Search Results

Search found 26649 results on 1066 pages for 'visionary software solutions'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 428/1066 | < Previous Page | 424 425 426 427 428 429 430 431 432 433 434 435  | Next Page >

  • Take a screenshot of an entire webpage in Opera

    - by robertc
    Is there some tool within Opera, or possibly an add-on, which will let me take a screenshot of an entire web page? I usually use Screengrab to do this with Firefox, but in this situation I want a screenshot of the page as Opera renders it (because I want to show the page as rendered with HTML5 form controls like date and time). I am currently using Opera 10.60 x86_64 on Fedora 12, so solutions that work in browser would be preferable rather than external programs.

    Read the article

  • Accessing or Resetting Permissions of a Mounted Registry Hive of a Different User / From a Different System

    - by Synetech
    I’m currently stuck using my backup system until I can replace my dead motherboard. In the meantime, I have put my hard-drive in this system so that I can access my files and keep working on the backup system. Fortunately, I don’t have a permission issues with the files (the partitions are FAT32). The issue I’m having is with the registry. I need to import some of my settings from the hives of my (old? normal?) installation of Windows into the one I’m currently using. Settings from the system hives (SYSTEM, SOFTWARE, etc.) are fine, but the user hive is giving me trouble. I’ve copied the NTUSER.DAT file from my other drive and mounted it with the reg command. Most of the keys (eg Software) are fine and I can access them without problem, but some of them (particularly the Identities key where Outlook Express settings are stored) complains that it cannot be opened. If I open the permissions dialog, I get an error about being unable to view the current permssions. If I then ignore it and try to take ownership of the key and it’s subkeys, I get an access-denied error. If I then add permissions for my user account on this system, I get an error, however I am then able to see the subkeys and values of the key. If I then try to access the subkeys, I get the same original errors. If I repeat the process for each subkey, I can see their values and subkeys, and so on, but of course this gets to be incredibly annoying and time-consuming (especially since the Identities key has a lot of subkeys). Is there an easier/temporary/more correct way to dump a key so that I can import it into my backup system?

    Read the article

  • How can I generate filesystem images that are usable on many different virtualization systems?

    - by Mark Longair
    I have written a script that generates a root filesystem image (based on Debian lenny) suitable for User-Mode Linux. (Essentially this script creates a filesystem image, mounts it with a loop device, uses debootstrap to create a lenny install, sets up a static IP for TUN/TAP networking, adds public keys for login by SSH and installs a web application.) These filesystem images work pretty well with UML, but it would be nice to be able to generate similar images that people can use on alternative virtualization software, and I'm not familiar with these options at all. In particular, since the idea is to use this image as a standalone server for testing the web application, it's important that the networking works. I wonder if anyone can suggest what would be involved in customizing such root filesystem images such that they could be used with other virtualization software, such as VMware, Xen or as an Amazon EC2 instance? Two particular concerns are: If such systems don't use a raw filesystem image (e.g. they need headers with metadata or are compressed in some particular way) do there exist tools to convert between the different formats? I assume that in the filesystem, at least /etc/network/interfaces will have to be customized, but are more involved changes likely to be necessary? Many thanks for any suggestions...

    Read the article

  • Why am I getting a Sharepoint error on a simple "hello world" web page?

    - by Fetchez la vache
    I've been granted admin access to an internal IIS server on which I need to set up a web site. Before doing anything technical I wanted to ensure that I could access the server, but when attempting to access a simple page (that does not refer to Sharepoint) at http://localhost/index.html when logged onto the server directly, I am getting Parser Error Description: An error occurred during the parsing of a resource required to service this request. Please review the following specific parse error details and modify your source file appropriately. Parser Error Message: Could not load file or assembly 'Microsoft.SharePoint' or one of its dependencies. The system cannot find the file specified. Source Error: Line 1: <%@ Assembly Name="Microsoft.SharePoint"%><%@ Application Language="C#" Inherits="Microsoft.SharePoint.ApplicationRuntime.SPHttpApplication" %> Source File: /global.asax Line: 1 Assembly Load Trace: The following information can be helpful to determine why the assembly 'Microsoft.SharePoint' could not be loaded. WRN: Assembly binding logging is turned OFF. To enable assembly bind failure logging, set the registry value [HKLM\Software\Microsoft\Fusion!EnableLog] (DWORD) to 1. Note: There is some performance penalty associated with assembly bind failure logging. To turn this feature off, remove the registry value [HKLM\Software\Microsoft\Fusion!EnableLog]. -------------------------------------------------------------------------------- Version Information: Microsoft .NET Framework Version:2.0.50727.5456; ASP.NET Version:2.0.50727.5456 To be quite honest I know zip about Sharepoint, so why am I getting a sharepoint error on a basic "hello world" html page? Cheers :) Update: I've since supposedly uninstalled Sharepoint, but am still getting this error. Any ideas welcome!

    Read the article

  • In-Page RSS Reader (Flash? Javascript?)

    - by Jonathan Sampson
    Has anybody ever seen any (no-installs-necessary) solutions to listing any RSS feed on any page of a website? Ideally it would consist of HTML (javascript if necessary) and require no downloads or installs. I am thinking of twitter-style apps that you load up in an iframe or via Javascript and in turn they show your latest tweets on the page - same concept, different content. Just looking for a shiny gadget, not able to write my own solution for this particular project.

    Read the article

  • Website & Forum sharing the same login credentials ?

    - by Brian
    I am going to be running a small site (100 hits a week maybe) and I am looking for a quick and easy way to share login information between the main website, a control panel (webmin, cpanel, or something), and the forum. One login needed to access any of the three. The website won't have use for the login, per say. But it will display "logged in" when you are on the website. Any custom solutions, any thoughts, logic, examples?

    Read the article

  • Am I safe on Windows if I continue like this?

    - by max
    Of all the available tons of anti-malware software for Windows all over the internet, I've never used any paid solution(I am a student, I have no money). Since the last 10 years, my computers running Windows have never been hacked/compromised or infected so badly that I had to reformat them(of course I did reformat them for other reasons). The only program I have for security is Avast Home Edition, which is free, installed on my computers. It has never caused any problems; always detected malware, updated automatically, has an option to sandbox programs and everything else I need. Even if I got infected, I just did a boot-time scan with it, downloaded and ran Malwarebytes, scanned Autoruns logs, checked running processes with Process Explorer and did some other things and made sure I cleaned my computer. I am quite experienced and I've always taken basic precautions like not clicking suspicious executables, not going to sites which are suspicious according to WOT, and all that blah. But recently I've been doing more and more online transactions and since its 2012 now, I'm doubtful whether I need more security or not. Have I been just lucky, or do my computing habits obviate the need to use any more(or paid) security software?

    Read the article

  • Trouble with Remote Desktop pulling through printers. Drive Redirection works, and the ports created but not the printers

    - by Windex
    I've run out of things to look into. All the support documents have been gone through and still provide no resolution. I've checked the service permissions, (sc sdshow spooler) they all match up with other systems and what is output on the support documents. I'm nearly positive that the issue can't be permissions anyway as the software requires all users to be an administrator, so all users are a local administrator. (I haven't looked into why yet but its on the list, I was just recently brought into this team and we've put procedures in place for quick recovery.) We've applied hot fixes relating to RDS and printing, though I'm not sure which ones they were. I've combed through group policy and no where is printer redirection disabled. It's setup with all default values regarding the use and redirection of printers and a quick install of W2k8 R2 shows that it works by default. This dev install was joined to the same domain, placed in the same OU, shows the same policies applied, etc, etc, etc, The server generates all the correct redirected ports but no printers are created. It will also redirect drives without issue, this would seem to rule out the usermode service that handles redirects being broken. No events are logged related to any of the events and there are no events from the TerminalServices-Printer source. There were local printers setup. I didn't think it would mattter but as I was running out of ideas I tried deleting them all with no change. The TS was configured for the software it will be running before we checked out the redirection of printers so the other team responsible to setting up new servers wants to find a fix instead of reloading a new server. I'm not sure where or what else to look for. Any ideas?

    Read the article

  • unable to type in web browser ubuntu 64bit

    - by mononym
    Hi Guys, I upgraded to 64bit ubuntu and every now and again (quite often though) i am unable to to type into the search box for google in chrome and firefox, i havent tried other browsers as these are the 2 i primarily use. Has anyone else experienced this? any solutions? also i'm unable to drag the slider in youtube (in firefox) to scan through videos.

    Read the article

  • How do you monitor and react when some scheduled job fails? - general question

    - by Dzida
    Hi, In many projects my team faced problems with 'silent fails' of some important components. There are lot of tasks executed behind the scenes and if somethings fails (either by errors in logic or hardware problems) in most cases responsible person is not notified (or not notified instantly). I know about heavy-weight monitoring tools that could solve some of that problems but there over-complicated and too expensive for our team. I am interested what are your solutions for such problems.

    Read the article

  • Blocking IP addresses Load Balanced Cluster

    - by Dom
    Hi We're using HAproxy as a front end load balancer / proxy and are looking for solutions to block random IP addresses from jamming the cluster. Is anyone familiar with a conf for HAProxy that can block requests if they exceed a certain threshold from a single IP within a defined period of time. Or can anyone suggest a software solution which could be placed in front of HAProxy to handle this kind of blocking. Thanks Dom--

    Read the article

  • Best format for hard drive for Windows and Mac?

    - by Neil
    I have a 500 GB USB External Hard Drive. I need four partitions on it, for the following purposes: 160 GB for a bootable backup of my Mac. 160 GB for a bootable backup of my Windows. 11 GB for a bootable Snow Leopard Install Disk Rest as for file storage. Now I need a partition table which will get recognised on both Windows and Mac, without needing extra software on Windows, which will let me keep bootable copies of both OS'es, but let me access the file storage from both OS'es. Currently, I have a GUI Partition Table, with Mac OS Extended (Journaled) Partitions for the two backups, Mac OS Extended for the Install Disk, and NTFS for the file storage. While this gets recognised perfectly on my Mac, thanks to an NTFS for Mac driver from Paragon, when connected to Windows, the drive is detected by the machine (listed in Safely Remove USB), but not recognised in Windows Explorer unless I install MacDrive, which is not feasible for me to install on public Windows Machines I might wanna access my storage area on. Can someone recommend the best combination of formats and software/drivers to get this done seamlessly?

    Read the article

  • How can I make vim show the current class and method I'm editing

    - by dcrosta
    Does anyone know if it's possible (or know of an existing vim script or plugin) that can create a "status bar" that shows the name of the current class and method (or function) I'm editing? I'm imagining that it would plug into the syntax parser for the filetype of the current buffer, and display a breadcrumb trail to show you what you're currently editing. I don't know vimscript well enough to suggest any more than that, but if there aren't any good solutions already, I may begin to hack on one, so suggestions as to where to start are welcome, too!

    Read the article

  • Linux that restores itself on each reboot

    - by jettero
    I'm looking for methods and software to help create a variant of lubuntu that will restore itself to an install state and/or update on every boot. I'm thinking of doing things like putting the root filesystem on a squashfs and using unionfs and tmpfs to make root writable, but automagically restorable. I'm thinking of updating the squashfs with rsync. Perhaps there are other ways to approach the problem. Perhaps root needn't be writable at all. All thoughts welcome. The home dir would be writable in the usual way. The goal, if it matters, is a Linux that's simple to maintain from the home office, but that functions correctly for customers. We have some custom software that we wish for customers to be able to run trivially on equipment we provide. Ideally these devices would have a "restore to factory" function that would put it back the way we intended. If this is part of the normal boot cycle, so much the better. Why lubuntu? Personal preference for this application. It has a usable desktop, but doesn't take up much ram.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Circumvent proxy filter that disables the download of EXE files

    - by elgrego
    Do you know of a way to download exe files although the web proxy has a filter in place not to allow this? I have searched for a feature web site that does automatic file renaming. That should certainly make it possible. The solution would take a URL and then change the extension so that it would look to my proxy as I was downloading a .dat file (or similar). There are perhaps other solutions to this problem.

    Read the article

  • Any way to Sync Google Bookmarks to iPhone OTA?

    - by BenA
    Does anybody know if its possible to sync Google Bookmarks over the air to my iPhone? Either natively or with an App? Googling it only seems to yield solutions involving importing my bookmarks to IE, and then syncing through iTunes. I'd like to skip both of these middlemen if thats at all possible.

    Read the article

  • 2.6.9 Kernel on virtual server (non upgradable) - any expected problems?

    - by chris_l
    Hi, I'm considering to rent a virtual server (for me personally). The product I'm currently looking at offers IMO fair pricing, very good hardware etc. The only problem is, that I won't be able to do an upgrade to a newer kernel than 2.6.9 (running Debian Etch). Also, I can't install my own kernel modules. (The server runs with Virtuozzo, so as far as I understand it, it just does some chroot instead of a real virtualization (?)) I want to run GlassFish, Postgres, Subversion, Trac and maybe some other things on it. It will also have to employ a firewall, and provide OpenSSL for https. Ideally, it would also be able to do AIO (asynchronous IO), which could speed up some server I/O. Should I expect problems with that old kernel version, in conjunction with the software I want to install (I'd like to use current versions of the software)? One thing I already found out, is that you can't do everything with iptables, since some kernel modules are missing/things are not build into the kernel. GlassFish v3 appears to run fine at first glance. I was able to test the server for a few hours. Installing my whole setup wasn't feasible in that time, but what I can say is, that it's amazingly fast for an entry-level vserver, especially hard disk and network performance (averaging at ca. 400MBit/s). So if the kernel won't be a problem, I'd really like to take it. Thanks, Chris PS Exact kernel version: 2.6.9-023stab051.3-smp

    Read the article

  • Managing records of bugs and notes

    - by Jim
    Hi. I want to create a knowledgebase for a piece of software. I'd also like to be able to track bugs and common points of failure in that application. Linking knowledgebase articles to bug records would be a real boon, as would the ability to do complex queries for particular articles and bugs on the basis of tags or metadata. I've never done anything like this before, and like to install as little as possible. I've been looking at creating a wiki with Wiki On A Stick, and it seems to offer a lot. But I can't make complex queries. I can create pages that list all 'articles' with a particular single tag, but I can't specify multiple tags or filters. Is there any software that can help? I don't want to spend money until I've tried something out thoroughly, and I'd ideally like something that demands little-to-no installation. Are there any tools that can help me? If something could easily export its data, or stored data in XML, that would be a real plus too. Otherwise, are there any simple apps that allow me to set up forms for bugs, store data as XML then query and process that XML on demand? Thanks in advance.

    Read the article

  • ffdshow h.264 audio desync

    - by Core Xii
    When I encode video with ffdshow with h.264, the audio is out of sync. At the very beginning of the video, the picture freezes for about 1 second, while the audio plays fine, resulting in the audio being that 1 second ahead of the picture throughout the entire video. Any ideas on possible causes or, obviously, solutions?

    Read the article

  • mod_rewrite and Apache questions

    - by John
    We have an interesting situation in relation to some help desk software that we are trying to setup. This is a web based software application that allows customers and staff to log into it and access tickets and supply updates, etc. The challenge we are having deals with the two different domains that we use and the mod_rewrite rules to make it all work with our SSL certificate that is only bound to one of the domains. I will list the use case scenarios below and the challenges that we are having. If you access http://support.domain1.com/support then it redirects fine to https://support.domain2.com/support If you access http://support.domain2.com/support then it redirects fine to https://support.domain2.com/support If you access https://support.domain1.com/support then it throws an error of "server cannot be found" If you access https://support.domain1.com/support/ after having visited https://support.domain2.com/support then you are presented with a "this connection is untrusted" error about the certificate only being valid for the domain2 domain instead of the domain1 domain name I have tried just about every mod_rewrite rule that I can think of to help make this work and I have not been able to locate the correct combination. I was curious if anyone had some ideas on how to make the redirects work correctly. In the end, we are needing all customers and staff to land at https://support.domain2.com/support regardless of the previous URL combinations that they enter, like listed above. Thanks in advance for your help with this.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 424 425 426 427 428 429 430 431 432 433 434 435  | Next Page >