Search Results

Search found 70915 results on 2837 pages for 'file permissions'.

Page 43/2837 | < Previous Page | 39 40 41 42 43 44 45 46 47 48 49 50  | Next Page >

  • ssh login successful, but scp password gives me "Permission denied"

    - by YANewb
    I'm trying to get some blogging software up on an organizational remote server. I tried to set up a SSH Key but was having problems and decided that getting the blog up and running was more important than dealing with the SSH Key issue, so I ssh-keygen -R remoteserver.com. Now I can successfully login with ssh -v [email protected] and the correct password. Once logged in I can move around and read any file and directory that I should be able to read. But when I try to edit an existing -rw-r--r-- file with VIM, it shows up as read-only, if I try to edit permissions I get chmod: file.ext: Operation not permitted, and if I try to scp a new file from my local machine I'm prompted for the remote user's password, and then get scp: /home/path/to/file.ext: Permission denied. Since I didn't have any of these problems before I tried to set up the ssh key, I suspect these anomalies are a side effect of that, but I don't know how to troubleshoot this. So what does a foolish server-newb, such as myself, need to do to get edit capability back as a remote user? Addendum 1: My userids are different between my local machine and the remote server. For ssh I ssh -v [email protected]. if I whoami I get remoteuser For scp I scp file.ext [email protected]:/path/to/file.ext from the local directory with file.ext while logged in as the local user. if I whoami I get localuser The ls -l for two different files I've tried scp: -rw-r--r--@ 1 localuser localgroup 20 Feb 11 21:03 phpinfo.php -rw-r--r-- 1 root localgroup 4 Feb 11 22:32 test.txt The ls -l for the file I've tried to VIM: -rw-r--r-- 1 remoteuser remotegroup 76 Jul 27 2009 info.txt Addendum 2: In the past I've set up ssh-keys for git repositories. I don't want to completely destroy them, so in an attempt to follow a deer's train of thinking I renamed my ~/.ssh/ to ~/.ssh-bak/, then tested the different types of access. The abridged version of the terminal commands and results is below; I think everything is working until the 8th line from the end. localcomputer:~ localuser$ ssh -v [email protected] OpenSSH_5.2p1, OpenSSL 0.9.8l 5 Nov 2009 debug1: Reading configuration data /etc/ssh_config debug1: Connecting to remoteserver.com [###.###.###.###] port 22. debug1: Connection established. debug1: identity file /Users/localuser/.ssh/identity type -1 debug1: identity file /Users/localuser/.ssh/id_rsa type -1 debug1: identity file /Users/localuser/.ssh/id_dsa type -1 debug1: Remote protocol version 2.0, remote software version OpenSSH_5.8p2 FreeBSD-20110503 debug1: match: OpenSSH_5.8p2 FreeBSD-20110503 pat OpenSSH* debug1: Enabling compatibility mode for protocol 2.0 debug1: Local version string SSH-2.0-OpenSSH_5.2 debug1: SSH2_MSG_KEXINIT sent debug1: SSH2_MSG_KEXINIT received debug1: kex: server->client aes128-ctr hmac-md5 none debug1: kex: client->server aes128-ctr hmac-md5 none debug1: SSH2_MSG_KEX_DH_GEX_REQUEST(1024<1024<8192) sent debug1: expecting SSH2_MSG_KEX_DH_GEX_GROUP debug1: SSH2_MSG_KEX_DH_GEX_INIT sent debug1: expecting SSH2_MSG_KEX_DH_GEX_REPLY The authenticity of host 'remoteserver.com (###.###.###.###)' can't be established. RSA key fingerprint is ##:##:##:##:##:##:##:##:##:##:##:##:##:##:##:##. Are you sure you want to continue connecting (yes/no)? yes Warning: Permanently added 'remoteserver.com,###.###.###.###' (RSA) to the list of known hosts. debug1: ssh_rsa_verify: signature correct debug1: SSH2_MSG_NEWKEYS sent debug1: expecting SSH2_MSG_NEWKEYS debug1: SSH2_MSG_NEWKEYS received debug1: SSH2_MSG_SERVICE_REQUEST sent debug1: SSH2_MSG_SERVICE_ACCEPT received debug1: Authentications that can continue: publickey,password debug1: Next authentication method: publickey debug1: Trying private key: /Users/localuser/.ssh/identity debug1: Trying private key: /Users/localuser/.ssh/id_rsa debug1: Trying private key: /Users/localuser/.ssh/id_dsa debug1: Next authentication method: password [email protected]'s password: debug1: Authentication succeeded (password). debug1: channel 0: new [client-session] debug1: Requesting [email protected] debug1: Entering interactive session. Last login: Sun Feb 12 18:00:54 2012 from 68.69.164.123 FreeBSD 6.4-RELEASE-p8 (VKERN) #1 r101746: Mon Aug 30 10:34:40 MDT 2010 [remoteuser@remoteserver /home]$ ls -l total ### -rw-r--r-- 1 remoteuser remotegroup 76 Aug 12 2009 info.txt [remoteuser@remoteserver /home]$ vim info.txt ~ {at the bottom of the VIM screen it tells me it's [read only]} [remoteuser@remoteserver /home]$ whoami remoteuser [remoteuser@remoteserver /home]$ logout debug1: client_input_channel_req: channel 0 rtype exit-status reply 0 debug1: client_input_channel_req: channel 0 rtype [email protected] reply 0 debug1: channel 0: free: client-session, nchannels 1 Connection to remoteserver.com closed. Transferred: sent 3872, received 12496 bytes, in 107.4 seconds Bytes per second: sent 36.1, received 116.4 debug1: Exit status 0 localcomputer:localdirectory name$ scp -v phpinfo.php [email protected]:/home/www/remotedirectory/phpinfo.php Executing: program /usr/bin/ssh host remoteserver.com, user remoteuser, command scp -v -t /home/www/remotedirectory/phpinfo.php OpenSSH_5.2p1, OpenSSL 0.9.8l 5 Nov 2009 debug1: Reading configuration data /etc/ssh_config debug1: Connecting to remoteserver.com [###.###.###.###] port 22. debug1: Connection established. debug1: identity file /Users/localuser/.ssh/identity type -1 debug1: identity file /Users/localuser/.ssh/id_rsa type -1 debug1: identity file /Users/localuser/.ssh/id_dsa type -1 debug1: Remote protocol version 2.0, remote software version OpenSSH_5.8p2 FreeBSD-20110503 debug1: match: OpenSSH_5.8p2 FreeBSD-20110503 pat OpenSSH* debug1: Enabling compatibility mode for protocol 2.0 debug1: Local version string SSH-2.0-OpenSSH_5.2 debug1: SSH2_MSG_KEXINIT sent debug1: SSH2_MSG_KEXINIT received debug1: kex: server->client aes128-ctr hmac-md5 none debug1: kex: client->server aes128-ctr hmac-md5 none debug1: SSH2_MSG_KEX_DH_GEX_REQUEST(1024<1024<8192) sent debug1: expecting SSH2_MSG_KEX_DH_GEX_GROUP debug1: SSH2_MSG_KEX_DH_GEX_INIT sent debug1: expecting SSH2_MSG_KEX_DH_GEX_REPLY debug1: Host 'remoteserver.com' is known and matches the RSA host key. debug1: Found key in /Users/localuser/.ssh/known_hosts:1 debug1: ssh_rsa_verify: signature correct debug1: SSH2_MSG_NEWKEYS sent debug1: expecting SSH2_MSG_NEWKEYS debug1: SSH2_MSG_NEWKEYS received debug1: SSH2_MSG_SERVICE_REQUEST sent debug1: SSH2_MSG_SERVICE_ACCEPT received debug1: Authentications that can continue: publickey,password debug1: Next authentication method: publickey debug1: Trying private key: /Users/localuser/.ssh/identity debug1: Trying private key: /Users/localuser/.ssh/id_rsa debug1: Trying private key: /Users/localuser/.ssh/id_dsa debug1: Next authentication method: password [email protected]'s password: debug1: Authentication succeeded (password). debug1: channel 0: new [client-session] debug1: Requesting [email protected] debug1: Entering interactive session. debug1: Sending command: scp -v -t /home/www/remotedirectory/phpinfo.php Sending file modes: C0644 20 phpinfo.php Sink: C0644 20 phpinfo.php scp: /home/www/remotedirectory/phpinfo.php: Permission denied debug1: client_input_channel_req: channel 0 rtype exit-status reply 0 debug1: channel 0: free: client-session, nchannels 1 debug1: fd 0 clearing O_NONBLOCK debug1: fd 1 clearing O_NONBLOCK Transferred: sent 1456, received 2160 bytes, in 0.6 seconds Bytes per second: sent 2322.3, received 3445.1 debug1: Exit status 1

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Permissions issues with mounting remote server into a specific folder

    - by Patrick
    I'm doing the following to mount a remote server to a specific path on my server: sshfs [email protected]:/backup/folder/ /home/myuser/server-backups/ However when I mount the server the folder permissions change (they become 700), and when I test my rsnapshot.conf file I get the following error: snapshot_root /home/myuser/server-backups/ - snapshot_root exists \ but is not readable What am I doing wrong ? should I mount the remote server with another user ?

    Read the article

  • CVE-2012-3524 Permissions, Privileges, and Access Controls vulnerability in libdbus

    - by Umang_D
    CVE DescriptionCVSSv2 Base ScoreComponentProduct and Resolution CVE-2012-3524 Permissions, Privileges, and Access Controls vulnerability 6.9 libdbus Solaris 11 11/11 SRU 12.4 This notification describes vulnerabilities fixed in third-party components that are included in Oracle's product distributions.Information about vulnerabilities affecting Oracle products can be found on Oracle Critical Patch Updates and Security Alerts page.

    Read the article

  • Digital Asset Management, iPhoto / Aperture server... alternative

    - by Sisyphus
    Afternoon, Clients, 10 : All Apples running either Leopard or Snow Leopard Server : Snow Leopard server, (and I have a old Dell Poweredge 650 at home running Gentoo 2.6, if anybody as a Linux solution). The situation: I work in small design company with 8 people, at present we are looking to consolidate all our image files onto one location, at present we each use our preferred single user DAM solution, be it, Adobe Bridge, iPhoto/Aperture (some don't bother at all) The filetypes commonly used are .psd, .pdf, .eps, .tiff, .jpg and RAW image files. Ideally what is needed: Centralised on one server, but allows us to search via spotlight (not essential, but would be nice) Include searchable metadata information such as date, location, title Open-source or as low cost as possibly Allow simultaneous users to import files So far, I have looked at a few open source DAM, systems, such as Razuna, Gallery (not strictly DAM), ResourceSpace, Notre-DAM, while these are brilliant and open-source, they don't integrate as smoothly with the Desktop as iPhoto and aperture. For iPhoto and aperture, I have tried creating a Shared library on the server (a tad laggy), and also using a drive with no permissions, put a library and letting each client read from it, however if they want to put images onto the library only, it's only supports one user at a time writing to the library... Any ideas what could fulfill our needs? Or is it time to bite the bullet for FinalCut Server? Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • Prevent Windows 7 User Accounts from accessing files in other User Accounts

    - by Mantis
    I'm trying to set up another User Account on my Windows 7 Professional laptop for use by another person. I do not want that person to have access to any of the files in my User Account on the same machine. This machine has a single hard disk formatted with NTFS. User accounts data is stored in the default location, C:\Users. I use the computer with a Standard Account (not an Administrator). Let's call my user account "User A." I have given the new user a Standard Account. Let's call the new user's account "User B." To be clear, I want User B to have the ability to log in to her account, to use the computer, but to be unable to access any of the files in the User A account on the same machine. Currently, User B cannot use Windows Explorer to navigate to the location C:\Users\User A. However, by simply using Windows Search, User B can easily find and open documents saved in C:\Users\User A\Documents. After opening a document, that document's full path appears in "Recent Places" in Windows Explorer, and the document appears as a file that can be opened using the "Recent" feature in Word 2010. This is not the desired behavior. User B should not have the ability to see any documents using Windows Search or anything else. I have attempted to set permissions using the following procedure. Using an Administrator account, navigate to C:\Users and right-click on the "User A" folder. Select "Properties." In the "User A Properties" window that appears, click the "Security" tab. Click the "Edit..." button to change permissions. IN the "Permissions for User B" window that appears, under "Group or User Names," select User B. Under "Permissions for User B", check the box under the "Deny" column for the "Full Control" row. Ensure that the "Deny" box is automatically checked for all the other rows, and then click "OK." The system should then begin working. The process could take several minutes. When I followed this procedure, I received several "Access Denied" errors, suggesting that the system was unable to set the permissions as I had directed. I think this might be one of the reasons why User B is still able to access files in User A's account folders. Is there any other way I could accomplish my goal here? Thank you.

    Read the article

  • Read Only usb stick that won't let me do anything to it

    - by Jonathon
    Somehow I messed up and accidentally made my usb stick into a read only file system. I have tried a bunch of things to delete the files, including the basic (rm -f myfile) and attempting to allow writing (sudo chmod +w myfile) and then deleting, but none of this seems to work. Any ideas on what I can do. I don't have anything on the usb stick that I need, but I don't want to throw away an otherwise perfectly good piece of equipment. How can I make it work? Am I going about this completely the wrong way?

    Read the article

  • TOR Error permission issue

    - by LeChiffte
    I've tried reinstalling, updating, and removing and then reinstalling. Nothing seems to work. See screenshot below: the output of gedit /home/skynet/.tor-browser-en/LOG (The installation log) is: /usr/bin/tor-browser-en.sh: Your version in /home/skynet/.tor-browser-en is outdated or you do not have installed tor-browser-en yet. /usr/bin/tor-browser-en.sh: Extracting files to /home/skynet/.tor-browser-en/INSTALL. tar (child): /opt/tor-browser-en/tor-browser-linux64-3.6.2_en-US.tar.xz: Cannot open: No such file or directory tar (child): Error is not recoverable: exiting now tar: Child returned status 2 tar: Error is not recoverable: exiting now

    Read the article

  • I want a non admin user to install software. What commands do I need to add to sudoers?

    - by Chance
    I want to edit the /etc/sudoers file so that a non-admin user can install software via the Software Center in Linux Mint 10. The reason for this is that I want a user to have the capability to install programs, but not make any other configuration changes to the system. So far I have the following (some of these may not make sense, I was just trying whatever I thought of) username ALL= /usr/bin/aptitude username ALL= /usr/bin/dpkg username ALL= /usr/local/bin/apt-get username ALL= /usr/lib/linuxmint/mintUpdate/mintUpdate.py username ALL= /usr/bin/software-center username ALL= /usr/bin/synaptic So far, it allows me to do updates without asking for my password, but it will not let me install software without entering an admin password. I am aware of this question, How can I set the Software Center to install software for non-root users?, but this goes the route of modifying the PolicyKit, whereas I'm interested in a sudo solution, because it seems a simpler way to go.

    Read the article

  • K3b - cdrecord has no permission

    - by user64386
    I use Ubuntu 12.04. Today I tried to burn an ISO file in a DVD-R disk using K3b. It used to work, but today, after one and a half minutes, it stopped saying that "cdrecord has no permission to open the device". I searched for a solution, and I found that I had to do something with k3bsetup. I tried to use it, but I had no idea what to do, and I couldn't find a guide, so I checked cdrecord and clicked apply. Now there is another error; it says "cdrecord returns an unknown error! (code 254)". What should I do?

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

< Previous Page | 39 40 41 42 43 44 45 46 47 48 49 50  | Next Page >