I found the problem. My /etc/nsswitch.conf specified ldap as hosts lookup backup, which is not available at that time of the boot. Relying on dns solely fixes my boot problems.

    Read the article

  • VB.net Cross-Thread

    - by PandaNL
    Hello, I have a cmd command that needs to be executed, when the command starts it starts to fill a progressbar. When the cmd command is done the progressbar needs to fill up to 100. This is the code i use, but it gives me an error when the progressbar.Value = 100 comes up. Public Class Form1 Dim teller As Integer Private Sub Timer1_Tick(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles TimerProgressbar.Tick teller += 1 ProgressBar1.Value = teller If ProgressBar1.Value = ProgressBar1.Maximum Then TimerProgressbar.Stop() End If End Sub This are the tow commands in another private sub where the app is crashing on ProgressBar1.Value = 100 TimerProgressbar.Stop() When i debug it and i try it out it crashes on ProgressBar1.Value = 100 But when i build it under Windows 7 it runs fine without crashing, however a few people reported me it crashes on there Windows xp system. VB gives me a suggestions about Cross Thread, but i don't know how i could make it work with this.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Java - getClassLoader().getResource() driving me bonkers

    - by Click Upvote
    I have this test app: import java.applet.*; import java.awt.*; import java.net.URL; public class Test extends Applet { public void init() { URL some=Test.class.getClass().getClassLoader().getResource("/assets/pacman.png"); System.out.println(some.toString()); System.out.println(some.getFile()); System.out.println(some.getPath()); } } When I run it from Eclipse, I get the error: java.lang.NullPointerException at Test.init(Test.java:9) at sun.applet.AppletPanel.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Classpath (from .CLASSPATH file) <classpathentry kind="src" path="src"/> In my c:\project\src folder, I have only the Test.java file and the 'assets' directory which contains pacman.png. What am I doing wrong and how to resolve it?

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • Storing millions of URLs in a database for fast pattern matching

    - by Paras Chopra
    I am developing a web analytics kind of system which needs to log referring URL, landing page URL and search keywords for every visitor on the website. What I want to do with this collected data is to allow end-user to query the data such as "Show me all visitors who came from Bing.com searching for phrase that contains 'red shoes'" or "Show me all visitors who landed on URL that contained 'campaign=twitter_ad'", etc. Because this system will be used on many big websites, the amount of data that needs to log will grow really, really fast. So, my question: a) what would be the best strategy for logging so that scaling the system doesn't become a pain; b) how to use that architecture for rapid querying of arbitrary requests? Is there a special method of storing URLs so that querying them gets faster? In addition to MySQL database that I use, I am exploring (and open to) other alternatives better suited for this task.

    Read the article

  • Generate SQL Server Express database from Entity Framework 4 model

    - by Cranialsurge
    I am able to auto-generate a SQL Server CE 4.0 *.sdf file using code-first generation as explained by Scott Guthrie here. The connection string for the same is as follows: <add name="NerdDinners" providerName="System.Data.SqlServerCe.4.0" connectionString="data source=|DataDirectory|NerdDinner.sdf"/> However if I try to generate an mdf instead using the following connection string, it fails to do so with the following error - "The provider did not return a ProviderManifestToken string.". <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="data source=|DataDirectory|NerdDinner.mdf"/> Even directly hooking into a SQLEXPRESS instance using the following connection string fails <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=NerdDinner;Integrated Security=True"/> Does EF 4 only support SQL CE 4.0 for database creation from a model for now or am I doing something wrong here?

    Read the article

  • Traditional ASP.NET application in subdirectory of an MVC application

    - by David
    Windows Server 2003, IIS6. We're trying to deploy a non-MVC ASP.NET web application as a subdirectory of an MVC application. However the ASP.NET application in the subdirectory is failing with the message "Could not load file or assembly 'System.Web.Mvc, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. The system cannot find the file specified." which is bizarre because it's not an MVC application.

    Read the article

  • Routing and Remote Access Service won't start after full disk

    - by NKCSS
    The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

    Read the article

  • How to find all the file handles by a process programmatically?

    - by kumar
    I have a process "x" which uses "system" C function to start ntpd daemon. I observed that ntpd are passed the open file descriptors of "x". ntpd holds on to the file descriptors even after original file is deleted. for ex: Some log files used by "x" are rotated out after sometime, but "ntpd" has file handle opened for these deleted files. Will it cause any problem? Alternatively I thought of setting "FD_CLOEXEC" flag for all the file descriptors before calling "system" function. But as we are running as an extension library to third process "x"( "x" loads our library based on some condition), there is no easy way to know about all the file descriptors process has opened. One way is to read /proc//fd and set "FD_CLOEXEC" for each file handle and reset it back after "system" function returns. I'm using Linux 2.16. Is there any other easy way to find all the file handlers? Thanks,

    Read the article

  • Parsing String to Time and insert in mysqldatabase

    - by kawtousse
    Goal: Parse a string from an input type text into TIME type to be inserted in MYSQL Database. String start= request.getParameter("startp"); System.out.println("start:" +start); SimpleDateFormat sdf = new SimpleDateFormat("HH:mm:ss"); long ms=0; try { ms = sdf.parse(start).getTime(); System.out.println(" the value of ms is:" +ms); } catch (ParseException e1) { // TODO Auto-generated catch block e1.printStackTrace(); } Time ts = new Time(ms); System.out.println("the value of ts is:" +ts); start:14:12 (value witch i entered actually in the form at the start field named startp) the value of ts is :01:00:00 java.text.ParseException: Unparseable date: "14:12" at java.text.DateFormat.parse(Unknown Source) ms not displayed I ensure that database type of the following parameter is TIME. Thanks.

    Read the article

  • mvc components in codeigniter?

    - by ajsie
    in yii i could have mvc components (acts like an own application). could i have this too in codeigniter? eg. in SYSTEM/APPLICATION have a folder called COMPONENTS and in there i put stand-alone applications that would be a part of the application. components like ADDRESS BOOK, MAIL, TWITTER and so on. every component folder has folders like: models, views, controllers, config etc. so a component model extends the application model which in turn extends system's (code igniter) model. the same goes for view and controller. i've already got a lot of these components which i want to use in codeigniter. is it good idea to place them as i said in SYSTEM/APPLICATION/COMPONENTS or is there best practice for this?

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • SSH Advanced Logging

    - by Radek Šimko
    I've installed OpenSUSE on my server and want to set ssh to log every command, which is send to system over it. I've found this in my sshd_config: # Logging # obsoletes QuietMode and FascistLogging #SyslogFacility AUTH #LogLevel INFO I guess that both of those directives has to be uncommented, but I'd like to log every command, not only authorization (login/logout via SSH). I just want to know, if someone breaks into my system, what did he do.

    Read the article

  • Forbid access to DVD/CD/USB for some users

    - by alex2k8
    I need to forbid all users except administrators to write into DVD/CD/USB drives on Windows XP. Googled around and there is a way to disable devices completely: Cdrom: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\cdrom\Start (from 1 to 4) Usb: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\USBSTOR (from 3 to 4) but I need to disable them only for particular users.

    Read the article

< Previous Page | 421 422 423 424 425 426 427 428 429 430 431 432  | Next Page >