Search Results

Search found 21908 results on 877 pages for 'content catalog'.

Page 432/877 | < Previous Page | 428 429 430 431 432 433 434 435 436 437 438 439  | Next Page >

  • How can I configure OSX/Windows7 to send ALL traffic though VPN tunnel?

    - by lrrrgg
    While connected to a VPN (SwissVPN service), a content filter at a site I'm working at blocked a web page. This was perplexing, since the local site's filter should not be able to see my traffic, right? So I assume my web browsing activity was not going through the VPN tunnel. How can I configure the OS to send ALL traffic though the currently connected VPN tunnel? I'm using OSX Lion and Windows 7. Thanks!

    Read the article

  • How to allow only specific directories to use htaccess?

    - by DisgruntledGoat
    Currently in apache2.conf I have AllowOverride all set for /var/www which simply allows htaccess for all the sites on the server (which is Ubuntu, 9.04). However, I'd rather only allow overrides in each site root directory and nothing else. In other words, /var/www/site1, /var/www/site2, etc. can have a htaccess, but all other directories including /var/www and /var/www/site1/content cannot. Is there a way to do this without having to write a rule for every site on the server?

    Read the article

  • Encrypt windows 8 file history

    - by SnippetSpace
    File history is great but it saves your files on the external drive without any encryption and stores them using the exact same folder structure as the originals. If a bad guy gets his hands on the hard drive it could basically not be easier to get to your important files. Is there any way to encrypt the file history backup without breaking its functionality and without having to encrypt the original content itself? Thanks for your input!

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Streaming from a second computer

    - by techgod52
    I play games on my laptop, and they run at about 30-45 fps, which is bearable for me. But when I try to stream, the frame rate drops to 20 or lower, which is unplayable for me. I have a second computer though (a Mac, the laptop is Win7), and I'm wondering if there is anyway to stream the game content (onto Twitch.tv) from my laptop using my Mac. Is this possible, and how would I go about doing it?

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • Windows XP restarts itself suddenly

    - by LaD
    My computer (Windows XP sp3) gets stuck suddenly and restarts itself. When Windows loads I get the following message: error Signature: BCCode : 100000d1 BCP1 : 0000674B BCP2 : 00000002 BCP3 : 00000000 BCP4 : BA9910DC OSVer : 5_1_2600 SP : 3_0 Product : 256_1 error report content: C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\Mini090909-02.dmp C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\sysdata.xml Help! Thanks.

    Read the article

  • How to schedule server jobs more intelligently than with cron?

    - by John
    I run a job every minute to reindex my site's content. Today, the search engine died, and when I logged in there were hundreds of orphan processes that had been started by cron. Is there another way using some kind of existing software that will let me execute a job every minute, but that won't launch another instance if that job doesn't return (i.e. because the search engine process has failed)?

    Read the article

  • Which guide do you recommend on setting up Nginx

    - by Saif Bechan
    I am setting up an LEMP (Nginx, MySQL, PHP on Linux) from scratch. There are a lot of guides available online in all different forms. Now I want a setup with virtual hosts, and only serve dynamic content (PHP). My static files(images,css,js) are on a CDN. Do you know of a good guide on setting up the LEMP installation.

    Read the article

  • How to append to a file as sudo? [closed]

    - by obvio171
    Possible Duplicate: sudo unable to write to /etc/profile I want to do: echo "something" >> /etc/config_file But, since only the root user has write permission to this file, I can't do that. But this: sudo echo "something" >> /etc/config_file also doesn't work. Is there any way to append to a file in that situation without having to first open it with a sudo'd editor and then appending the new content by hand?

    Read the article

  • How to register rss for a website?

    - by domainking
    I am not sure if I ask this question in the right place, because I am new to it. What I want to ask is, do I need to register/create RSS for my website? I have a website, lets say: [http://blog.domain.com] = its a 2.9.2 wordpress blog So, if I want to display the latest content in another subdomain, for example: [news.domain.com], how do I do that? I know a little bit of php and mysql.

    Read the article

  • Invalid command 'SSLRequireSSL',

    - by Bad Programmer
    An svn server that I managed crashed. The server is up and running again, but I can't manage to get svn running anymore. I followed the instructions listed here: http://mark.koli.ch/2010/03/howto-setting-up-your-own-svn-server-using-apache-and-mod-dav-svn.html Yet when I try to start apache using /etc/init.d/httpd start I get a [FAILED] message. There is no content in the error logs. Any suggestions?

    Read the article

  • How can I tell if I'm behind a portal or proxy

    - by user19269
    I'm testing out a Content management system on my computer and have emailed their support for a problem regarding login.. They've replied back and asked if my CMS is behind a portal or proxy. I feel kind of stupid for not knowing this, but how do I find out? Everything is local (eg, hosted on my computer, etc). Thanks in advance!

    Read the article

  • Export Specific Page from MediaWiki

    - by wag2639
    We have an internal document wiki running on MediaWiki (latest stable). Is there a way we can export a specific page for a customer without giving them access to the entire wiki (which is currently behind a PAM-based authentication). Edit1: Sorry for the vagueness, I meant is there a way to syndicate a specific page so that they don't actually have access to the wiki but the content is still available and up-to-date. For example, the page I want them to see http://mysite.com/wiki/page_to_see Can I have it available at http://mysite.com/outsite_wiki

    Read the article

  • what TERM to use to get rid of color escape codes?

    - by slivu
    Is there a way to get rid of escape codes in terminal output? Say even if the script are sending that codes they are ignored by terminal and text displayed as is, without colors, bolds etc. I need to display terminal output on a HTML page. For now i'm using javascript to remove escape codes, but it becomes clunky cause i receive output by chars, and have to wait until all content received then update it, leading in weird effects.

    Read the article

  • Svn hook on commit makes lock

    - by dynback.com
    My post-commit hook looks like this: pushd C:\Websites\Project svn update I am updating my server copy of repository. When I commit client stopped on sending content and locked or I dont know. Its is waiting for something. So when I cancel and try to update manually on server, I see: Working copy "." lockedsvn And only after manual cleanup and update again, I get updated revision, that was really commited. What I do wrong?

    Read the article

  • Problem connecting to Hsqldb via Hibernate when running a Eclipse GWT project.

    - by Toby
    Hi, I'm trying to run a simple GWT project where I'm trying to do a simple persitence via hibernate to a HSQLDB database. The database I'm using I have been using for at least 2 years with several osgi applications without any problems. So all I done is reused the same configuration and added a simple object mapping file. The problem I have is that I get a socket creation error when ever I try to persist the object with in GWT jetty. I now the database is up and running, I can telnet to it, run OSGI projects that uses the same config with out problems. This is the stack I get when running 25 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Environment - Hibernate 3.3.1.GA 30 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Environment - hibernate.properties not found 34 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Environment - Bytecode provider name : javassist 42 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Environment - using JDK 1.4 java.sql.Timestamp handling 162 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Configuration - configuring from resource: hibernate.cfg.xml 162 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Configuration - Configuration resource: hibernate.cfg.xml 268 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Configuration - Reading mappings from resource : hbm-mappings/project.hbm.xml 382 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.HbmBinder - Mapping class: se.kanit.projectmgr.db.ProjectDAO - T_PROJECT 419 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.Configuration - Configured SessionFactory: null 3534 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - Using Hibernate built-in connection pool (not for production use!) 3534 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - Hibernate connection pool size: 1 3534 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - autocommit mode: false 3537 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - using driver: org.hsqldb.jdbcDriver at URL: jdbc:hsqldb:hsql://localhost:1476/dirtyharry 3537 [21704474@qtp-26509496-0] INFO org.hibernate.connection.DriverManagerConnectionProvider - connection properties: {user=sa, password=****} 3594 [21704474@qtp-26509496-0] WARN org.hibernate.cfg.SettingsFactory - Could not obtain connection metadata java.sql.SQLException: socket creation error at org.hsqldb.jdbc.Util.sqlException(Unknown Source) at org.hsqldb.jdbc.jdbcConnection.(Unknown Source) at org.hsqldb.jdbcDriver.getConnection(Unknown Source) at org.hsqldb.jdbcDriver.connect(Unknown Source) at java.sql.DriverManager.getConnection(DriverManager.java:582) at java.sql.DriverManager.getConnection(DriverManager.java:154) at org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) at org.hibernate.cfg.SettingsFactory.buildSettings(SettingsFactory.java:111) at org.hibernate.cfg.Configuration.buildSettings(Configuration.java:2101) at org.hibernate.cfg.Configuration.buildSessionFactory(Configuration.java:1325) at se.kanit.projectmgr.db.HibernateUtil.(HibernateUtil.java:24) at se.kanit.web.projectmgr.server.issues.IssuesService.addIssue(IssuesService.java:26) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at com.google.gwt.user.server.rpc.RPC.invokeAndEncodeResponse(RPC.java:562) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processCall(RemoteServiceServlet.java:188) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processPost(RemoteServiceServlet.java:224) at com.google.gwt.user.server.rpc.AbstractRemoteServiceServlet.doPost(AbstractRemoteServiceServlet.java:62) at javax.servlet.http.HttpServlet.service(HttpServlet.java:713) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.content(HttpConnection.java:938) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:755) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:218) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) 3626 [21704474@qtp-26509496-0] INFO org.hibernate.dialect.Dialect - Using dialect: org.hibernate.dialect.HSQLDialect 3640 [21704474@qtp-26509496-0] INFO org.hibernate.transaction.TransactionFactoryFactory - Using default transaction strategy (direct JDBC transactions) 3644 [21704474@qtp-26509496-0] INFO org.hibernate.transaction.TransactionManagerLookupFactory - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 3644 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Automatic flush during beforeCompletion(): disabled 3644 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Automatic session close at end of transaction: disabled 3645 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Scrollable result sets: disabled 3645 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - JDBC3 getGeneratedKeys(): disabled 3645 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Connection release mode: auto 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Default batch fetch size: 1 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Generate SQL with comments: disabled 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Order SQL updates by primary key: disabled 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Order SQL inserts for batching: disabled 3646 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Query translator: org.hibernate.hql.ast.ASTQueryTranslatorFactory 3651 [21704474@qtp-26509496-0] INFO org.hibernate.hql.ast.ASTQueryTranslatorFactory - Using ASTQueryTranslatorFactory 3651 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Query language substitutions: {} 3652 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - JPA-QL strict compliance: disabled 3652 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Second-level cache: enabled 3652 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Query cache: disabled 3664 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Cache region factory : org.hibernate.cache.impl.bridge.RegionFactoryCacheProviderBridge 3665 [21704474@qtp-26509496-0] INFO org.hibernate.cache.impl.bridge.RegionFactoryCacheProviderBridge - Cache provider: org.hibernate.cache.NoCacheProvider 3666 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Optimize cache for minimal puts: disabled 3666 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Structured second-level cache entries: disabled 3678 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Statistics: disabled 3678 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Deleted entity synthetic identifier rollback: disabled 3678 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Default entity-mode: pojo 3679 [21704474@qtp-26509496-0] INFO org.hibernate.cfg.SettingsFactory - Named query checking : enabled 3775 [21704474@qtp-26509496-0] INFO org.hibernate.impl.SessionFactoryImpl - building session factory 4155 [21704474@qtp-26509496-0] INFO org.hibernate.impl.SessionFactoryObjectFactory - Not binding factory to JNDI, no JNDI name configured 4170 [21704474@qtp-26509496-0] INFO org.hibernate.tool.hbm2ddl.SchemaUpdate - Running hbm2ddl schema update 4170 [21704474@qtp-26509496-0] INFO org.hibernate.tool.hbm2ddl.SchemaUpdate - fetching database metadata 4171 [21704474@qtp-26509496-0] ERROR org.hibernate.tool.hbm2ddl.SchemaUpdate - could not get database metadata java.sql.SQLException: socket creation error at org.hsqldb.jdbc.Util.sqlException(Unknown Source) at org.hsqldb.jdbc.jdbcConnection.(Unknown Source) at org.hsqldb.jdbcDriver.getConnection(Unknown Source) at org.hsqldb.jdbcDriver.connect(Unknown Source) at java.sql.DriverManager.getConnection(DriverManager.java:582) at java.sql.DriverManager.getConnection(DriverManager.java:154) at org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) at org.hibernate.tool.hbm2ddl.SuppliedConnectionProviderConnectionHelper.prepare(SuppliedConnectionProviderConnectionHelper.java:51) at org.hibernate.tool.hbm2ddl.SchemaUpdate.execute(SchemaUpdate.java:168) at org.hibernate.impl.SessionFactoryImpl.(SessionFactoryImpl.java:346) at org.hibernate.cfg.Configuration.buildSessionFactory(Configuration.java:1327) at se.kanit.projectmgr.db.HibernateUtil.(HibernateUtil.java:24) at se.kanit.web.projectmgr.server.issues.IssuesService.addIssue(IssuesService.java:26) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at com.google.gwt.user.server.rpc.RPC.invokeAndEncodeResponse(RPC.java:562) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processCall(RemoteServiceServlet.java:188) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processPost(RemoteServiceServlet.java:224) at com.google.gwt.user.server.rpc.AbstractRemoteServiceServlet.doPost(AbstractRemoteServiceServlet.java:62) at javax.servlet.http.HttpServlet.service(HttpServlet.java:713) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.content(HttpConnection.java:938) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:755) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:218) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) 4172 [21704474@qtp-26509496-0] ERROR org.hibernate.tool.hbm2ddl.SchemaUpdate - could not complete schema update java.sql.SQLException: socket creation error at org.hsqldb.jdbc.Util.sqlException(Unknown Source) at org.hsqldb.jdbc.jdbcConnection.(Unknown Source) at org.hsqldb.jdbcDriver.getConnection(Unknown Source) at org.hsqldb.jdbcDriver.connect(Unknown Source) at java.sql.DriverManager.getConnection(DriverManager.java:582) at java.sql.DriverManager.getConnection(DriverManager.java:154) at org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) at org.hibernate.tool.hbm2ddl.SuppliedConnectionProviderConnectionHelper.prepare(SuppliedConnectionProviderConnectionHelper.java:51) at org.hibernate.tool.hbm2ddl.SchemaUpdate.execute(SchemaUpdate.java:168) at org.hibernate.impl.SessionFactoryImpl.(SessionFactoryImpl.java:346) at org.hibernate.cfg.Configuration.buildSessionFactory(Configuration.java:1327) at se.kanit.projectmgr.db.HibernateUtil.(HibernateUtil.java:24) at se.kanit.web.projectmgr.server.issues.IssuesService.addIssue(IssuesService.java:26) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at com.google.gwt.user.server.rpc.RPC.invokeAndEncodeResponse(RPC.java:562) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processCall(RemoteServiceServlet.java:188) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processPost(RemoteServiceServlet.java:224) at com.google.gwt.user.server.rpc.AbstractRemoteServiceServlet.doPost(AbstractRemoteServiceServlet.java:62) at javax.servlet.http.HttpServlet.service(HttpServlet.java:713) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.content(HttpConnection.java:938) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:755) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:218) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) 4293 [21704474@qtp-26509496-0] WARN org.hibernate.util.JDBCExceptionReporter - SQL Error: -80, SQLState: 08000 4293 [21704474@qtp-26509496-0] ERROR org.hibernate.util.JDBCExceptionReporter - socket creation error Cannot open connection org.hibernate.exception.JDBCConnectionException: Cannot open connection at org.hibernate.exception.SQLStateConverter.convert(SQLStateConverter.java:97) at org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:66) at org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:52) at org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:449) at org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) at org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) at org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) at org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1353) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:342) at $Proxy7.beginTransaction(Unknown Source) at se.kanit.projectmgr.db.HibernateUtil.saveOrUpdate(HibernateUtil.java:115) at se.kanit.web.projectmgr.server.issues.IssuesService.addIssue(IssuesService.java:26) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.appengine.tools.development.agent.runtime.Runtime.invoke(Runtime.java:100) at com.google.gwt.user.server.rpc.RPC.invokeAndEncodeResponse(RPC.java:562) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processCall(RemoteServiceServlet.java:188) at com.google.gwt.user.server.rpc.RemoteServiceServlet.processPost(RemoteServiceServlet.java:224) at com.google.gwt.user.server.rpc.AbstractRemoteServiceServlet.doPost(AbstractRemoteServiceServlet.java:62) at javax.servlet.http.HttpServlet.service(HttpServlet.java:713) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.content(HttpConnection.java:938) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:755) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:218) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) Caused by: java.sql.SQLException: socket creation error at org.hsqldb.jdbc.Util.sqlException(Unknown Source) at org.hsqldb.jdbc.jdbcConnection.(Unknown Source) at org.hsqldb.jdbcDriver.getConnection(Unknown Source) at org.hsqldb.jdbcDriver.connect(Unknown Source) at java.sql.DriverManager.getConnection(DriverManager.java:582) at java.sql.DriverManager.getConnection(DriverManager.java:154) at org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) at org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:446) ... 49 more Any tips and ideas are greatly appreciated. Cheers. Toby.

    Read the article

  • Android app crashes on emulator - logCat shows no errors

    - by David Miler
    I have just added the SherlockActionBar library to my android project. After some small changes (FragmentActivity - SherlockFragmentActivity, getActionBar() - getSupportActionBar(), imports) it all compiled nicely. After I run the app, however, the debugger stops, as though it had encountered an exception. However, there are no errors shown in the LogCat output. I just can't wrap my head around what's going on. Here is the logCat output after I terminate the app. 10-02 14:11:19.227: I/SystemUpdateService(174): UpdateTask at time 1349187079227 10-02 14:11:19.237: I/ActivityThread(328): Pub com.android.email.attachmentprovider: com.android.email.provider.AttachmentProvider 10-02 14:11:19.687: I/dalvikvm(81): Jit: resizing JitTable from 512 to 1024 10-02 14:11:19.809: D/MediaScannerService(150): start scanning volume internal: [/system/media] 10-02 14:11:20.047: V/AlarmClock(239): AlarmInitReceiver finished 10-02 14:11:20.087: I/ActivityManager(81): Start proc com.android.quicksearchbox for broadcast com.android.quicksearchbox/.SearchWidgetProvider: pid=346 uid=10012 gids={3003} 10-02 14:11:20.127: D/ExchangeService(320): !!! EAS ExchangeService, onStartCommand, startingUp = false, running = false 10-02 14:11:20.427: I/ActivityThread(346): Pub com.android.quicksearchbox.google: com.android.quicksearchbox.google.GoogleSuggestionProvider 10-02 14:11:20.497: I/ActivityThread(346): Pub com.android.quicksearchbox.shortcuts: com.android.quicksearchbox.ShortcutsProvider 10-02 14:11:20.657: I/ActivityManager(81): Start proc com.android.music for broadcast com.android.music/.MediaAppWidgetProvider: pid=358 uid=10028 gids={3003, 1015} 10-02 14:11:20.927: D/ExchangeService(320): !!! EAS ExchangeService, onCreate 10-02 14:11:20.967: D/dalvikvm(260): GC_CONCURRENT freed 213K, 6% free 6409K/6791K, paused 5ms+101ms 10-02 14:11:21.077: D/ExchangeService(320): !!! EAS ExchangeService, onStartCommand, startingUp = true, running = false 10-02 14:11:21.567: D/GTalkService(174): [ReonnectMgr] ### report Inet condition: status=false, networkType=0 10-02 14:11:21.587: D/ConnectivityService(81): reportNetworkCondition(0, 0) 10-02 14:11:21.597: D/ConnectivityService(81): Inet connectivity change, net=0, condition=0,mActiveDefaultNetwork=0 10-02 14:11:21.597: D/ConnectivityService(81): starting a change hold 10-02 14:11:21.697: D/GTalkService(174): [RawStanzaProvidersMgr] ##### searchProvidersFromIntent 10-02 14:11:21.697: D/GTalkService(174): [RawStanzaProvidersMgr] no intent receivers found 10-02 14:11:21.847: I/SystemUpdateService(174): cancelUpdate (empty URL) 10-02 14:11:21.847: E/TelephonyManager(174): Hidden constructor called more than once per process! 10-02 14:11:21.867: D/dalvikvm(174): GC_CONCURRENT freed 337K, 7% free 6561K/7047K, paused 5ms+4ms 10-02 14:11:21.917: D/GTalkService(174): [ReonnectMgr] ### report Inet condition: status=false, networkType=0 10-02 14:11:21.917: D/ConnectivityService(81): reportNetworkCondition(0, 0) 10-02 14:11:21.917: D/ConnectivityService(81): Inet connectivity change, net=0, condition=0,mActiveDefaultNetwork=0 10-02 14:11:21.917: D/ConnectivityService(81): currently in hold - not setting new end evt 10-02 14:11:21.990: E/TelephonyManager(174): Original: com.google.android.location, new: com.google.android.gsf 10-02 14:11:22.027: I/SystemUpdateService(174): removeAllDownloads (cancelUpdate) 10-02 14:11:22.127: D/dalvikvm(328): GC_CONCURRENT freed 205K, 6% free 6506K/6855K, paused 660ms+3ms 10-02 14:11:22.197: D/Eas Debug(320): Logging: 10-02 14:11:22.319: D/dalvikvm(81): GREF has increased to 401 10-02 14:11:22.947: D/ExchangeService(320): !!! EAS ExchangeService, onStartCommand, startingUp = true, running = false 10-02 14:11:23.130: D/Eas Debug(320): Logging: 10-02 14:11:23.307: I//system/bin/fsck_msdos(29): Attempting to allocate 2044 KB for FAT 10-02 14:11:23.560: I/ActivityManager(81): Starting: Intent { flg=0x10000000 cmp=com.google.android.gsf/.update.SystemUpdateInstallDialog } from pid 174 10-02 14:11:23.587: I/ActivityManager(81): Starting: Intent { flg=0x10000000 cmp=com.google.android.gsf/.update.SystemUpdateDownloadDialog } from pid 174 10-02 14:11:24.087: W/ActivityManager(81): Activity pause timeout for ActivityRecord{407c7320 com.android.launcher/com.android.launcher2.Launcher} 10-02 14:11:24.237: E/TelephonyManager(174): Hidden constructor called more than once per process! 10-02 14:11:24.237: E/TelephonyManager(174): Original: com.google.android.location, new: com.google.android.gsf 10-02 14:11:24.507: D/dalvikvm(174): GC_EXPLICIT freed 231K, 7% free 6596K/7047K, paused 4ms+6ms 10-02 14:11:24.607: D/ConnectivityService(81): Inet hold end, net=0, condition =0, published condition =0 10-02 14:11:24.607: D/ConnectivityService(81): no change in condition - aborting 10-02 14:11:24.707: D/dalvikvm(174): GC_EXPLICIT freed 17K, 7% free 6579K/7047K, paused 4ms+4ms 10-02 14:11:24.947: I//system/bin/fsck_msdos(29): ** Phase 2 - Check Cluster Chains 10-02 14:11:25.117: I//system/bin/fsck_msdos(29): ** Phase 3 - Checking Directories 10-02 14:11:25.128: I//system/bin/fsck_msdos(29): ** Phase 4 - Checking for Lost Files 10-02 14:11:25.167: I//system/bin/fsck_msdos(29): 12 files, 1044448 free (522224 clusters) 10-02 14:11:25.227: I/Vold(29): Filesystem check completed OK 10-02 14:11:25.227: I/Vold(29): Device /dev/block/vold/179:0, target /mnt/sdcard mounted @ /mnt/secure/staging 10-02 14:11:25.237: D/Vold(29): Volume sdcard state changing 3 (Checking) -> 4 (Mounted) 10-02 14:11:25.257: I/PackageManager(81): Updating external media status from unmounted to mounted 10-02 14:11:25.457: D/dalvikvm(303): GC_EXPLICIT freed 35K, 6% free 6242K/6595K, paused 3ms+312ms 10-02 14:11:25.987: D/ExchangeService(320): !!! EAS ExchangeService, onStartCommand, startingUp = true, running = false 10-02 14:11:26.157: D/MediaScanner(150): prescan time: 2905ms 10-02 14:11:26.167: D/MediaScanner(150): scan time: 148ms 10-02 14:11:26.167: D/MediaScanner(150): postscan time: 2ms 10-02 14:11:26.167: D/MediaScanner(150): total time: 3055ms 10-02 14:11:26.197: D/MediaScannerService(150): done scanning volume internal 10-02 14:11:26.237: D/MediaScannerService(150): start scanning volume external: [/mnt/sdcard] 10-02 14:11:26.497: D/dalvikvm(143): GC_EXPLICIT freed 234K, 8% free 7735K/8327K, paused 3ms+5ms 10-02 14:11:27.180: D/dalvikvm(143): GC_CONCURRENT freed 150K, 4% free 8004K/8327K, paused 7ms+3ms 10-02 14:11:27.397: D/dalvikvm(143): GC_FOR_ALLOC freed 96K, 6% free 8310K/8775K, paused 76ms 10-02 14:11:27.580: D/dalvikvm(143): GC_FOR_ALLOC freed 515K, 11% free 8135K/9095K, paused 79ms 10-02 14:11:27.829: D/dalvikvm(143): GC_CONCURRENT freed 3K, 5% free 8694K/9095K, paused 7ms+6ms 10-02 14:11:28.137: V/TLINE(143): new: android.text.TextLine@4065b280 10-02 14:11:28.527: D/dalvikvm(143): GC_CONCURRENT freed 729K, 10% free 8764K/9671K, paused 5ms+13ms 10-02 14:11:28.677: D/dalvikvm(143): GC_FOR_ALLOC freed 152K, 11% free 8683K/9671K, paused 99ms 10-02 14:11:28.717: I/dalvikvm-heap(143): Grow heap (frag case) to 11.434MB for 2975968-byte allocation 10-02 14:11:28.807: D/dalvikvm(143): GC_FOR_ALLOC freed 0K, 9% free 11589K/12615K, paused 84ms 10-02 14:11:29.159: D/dalvikvm(143): GC_CONCURRENT freed 197K, 7% free 12195K/12999K, paused 8ms+6ms 10-02 14:11:29.647: D/dalvikvm(143): GC_EXPLICIT freed 351K, 6% free 12790K/13511K, paused 8ms+17ms 10-02 14:11:29.717: I/SurfaceFlinger(32): Boot is finished (70768 ms) 10-02 14:11:29.877: I/ARMAssembler(32): generated scanline__00000177:03010104_00000002_00000000 [ 44 ipp] (66 ins) at [0x407c7290:0x407c7398] in 990662 ns 10-02 14:11:29.907: I/ARMAssembler(32): generated scanline__00000177:03515104_00000001_00000000 [ 73 ipp] (95 ins) at [0x407c73a0:0x407c751c] in 989381 ns 10-02 14:11:30.287: D/dalvikvm(174): GC_EXPLICIT freed 25K, 8% free 6554K/7047K, paused 4ms+32ms 10-02 14:11:30.380: D/dalvikvm(143): GC_EXPLICIT freed 349K, 6% free 13124K/13895K, paused 5ms+25ms 10-02 14:11:30.957: D/dalvikvm(143): GC_FOR_ALLOC freed 1069K, 10% free 13860K/15239K, paused 81ms 10-02 14:11:32.177: D/dalvikvm(150): GC_CONCURRENT freed 183K, 6% free 6438K/6791K, paused 5ms+4ms 10-02 14:11:32.187: W/ActivityManager(81): No content provider found for: 10-02 14:11:32.607: V/MediaScanner(150): pruneDeadThumbnailFiles... android.database.sqlite.SQLiteCursor@406724a8 10-02 14:11:32.617: V/MediaScanner(150): /pruneDeadThumbnailFiles... android.database.sqlite.SQLiteCursor@406724a8 10-02 14:11:32.640: W/ActivityManager(81): No content provider found for: 10-02 14:11:32.640: D/VoldCmdListener(29): asec list 10-02 14:11:32.647: I/PackageManager(81): No secure containers on sdcard 10-02 14:11:32.667: D/MediaScanner(150): prescan time: 107ms 10-02 14:11:32.667: D/MediaScanner(150): scan time: 89ms 10-02 14:11:32.667: D/MediaScanner(150): postscan time: 61ms 10-02 14:11:32.667: D/MediaScanner(150): total time: 257ms 10-02 14:11:32.697: W/PackageManager(81): Unknown permission android.permission.ADD_SYSTEM_SERVICE in package com.android.phone 10-02 14:11:32.707: W/PackageManager(81): Unknown permission com.android.smspush.WAPPUSH_MANAGER_BIND in package com.android.phone 10-02 14:11:32.737: W/PackageManager(81): Not granting permission android.permission.SEND_DOWNLOAD_COMPLETED_INTENTS to package com.android.browser (protectionLevel=2 flags=0x9be45) 10-02 14:11:32.737: W/PackageManager(81): Not granting permission android.permission.BIND_APPWIDGET to package com.android.widgetpreview (protectionLevel=3 flags=0x28be44) 10-02 14:11:32.767: W/PackageManager(81): Unknown permission android.permission.READ_OWNER_DATA in package com.android.exchange 10-02 14:11:32.778: W/PackageManager(81): Unknown permission android.permission.READ_OWNER_DATA in package com.android.email 10-02 14:11:32.788: W/PackageManager(81): Unknown permission com.android.providers.im.permission.READ_ONLY in package com.google.android.apps.maps 10-02 14:11:32.797: W/PackageManager(81): Not granting permission android.permission.DEVICE_POWER to package com.android.deskclock (protectionLevel=2 flags=0x8be45) 10-02 14:11:33.137: D/MediaScannerService(150): done scanning volume external 10-02 14:11:33.197: D/PackageParser(81): Scanning package: /data/app/vmdl257911298.tmp 10-02 14:11:33.837: I/InputReader(81): Device reconfigured: id=0, name='qwerty2', surface size is now 1024x800 10-02 14:11:34.097: D/dalvikvm(81): GC_CONCURRENT freed 12185K, 47% free 13966K/26311K, paused 8ms+23ms 10-02 14:11:36.798: I/TabletStatusBar(124): DISABLE_CLOCK: no 10-02 14:11:36.798: I/TabletStatusBar(124): DISABLE_NAVIGATION: no 10-02 14:11:37.348: I/ARMAssembler(32): generated scanline__00000177:03515104_00001001_00000000 [ 91 ipp] (114 ins) at [0x407c7520:0x407c76e8] in 919320 ns 10-02 14:11:37.598: I/TabletStatusBar(124): DISABLE_BACK: no 10-02 14:11:37.710: I/ActivityManager(81): Displayed com.android.launcher/com.android.launcher2.Launcher: +46s212ms 10-02 14:11:38.817: D/dalvikvm(143): GC_CONCURRENT freed 969K, 8% free 14867K/16007K, paused 4ms+10ms 10-02 14:11:39.437: I/dalvikvm(81): Jit: resizing JitTable from 1024 to 2048 10-02 14:11:40.267: D/dalvikvm(143): GC_FOR_ALLOC freed 2357K, 16% free 14395K/17031K, paused 80ms 10-02 14:11:40.717: D/dalvikvm(143): GC_EXPLICIT freed 742K, 16% free 14358K/17031K, paused 8ms+4ms 10-02 14:11:41.617: D/dalvikvm(81): GC_CONCURRENT freed 1955K, 48% free 13869K/26311K, paused 9ms+10ms 10-02 14:11:42.559: D/dalvikvm(81): GC_CONCURRENT freed 1830K, 48% free 13881K/26311K, paused 9ms+9ms 10-02 14:11:42.758: I/PackageManager(81): Removing non-system package:cz.trilimi.sfaui 10-02 14:11:42.758: I/ActivityManager(81): Force stopping package cz.trilimi.sfaui uid=10036 10-02 14:11:42.967: D/PackageManager(81): Scanning package cz.trilimi.sfaui 10-02 14:11:42.967: I/PackageManager(81): Package cz.trilimi.sfaui codePath changed from /data/app/cz.trilimi.sfaui-1.apk to /data/app/cz.trilimi.sfaui-2.apk; Retaining data and using new 10-02 14:11:42.967: I/PackageManager(81): Unpacking native libraries for /data/app/cz.trilimi.sfaui-2.apk 10-02 14:11:43.097: D/installd(35): DexInv: --- BEGIN '/data/app/cz.trilimi.sfaui-2.apk' --- 10-02 14:11:45.317: D/dalvikvm(391): DexOpt: load 434ms, verify+opt 1260ms 10-02 14:11:45.407: D/installd(35): DexInv: --- END '/data/app/cz.trilimi.sfaui-2.apk' (success) --- 10-02 14:11:45.407: W/PackageManager(81): Code path for pkg : cz.trilimi.sfaui changing from /data/app/cz.trilimi.sfaui-1.apk to /data/app/cz.trilimi.sfaui-2.apk 10-02 14:11:45.407: W/PackageManager(81): Resource path for pkg : cz.trilimi.sfaui changing from /data/app/cz.trilimi.sfaui-1.apk to /data/app/cz.trilimi.sfaui-2.apk 10-02 14:11:45.407: D/PackageManager(81): Activities: cz.trilimi.sfaui.ItemListActivity cz.trilimi.sfaui.ItemDetailActivity 10-02 14:11:45.427: I/ActivityManager(81): Force stopping package cz.trilimi.sfaui uid=10036 10-02 14:11:45.657: I/installd(35): move /data/dalvik-cache/data@[email protected]@classes.dex -> /data/dalvik-cache/data@[email protected]@classes.dex 10-02 14:11:45.657: D/PackageManager(81): New package installed in /data/app/cz.trilimi.sfaui-2.apk 10-02 14:11:45.997: I/ActivityManager(81): Force stopping package cz.trilimi.sfaui uid=10036 10-02 14:11:46.147: D/dalvikvm(143): GC_EXPLICIT freed 3K, 16% free 14356K/17031K, paused 10ms+9ms 10-02 14:11:46.237: D/PackageManager(81): generateServicesMap(android.accounts.AccountAuthenticator): 3 services unchanged 10-02 14:11:46.277: D/PackageManager(81): generateServicesMap(android.content.SyncAdapter): 5 services unchanged 10-02 14:11:46.337: D/PackageManager(81): generateServicesMap(android.accounts.AccountAuthenticator): 3 services unchanged 10-02 14:11:46.347: D/PackageManager(81): generateServicesMap(android.content.SyncAdapter): 5 services unchanged 10-02 14:11:46.437: D/dalvikvm(208): GC_EXPLICIT freed 258K, 7% free 6488K/6919K, paused 3ms+5ms 10-02 14:11:46.477: W/RecognitionManagerService(81): no available voice recognition services found 10-02 14:11:46.897: I/ActivityManager(81): Start proc com.svox.pico for broadcast com.svox.pico/.VoiceDataInstallerReceiver: pid=398 uid=10006 gids={} 10-02 14:11:47.087: I/ActivityThread(398): Pub com.svox.pico.providers.SettingsProvider: com.svox.pico.providers.SettingsProvider 10-02 14:11:47.138: D/GTalkService(174): [GTalkService.1] handlePackageInstalled: re-initialize providers 10-02 14:11:47.147: D/GTalkService(174): [RawStanzaProvidersMgr] ##### searchProvidersFromIntent 10-02 14:11:47.147: D/GTalkService(174): [RawStanzaProvidersMgr] no intent receivers found 10-02 14:11:47.718: I/AccountTypeManager(208): Loaded meta-data for 1 account types, 0 accounts in 186ms 10-02 14:11:48.377: D/dalvikvm(143): GC_CONCURRENT freed 1865K, 15% free 14513K/17031K, paused 7ms+4ms 10-02 14:11:48.917: D/dalvikvm(208): GC_CONCURRENT freed 219K, 6% free 6788K/7175K, paused 7ms+73ms 10-02 14:11:49.207: D/dalvikvm(143): GC_FOR_ALLOC freed 4558K, 31% free 11866K/17031K, paused 89ms 10-02 14:11:49.587: D/dalvikvm(143): GC_CONCURRENT freed 713K, 24% free 13010K/17031K, paused 5ms+4ms 10-02 14:11:49.967: D/dalvikvm(143): GC_CONCURRENT freed 1046K, 19% free 13922K/17031K, paused 5ms+4ms 10-02 14:11:50.437: D/dalvikvm(81): GC_EXPLICIT freed 898K, 47% free 13955K/26311K, paused 6ms+39ms 10-02 14:11:50.467: I/installd(35): unlink /data/dalvik-cache/data@[email protected]@classes.dex 10-02 14:11:50.477: D/AndroidRuntime(227): Shutting down VM 10-02 14:11:50.507: D/dalvikvm(227): GC_CONCURRENT freed 97K, 84% free 331K/2048K, paused 1ms+2ms 10-02 14:11:50.507: I/AndroidRuntime(227): NOTE: attach of thread 'Binder Thread #3' failed 10-02 14:11:50.517: D/jdwp(227): adbd disconnected 10-02 14:11:51.177: D/AndroidRuntime(410): >>>>>> AndroidRuntime START com.android.internal.os.RuntimeInit <<<<<< 10-02 14:11:51.177: D/AndroidRuntime(410): CheckJNI is ON 10-02 14:11:51.897: D/AndroidRuntime(410): Calling main entry com.android.commands.am.Am 10-02 14:11:51.937: I/ActivityManager(81): Force stopping package cz.trilimi.sfaui uid=10036 10-02 14:11:51.937: I/ActivityManager(81): Starting: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=cz.trilimi.sfaui/.ItemListActivity } from pid 410 10-02 14:11:51.968: W/WindowManager(81): Failure taking screenshot for (230x179) to layer 21005 10-02 14:11:51.997: I/ActivityManager(81): Start proc cz.trilimi.sfaui for activity cz.trilimi.sfaui/.ItemListActivity: pid=418 uid=10036 gids={} 10-02 14:11:52.007: D/AndroidRuntime(410): Shutting down VM 10-02 14:11:52.057: I/AndroidRuntime(410): NOTE: attach of thread 'Binder Thread #3' failed 10-02 14:11:52.097: D/dalvikvm(410): GC_CONCURRENT freed 98K, 83% free 360K/2048K, paused 1ms+0ms 10-02 14:11:52.097: D/jdwp(410): adbd disconnected 10-02 14:11:53.147: W/ActivityThread(418): Application cz.trilimi.sfaui is waiting for the debugger on port 8100... 10-02 14:11:53.207: I/System.out(418): Sending WAIT chunk 10-02 14:11:53.217: I/dalvikvm(418): Debugger is active 10-02 14:11:53.447: I/System.out(418): Debugger has connected 10-02 14:11:53.457: I/System.out(418): waiting for debugger to settle... 10-02 14:11:53.637: I/ARMAssembler(32): generated scanline__00000177:03515104_00001002_00000000 [ 87 ipp] (110 ins) at [0x407c76f0:0x407c78a8] in 598498 ns 10-02 14:11:53.660: I/System.out(418): waiting for debugger to settle... 10-02 14:11:53.857: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.057: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.257: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.317: V/TLINE(81): new: android.text.TextLine@4155dde8 10-02 14:11:54.467: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.667: I/System.out(418): waiting for debugger to settle... 10-02 14:11:54.870: I/System.out(418): waiting for debugger to settle... 10-02 14:11:55.027: D/dalvikvm(143): GC_EXPLICIT freed 900K, 16% free 14420K/17031K, paused 7ms+4ms 10-02 14:11:55.067: I/System.out(418): waiting for debugger to settle... 10-02 14:11:55.292: I/System.out(418): debugger has settled (1315) 10-02 14:12:02.008: W/ActivityManager(81): Launch timeout has expired, giving up wake lock! 10-02 14:12:02.971: W/ActivityManager(81): Activity idle timeout for ActivityRecord{4078c6b0 cz.trilimi.sfaui/.ItemListActivity} 10-02 14:12:08.359: D/ExchangeService(320): Received deviceId from Email app: androidc259148960 10-02 14:12:08.507: D/ExchangeService(320): Reconciling accounts... 10-02 14:16:11.437: D/SntpClient(81): request time failed: java.net.SocketException: Address family not supported by protocol 10-02 14:17:21.573: W/jdwp(418): Debugger is telling the VM to exit with code=1 10-02 14:17:21.573: I/dalvikvm(418): GC lifetime allocation: 8642 bytes 10-02 14:17:21.637: D/Zygote(33): Process 418 exited cleanly (1) 10-02 14:17:21.651: I/ActivityManager(81): Process cz.trilimi.sfaui (pid 418) has died. 10-02 14:17:21.847: D/dalvikvm(143): GC_EXPLICIT freed <1K, 16% free 14420K/17031K, paused 7ms+7ms 10-02 14:17:21.917: W/InputManagerService(81): Window already focused, ignoring focus gain of: com.android.internal.view.IInputMethodClient$Stub$Proxy@40bfbf28

    Read the article

  • Problems with inheritance query view and one to many association in entity framework 4

    - by Kazys
    Hi, I have situation in with I stucked and don't know way out. The problem is in my bigger model, but I have made small example which shows the same problem. I have 4 tables. I called them SuperParent, NamedParent, TypedParent and ParentType. NamedParent and TypedParent derives from superParent. TypedParent has one to many association with ParentType. I describe mapping for entities using queryView. The problem is then I want to get TypedParents and Include ParentType I get the following exception: An error occurred while preparing the command definition. See the inner exception for details. --- System.ArgumentException: The ResultType of the specified expression is not compatible with the required type. The expression ResultType is 'Transient.reference[PasibandymaiModel.SuperParent]' but the required type is 'Transient.reference[PasibandymaiModel.TypedParent]'. Parameter name: arguments[1] To get TypedParents I use following code: context.SuperParent.OfType().Include("ParentType"); my edmx file: <edmx:Edmx Version="2.0" xmlns:edmx="http://schemas.microsoft.com/ado/2008/10/edmx"> <!-- EF Runtime content --> <edmx:Runtime> <!-- SSDL content --> <edmx:StorageModels> <Schema Namespace="PasibandymaiModel.Store" Alias="Self" Provider="System.Data.SqlClient" ProviderManifestToken="2005" xmlns:store="http://schemas.microsoft.com/ado/2007/12/edm/EntityStoreSchemaGenerator" xmlns="http://schemas.microsoft.com/ado/2009/02/edm/ssdl"> <EntityContainer Name="PasibandymaiModelStoreContainer"> <EntitySet Name="NamedParent" EntityType="PasibandymaiModel.Store.NamedParent" store:Type="Tables" Schema="dbo" /> <EntitySet Name="ParentType" EntityType="PasibandymaiModel.Store.ParentType" store:Type="Tables" Schema="dbo" /> <EntitySet Name="SuperParent" EntityType="PasibandymaiModel.Store.SuperParent" store:Type="Tables" Schema="dbo" /> <EntitySet Name="TypedParent" EntityType="PasibandymaiModel.Store.TypedParent" store:Type="Tables" Schema="dbo" /> <AssociationSet Name="fk_NamedParent_SuperParent" Association="PasibandymaiModel.Store.fk_NamedParent_SuperParent"> <End Role="SuperParent" EntitySet="SuperParent" /> <End Role="NamedParent" EntitySet="NamedParent" /> </AssociationSet> <AssociationSet Name="fk_TypedParent_ParentType" Association="PasibandymaiModel.Store.fk_TypedParent_ParentType"> <End Role="ParentType" EntitySet="ParentType" /> <End Role="TypedParent" EntitySet="TypedParent" /> </AssociationSet> <AssociationSet Name="fk_TypedParent_SuperParent" Association="PasibandymaiModel.Store.fk_TypedParent_SuperParent"> <End Role="SuperParent" EntitySet="SuperParent" /> <End Role="TypedParent" EntitySet="TypedParent" /> </AssociationSet> </EntityContainer> <EntityType Name="NamedParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" /> <Property Name="Name" Type="nvarchar" Nullable="false" MaxLength="100" /> </EntityType> <EntityType Name="ParentType"> <Key> <PropertyRef Name="ParentTypeId" /> </Key> <Property Name="ParentTypeId" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="Name" Type="nvarchar" MaxLength="100" /> </EntityType> <EntityType Name="SuperParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="SomeAttribute" Type="nvarchar" Nullable="false" MaxLength="100" /> </EntityType> <EntityType Name="TypedParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" /> <Property Name="ParentTypeId" Type="int" Nullable="false"/> </EntityType> <Association Name="fk_NamedParent_SuperParent"> <End Role="SuperParent" Type="PasibandymaiModel.Store.SuperParent" Multiplicity="1" /> <End Role="NamedParent" Type="PasibandymaiModel.Store.NamedParent" Multiplicity="0..1" /> <ReferentialConstraint> <Principal Role="SuperParent"> <PropertyRef Name="ParentId" /> </Principal> <Dependent Role="NamedParent"> <PropertyRef Name="ParentId" /> </Dependent> </ReferentialConstraint> </Association> <Association Name="fk_TypedParent_ParentType"> <End Role="ParentType" Type="PasibandymaiModel.Store.ParentType" Multiplicity="1" /> <End Role="TypedParent" Type="PasibandymaiModel.Store.TypedParent" Multiplicity="*" /> <ReferentialConstraint> <Principal Role="ParentType"> <PropertyRef Name="ParentTypeId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentTypeId" /> </Dependent> </ReferentialConstraint> </Association> <Association Name="fk_TypedParent_SuperParent"> <End Role="SuperParent" Type="PasibandymaiModel.Store.SuperParent" Multiplicity="1" /> <End Role="TypedParent" Type="PasibandymaiModel.Store.TypedParent" Multiplicity="0..1" /> <ReferentialConstraint> <Principal Role="SuperParent"> <PropertyRef Name="ParentId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentId" /> </Dependent> </ReferentialConstraint> </Association> <Function Name="ChildDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ChildId" Type="int" Mode="In" /> </Function> <Function Name="ChildInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="ChildUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ChildId" Type="int" Mode="In" /> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="NamedParentDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="NamedParentInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> </Function> <Function Name="NamedParentUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="ParentTypeDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> </Function> <Function Name="ParentTypeInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="ParentTypeUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="TypedParentDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="TypedParentInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> </Function> <Function Name="TypedParentUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> </Function> </Schema> </edmx:StorageModels> <!-- CSDL content --> <edmx:ConceptualModels> <Schema Namespace="PasibandymaiModel" Alias="Self" xmlns:annotation="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns="http://schemas.microsoft.com/ado/2008/09/edm"> <EntityContainer Name="PasibandymaiEntities" annotation:LazyLoadingEnabled="true"> <EntitySet Name="ParentType" EntityType="PasibandymaiModel.ParentType" /> <EntitySet Name="SuperParent" EntityType="PasibandymaiModel.SuperParent" /> <AssociationSet Name="ParentTypeTypedParent" Association="PasibandymaiModel.ParentTypeTypedParent"> <End Role="ParentType" EntitySet="ParentType" /> <End Role="TypedParent" EntitySet="SuperParent" /> </AssociationSet> </EntityContainer> <EntityType Name="NamedParent" BaseType="PasibandymaiModel.SuperParent"> <Property Type="String" Name="Name" Nullable="false" MaxLength="100" FixedLength="false" Unicode="true" /> </EntityType> <EntityType Name="ParentType"> <Key> <PropertyRef Name="ParentTypeId" /> </Key> <Property Type="Int32" Name="ParentTypeId" Nullable="false" annotation:StoreGeneratedPattern="Identity" /> <Property Type="String" Name="Name" MaxLength="100" FixedLength="false" Unicode="true" /> <NavigationProperty Name="TypedParent" Relationship="PasibandymaiModel.ParentTypeTypedParent" FromRole="ParentType" ToRole="TypedParent" /> </EntityType> <EntityType Name="SuperParent" Abstract="true"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Type="Int32" Name="ParentId" Nullable="false" annotation:StoreGeneratedPattern="Identity" /> <Property Type="String" Name="SomeAttribute" Nullable="false" MaxLength="100" FixedLength="false" Unicode="true" /> </EntityType> <EntityType Name="TypedParent" BaseType="PasibandymaiModel.SuperParent"> <NavigationProperty Name="ParentType" Relationship="PasibandymaiModel.ParentTypeTypedParent" FromRole="TypedParent" ToRole="ParentType" /> <Property Type="Int32" Name="ParentTypeId" Nullable="false" /> </EntityType> <Association Name="ParentTypeTypedParent"> <End Type="PasibandymaiModel.ParentType" Role="ParentType" Multiplicity="1" /> <End Type="PasibandymaiModel.TypedParent" Role="TypedParent" Multiplicity="*" /> <ReferentialConstraint> <Principal Role="ParentType"> <PropertyRef Name="ParentTypeId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentTypeId" /> </Dependent> </ReferentialConstraint> </Association> </Schema> </edmx:ConceptualModels> <!-- C-S mapping content --> <edmx:Mappings> <Mapping Space="C-S" xmlns="http://schemas.microsoft.com/ado/2008/09/mapping/cs"> <EntityContainerMapping StorageEntityContainer="PasibandymaiModelStoreContainer" CdmEntityContainer="PasibandymaiEntities"> <EntitySetMapping Name="ParentType"> <QueryView> SELECT VALUE PasibandymaiModel.ParentType(tp.ParentTypeId, tp.Name) FROM PasibandymaiModelStoreContainer.ParentType AS tp </QueryView> </EntitySetMapping> <EntitySetMapping Name="SuperParent"> <QueryView> SELECT VALUE CASE WHEN (np.ParentId IS NOT NULL) THEN PasibandymaiModel.NamedParent(sp.ParentId, sp.SomeAttribute, np.Name) WHEN (tp.ParentId IS NOT NULL) THEN PasibandymaiModel.TypedParent(sp.ParentId, sp.SomeAttribute, tp.ParentTypeId) END FROM PasibandymaiModelStoreContainer.SuperParent AS sp LEFT JOIN PasibandymaiModelStoreContainer.NamedParent AS np ON sp.ParentId = np.ParentId LEFT JOIN PasibandymaiModelStoreContainer.TypedParent AS tp ON sp.ParentId = tp.ParentId </QueryView> <QueryView TypeName="PasibandymaiModel.TypedParent"> SELECT VALUE PasibandymaiModel.TypedParent(sp.ParentId, sp.SomeAttribute, tp.ParentTypeId) FROM PasibandymaiModelStoreContainer.SuperParent AS sp INNER JOIN PasibandymaiModelStoreContainer.TypedParent AS tp ON sp.ParentId = tp.ParentId </QueryView> <QueryView TypeName="PasibandymaiModel.NamedParent"> SELECT VALUE PasibandymaiModel.NamedParent(sp.ParentId, sp.SomeAttribute, np.Name) FROM PasibandymaiModelStoreContainer.SuperParent AS sp INNER JOIN PasibandymaiModelStoreContainer.NamedParent AS np ON sp.ParentId = np.ParentId </QueryView> </EntitySetMapping> </EntityContainerMapping> </Mapping> </edmx:Mappings> </edmx:Runtime> </edmx:Edmx> I have tried using AssociationSetMapping instead of using Association with ReferentialConstraint. But then couldn't insert related entities at once, becouse entity framework didn't provided entity key of inserted entities for related entities. Thanks for any idea

    Read the article

  • passing values to php print page

    - by DAFFODIL
    In this wen i select a value in drop down box it will list out that name value in table .There will be a check box ,the checked values should be passed to pring page which is below the 1st part of code. Any help ii be appreciated <?php $con = mysql_connect("localhost","root",""); if (!$con) { die('Could not connect: ' . mysql_error()); } mysql_select_db("form1", $con); error_reporting(E_ALL ^ E_NOTICE); $nam=$_REQUEST['select1']; $row=mysql_query("select * from inv where name='$nam'"); while($row1=mysql_fetch_array($row)) { $Name=$row1['Name']; $Address =$row1['Address']; $City=$row1['City']; $Pincode=$row1['Pincode']; $No=$row1['No']; $Date=$row1['Date']; $DCNo=$row1['DCNo']; $DcDate=$row1['DcDate']; $YourOrderNo=$row1['YourOrderNo']; $OrderDate=$row1['OrderDate']; $VendorCode=$row1['VendorCode']; $SNo=$row1['SNo']; $descofgoods=$row1['descofgoods']; $Qty=$row1['Qty']; $Rate=$row1['Rate']; $Amount=$row1['Amount']; } ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title>Untitled Document</title> <script type="text/javascript"> function ram() { var q=document.getElementById('qty').value; var r=document.getElementById('rate').value; document.getElementById('amt').value=q*r; } </script> </head> <body> <form id="form1" name="form1" method="post" action=""> <table width="1315" border="0"> <script type="text/javascript"> function g() { form1.submit(); } </script> <tr> <th>Name</th> <th align="left"><select name="select1" onchange="g();"> <option value="" selected="selected">select</option> <?php $row=mysql_query("select Name from inv "); while($row1=mysql_fetch_array($row)) { ?> <option value="<?php echo $row1['Name'];?>"><?php echo $row1['Name'];?></option> <?php } ?> </select></th> </tr> <tr> <th>Address</th> <th align="left"><textarea name="Address"><?php echo $Address;?></textarea></th> </tr> <tr> <th>City</th> <th align="left"><input type="text" name="City" value='<?php echo $City;?>' /></th> </tr> <tr> <th>Pincode</th> <th align="left"><input type="text" name="Pincode" value='<?php echo $Pincode;?>'></th> </tr> <tr> <th>No</th> <th align="left"><input type="text" name="No2" value='<?php echo $No;?>' readonly="" /></th> </tr> <tr> <th>Date</th> <th align="left"><input type="text" name="Date" value='<?php echo $Date;?>' readonly="" /></th> </tr> <tr> <th>DCNo</th> <th align="left"><input type="text" name="DCNo" value='<?php echo $DCNo;?>' readonly="" /></th> </tr> <tr> <th>DcDate:</th> <th align="left"><input type="text" name="DcDate" value='<?php echo $DcDate;?>' /></th> </tr> <tr> <th>YourOrderNo</th> <th align="left"><input type="text" name="YourOrderNo" value='<?php echo $YourOrderNo;?>' readonly="" /></th> </tr> <tr> <th>OrderDate</th> <th align="left"><input type="text" name="OrderDate" value='<?php echo $OrderDate;?>' readonly="" /></th> </tr> <tr> <th width="80">VendorCode</th> <th width="1225" align="left"><input type="text" name="VendorCode" value='<?php echo $VendorCode;?>' readonly="" /></th> </tr> </table> <table width="1313" border="0"> <tr> <td width="44">&nbsp;</td> <td width="71">SNO</td> <td width="527">DESCRIPTION</td> <td width="214">QUANTITY</td> <td width="214">RATE/UNIT</td> <td width="217">AMOUNT</td> </tr> <?php $i=1; $row=mysql_query("select * from inv where Name='$nam'"); while($row1=mysql_fetch_array($row)) { $descofgoods=$row1['descofgoods']; $Qty=$row1['Qty']; $Rate=$row1['Rate']; $Amount=$row1['Amount']; ?> <tr> <td><input type="checkbox" name="checkbox" value="checkbox" /></td> <td><input type="text" name="No" value='<?php echo $No;?>' readonly=""/></td> <td><input type="text" name="descofgoods" value='<?php echo $descofgoods;?>' /></td> <td><input type="text" name="qty" maxlength="50000000" id="qty"/></td> <td><input type="text" name="Rate" value='<?php echo $Rate;?>' id="rate" onclick="ram()";></td> <td><input type="text" name="Amount" id="amt"/></td> </tr> <?php $i++;} ?> <tr> <th colspan="2"><a href="pp.php?msg=<?php echo $nam;?>">Print</a></th> </tr> </table> <label></label> </form> </body> </html> - <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title></title> <script type = "text/javascript"> function a() { var q = document.getElementsByName('Amount'); var count = 0; for (i = 0; i < q.length; i++) count += parseInt(q[i].value,10); document.getElementById('s').value = count; } </script> </head> <?php $con = mysql_connect("localhost","root",""); if (!$con) { die('Could not connect: ' . mysql_error()); } mysql_select_db("form1", $con); error_reporting(E_ALL ^ E_NOTICE); $nam=$_GET['msg']; $row=mysql_query("select * from inv where Name='$nam'"); while($row1=mysql_fetch_array($row)) { $Name=$row1['Name']; $Address =$row1['Address']; $City=$row1['City']; $Pincode=$row1['Pincode']; $No=$row1['No']; $Date=$row1['Date']; $DCNo=$row1['DCNo']; $DcDate=$row1['DcDate']; $YourOrderNo=$row1['YourOrderNo']; $OrderDate=$row1['OrderDate']; $VendorCode=$row1['VendorCode']; $SNo=$row1['SNo']; $descofgoods=$row1['descofgoods']; $Qty=$row1['Qty']; $Rate=$row1['Rate']; $Amount=$row1['Amount']; } ?> <body> <form id="form1" name="form1" method="post" action=""> <table width="846" border="0"> <tr> <td width="411" height="113">&nbsp;</td> <td width="412">&nbsp;</td> </tr> </table> <table width="846" border="0"> <tr> <td height="38">&nbsp;</td> </tr> </table> <table width="846" border="0"> <tr> <td width="390" rowspan="4">&nbsp;</td> <td width="92" height="35">&nbsp;</td> <td width="136"><?php echo $No;?></td> <td width="36">&nbsp;</td> <td width="170"><?php echo $Date;?></td> </tr> <tr> <td height="37">&nbsp;</td> <td><?php echo $DCNo;?></td> <td>&nbsp;</td> <td><?php echo $DcDate;?></td> </tr> <tr> <td height="34">&nbsp;</td> <td><?php echo $YourOrderNo;?></td> <td>&nbsp;</td> <td><?php echo $OrderDate;?></td> </tr> <tr> <td height="29">&nbsp;</td> <td><?php echo $VendorCode;?></td> <td>&nbsp;</td> <td>&nbsp;</td> </tr> </table> <table width="845" border="0"> <tr> <td height="38">&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> </tr> <tr> <td width="34">&nbsp;</td> <td width="457">&nbsp;</td> <td width="104">&nbsp;</td> <td width="79">&nbsp;</td> <td width="149">&nbsp;</td> </tr> <?php $i=1; $row=mysql_query("select * from inv where Name='$nam'"); while($row1=mysql_fetch_array($row)) { $descofgoods=$row1['descofgoods']; $Qty=$row1['Qty']; $Rate=$row1['Rate']; $Amount=$row1['Amount']; ?> <tr> <td><?php echo $i;?></td> <td><?php echo $descofgoods;?></td> <td><?php echo $Qty;?></td> <td><?php echo $Rate;?></td> <td><input name="Amount" type = "text" value="<?php echo $Amount; ?>" /></td> </tr> <?php $i++;} ?> </table> <table width="844" border="0"> <tr> <td width="495" height="1065">&nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp;&nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; <input type="text" name="textfield2" width="150" /> &nbsp; &nbsp; &nbsp; &nbsp; </td> <td width="191">&nbsp;</td> <td width="144"><input type="text" name="to" id="s" onclick="a()";/></td> </tr> </table> </form> </body> </html>

    Read the article

  • update jframe in java or revalidate/repaint/ panel

    - by user1516251
    How to update a java frame with changed content I want to update a frame or just the panel with updated content. What do I use for this Here is where i want to revalidate the frame or repaint mainpanel or whatever will work I have tried a number of things, but none of them have worked. public void actionPerformed(ActionEvent e) { //System.out.println(e.getActionCommand()); if (e.getActionCommand().equals("advance")) { multi--; // Revalidate update repaint here <<<<<<<<<<<<<<<<<<< } else if (e.getActionCommand().equals("reverse")) { multi++; // Revalidate update repaint here <<<<<<<<<<<<<<<<<<< } else { openURL(e.getActionCommand()); } } Here is the whole java file /* * * */ package build; import java.lang.reflect.Method; import javax.swing.JOptionPane; import java.util.Arrays; import java.util.*; import java.util.ArrayList; import javax.swing.*; import javax.swing.AbstractButton; import javax.swing.JScrollPane; import javax.swing.JButton; import javax.swing.JPanel; import javax.swing.JFrame; import javax.swing.ImageIcon; import java.awt.*; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.awt.event.KeyEvent; /* * ButtonDemo.java requires the following files: * images/right.gif * images/middle.gif * images/left.gif */ public class StockTable extends JPanel implements ActionListener { static int multi = 1; int roll = 0; static TextVars textvars = new TextVars(); static final String[] browsers = { "firefox", "opera", "konqueror", "epiphany", "seamonkey", "galeon", "kazehakase", "mozilla", "netscape" }; JFrame frame; JPanel mainpanel, panel1, panel2, panel3, panel4, panel2left, panel2center, panel2right; JButton stknames_btn[] = new JButton[textvars.getNumberOfStocks()]; JLabel label[] = new JLabel[textvars.getNumberOfStocks()]; JLabel headlabel, dayspan, namelabel; JRadioButton radioButton; JButton button; JScrollPane scrollpane; int wid = 825; public JPanel createContentPane() { mainpanel = new JPanel(); mainpanel.setPreferredSize(new Dimension(wid, 800)); mainpanel.setLayout(new GridBagLayout()); GridBagConstraints c = new GridBagConstraints(); panel1 = new JPanel(); panel1.setPreferredSize(new Dimension(wid, 25)); c.gridx = 0; c.gridy = 0; c.insets = new Insets(0,0,0,0); mainpanel.add(panel1, c); // Panel 2------------ panel2 = new JPanel(); panel2.setPreferredSize(new Dimension(wid, 51)); c.gridx = 0; c.gridy = 1; c.insets = new Insets(0,0,0,0); mainpanel.add(panel2, c); panel2left = new JPanel(); panel2left.setPreferredSize(new Dimension(270, 51)); c.gridx = 0; c.gridy = 1; c.insets = new Insets(0,0,0,0); panel2.add(panel2left, c); panel2center = new JPanel(); panel2center.setPreferredSize(new Dimension(258, 51)); c.gridx = 1; c.gridy = 1; c.insets = new Insets(0,0,0,0); panel2.add(panel2center, c); panel2right = new JPanel(); panel2right.setPreferredSize(new Dimension(270, 51)); c.gridx = 2; c.gridy = 1; c.insets = new Insets(0,0,0,0); panel2.add(panel2right, c); // ------------------ panel3 = new JPanel(); panel3.setLayout(new GridBagLayout()); scrollpane = new JScrollPane(panel3); scrollpane.setPreferredSize(new Dimension(wid, 675)); c.gridx = 0; c.gridy = 2; c.insets = new Insets(0,0,0,0); mainpanel.add(scrollpane, c); ImageIcon leftButtonIcon = createImageIcon("images/right.gif"); //b1 = new JButton("Disable middle button", leftButtonIcon); //b1.setVerticalTextPosition(AbstractButton.CENTER); //b1.setHorizontalTextPosition(AbstractButton.LEADING); //aka LEFT, for left-to-right locales //b1.setMnemonic(KeyEvent.VK_D); //b1.setActionCommand("disable"); //Listen for actions on buttons 1 //b1.addActionListener(this); //b1.setToolTipText("Click this button to disable the middle button."); //Add Components to this container, using the default FlowLayout. //add(b1); headlabel = new JLabel("hellorow1"); c.gridx = 0; c.gridy = 0; c.insets = new Insets(0, 0, 0, 0); panel1.add(headlabel, c); radioButton = new JRadioButton("Percentage"); c.gridx = 2; c.gridy = 0; c.insets = new Insets(0, 0, 0, 0); panel1.add(radioButton, c); radioButton = new JRadioButton("Days Range"); c.gridx = 3; c.gridy = 0; c.insets = new Insets(0, 0, 0, 0); panel1.add(radioButton, c); radioButton = new JRadioButton("Open / Close"); c.gridx = 4; c.gridy = 0; c.insets = new Insets(0, 0, 0,0 ); panel1.add(radioButton, c); button = new JButton("<<"); button.setPreferredSize(new Dimension(50, 50)); button.setActionCommand("reverse"); button.addActionListener(this); c.gridx = 0; c.gridy = 1; c.insets = new Insets(0, 0, 0, 0); panel2left.add(button, c); dayspan = new JLabel("hellorow2"); dayspan.setHorizontalAlignment(JLabel.CENTER); dayspan.setVerticalAlignment(JLabel.CENTER); dayspan.setPreferredSize(new Dimension(270, 50)); c.gridx = 1; c.gridy = 1; c.insets = new Insets(0, 0, 0, 0); panel2center.add(dayspan, c); button = new JButton(">>"); button.setPreferredSize(new Dimension(50, 50)); button.setActionCommand("advance"); button.addActionListener(this); if (multi == 0) { button.setEnabled(false); } else { button.setEnabled(true); } c.gridx = 2; c.gridy = 1; c.insets = new Insets(0, 0, 0, 0); panel2right.add(button, c); int availSpace_int = textvars.getStocks().size()-textvars.getNumberOfStocks()*7; ArrayList<String[]> stocknames = textvars.getStockNames(); ArrayList<String[]> stocks = textvars.getStocks(); for (int column = 0; column < 8; column++) { for (int row = 0; row < textvars.getNumberOfStocks(); row++) { if (column==0) { if (row==0) { namelabel = new JLabel(stocknames.get(0)[0]); namelabel.setVerticalAlignment(JLabel.CENTER); namelabel.setHorizontalAlignment(JLabel.CENTER); namelabel.setPreferredSize(new Dimension(100, 25)); c.gridx = column; c.gridy = row; c.insets = new Insets(0, 0, 0, 0); panel3.add(namelabel, c); } else { stknames_btn[row] = new JButton(stocknames.get(row)[0], leftButtonIcon); stknames_btn[row].setVerticalTextPosition(AbstractButton.CENTER); stknames_btn[row].setActionCommand(stocknames.get(row)[1]); stknames_btn[row].addActionListener(this); stknames_btn[row].setToolTipText("go to Google Finance "+stocknames.get(row)[0]); stknames_btn[row].setPreferredSize(new Dimension(100, 25)); c.gridx = column; c.gridy = row; c.insets = new Insets(0, 0, 0, 0); //scrollpane.add(stknames[row], c); panel3.add(stknames_btn[row], c); } } else { label[row]= new JLabel(textvars.getStocks().get(columnMulti(multi))[1]); label[row].setBorder(BorderFactory.createLineBorder(Color.black)); label[row].setVerticalAlignment(JLabel.CENTER); label[row].setHorizontalAlignment(JLabel.CENTER); label[row].setPreferredSize(new Dimension(100, 25)); c.gridx = column; c.gridy = row; c.insets = new Insets(0,0,0,0); panel3.add(label[row], c); } } } return mainpanel; } public void actionPerformed(ActionEvent e) { //System.out.println(e.getActionCommand()); if (e.getActionCommand().equals("advance")) { multi--; } else if (e.getActionCommand().equals("reverse")) { multi++; } else { openURL(e.getActionCommand()); } } /** Returns an ImageIcon, or null if the path was invalid. */ protected static ImageIcon createImageIcon(String path) { java.net.URL imgURL = StockTable.class.getResource(path); if (imgURL != null) { return new ImageIcon(imgURL); } else { System.err.println("Couldn't find file: " + path); return null; } } public static void openURL(String url) { String osName = System.getProperty("os.name"); try { if (osName.startsWith("Mac OS")) { Class<?> fileMgr = Class.forName("com.apple.eio.FileManager"); Method openURL = fileMgr.getDeclaredMethod("openURL", new Class[] {String.class}); openURL.invoke(null, new Object[] {url}); } else if (osName.startsWith("Windows")) { Runtime.getRuntime().exec("rundll32 url.dll,FileProtocolHandler " + url); } else { //assume Unix or Linux boolean found = false; for (String browser : browsers) if (!found) { found = Runtime.getRuntime().exec( new String[] {"which", browser}).waitFor() == 0; if (found) Runtime.getRuntime().exec(new String[] {browser, url}); } if (!found) throw new Exception(Arrays.toString(browsers)); } } catch (Exception e) { JOptionPane.showMessageDialog(null, "Error attempting to launch web browser\n" + e.toString()); } } int reit = 0; int start = textvars.getStocks().size()-((textvars.getNumberOfStocks()*5)*7)-1; public int columnMulti(int multi) { reit++; start++; if (reit == textvars.getNumberOfStocks()) { reit = 0; start=start+64; } //start = start - (multi*(textvars.getNumberOfStocks())); return start; } /** * Create the GUI and show it. For thread safety, * this method should be invoked from the * event-dispatching thread. */ private static void createAndShowGUI() { //Create and set up the window. JFrame frame = new JFrame("Stock Table"); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); //Create and set up the content pane. StockTable newContentPane = new StockTable(); //newContentPane.setOpaque(true); //content panes must be opaque //frame.setContentPane(newContentPane); frame.setContentPane(newContentPane.createContentPane()); frame.setSize(800, 800); //Display the window. frame.pack(); frame.setVisible(true); } public static void main(String[] args) { //Schedule a job for the event-dispatching thread: //creating and showing this application's GUI. javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { createAndShowGUI(); } }); } }

    Read the article

  • Microsoft and jQuery

    - by Rick Strahl
    The jQuery JavaScript library has been steadily getting more popular and with recent developments from Microsoft, jQuery is also getting ever more exposure on the ASP.NET platform including now directly from Microsoft. jQuery is a light weight, open source DOM manipulation library for JavaScript that has changed how many developers think about JavaScript. You can download it and find more information on jQuery on www.jquery.com. For me jQuery has had a huge impact on how I develop Web applications and was probably the main reason I went from dreading to do JavaScript development to actually looking forward to implementing client side JavaScript functionality. It has also had a profound impact on my JavaScript skill level for me by seeing how the library accomplishes things (and often reviewing the terse but excellent source code). jQuery made an uncomfortable development platform (JavaScript + DOM) a joy to work on. Although jQuery is by no means the only JavaScript library out there, its ease of use, small size, huge community of plug-ins and pure usefulness has made it easily the most popular JavaScript library available today. As a long time jQuery user, I’ve been excited to see the developments from Microsoft that are bringing jQuery to more ASP.NET developers and providing more integration with jQuery for ASP.NET’s core features rather than relying on the ASP.NET AJAX library. Microsoft and jQuery – making Friends jQuery is an open source project but in the last couple of years Microsoft has really thrown its weight behind supporting this open source library as a supported component on the Microsoft platform. When I say supported I literally mean supported: Microsoft now offers actual tech support for jQuery as part of their Product Support Services (PSS) as jQuery integration has become part of several of the ASP.NET toolkits and ships in several of the default Web project templates in Visual Studio 2010. The ASP.NET MVC 3 framework (still in Beta) also uses jQuery for a variety of client side support features including client side validation and we can look forward toward more integration of client side functionality via jQuery in both MVC and WebForms in the future. In other words jQuery is becoming an optional but included component of the ASP.NET platform. PSS support means that support staff will answer jQuery related support questions as part of any support incidents related to ASP.NET which provides some piece of mind to some corporate development shops that require end to end support from Microsoft. In addition to including jQuery and supporting it, Microsoft has also been getting involved in providing development resources for extending jQuery’s functionality via plug-ins. Microsoft’s last version of the Microsoft Ajax Library – which is the successor to the native ASP.NET AJAX Library – included some really cool functionality for client templates, databinding and localization. As it turns out Microsoft has rebuilt most of that functionality using jQuery as the base API and provided jQuery plug-ins of these components. Very recently these three plug-ins were submitted and have been approved for inclusion in the official jQuery plug-in repository and been taken over by the jQuery team for further improvements and maintenance. Even more surprising: The jQuery-templates component has actually been approved for inclusion in the next major update of the jQuery core in jQuery V1.5, which means it will become a native feature that doesn’t require additional script files to be loaded. Imagine this – an open source contribution from Microsoft that has been accepted into a major open source project for a core feature improvement. Microsoft has come a long way indeed! What the Microsoft Involvement with jQuery means to you For Microsoft jQuery support is a strategic decision that affects their direction in client side development, but nothing stopped you from using jQuery in your applications prior to Microsoft’s official backing and in fact a large chunk of developers did so readily prior to Microsoft’s announcement. Official support from Microsoft brings a few benefits to developers however. jQuery support in Visual Studio 2010 means built-in support for jQuery IntelliSense, automatically added jQuery scripts in many projects types and a common base for client side functionality that actually uses what most developers are already using. If you have already been using jQuery and were worried about straying from the Microsoft line and their internal Microsoft Ajax Library – worry no more. With official support and the change in direction towards jQuery Microsoft is now following along what most in the ASP.NET community had already been doing by using jQuery, which is likely the reason for Microsoft’s shift in direction in the first place. ASP.NET AJAX and the Microsoft AJAX Library weren’t bad technology – there was tons of useful functionality buried in these libraries. However, these libraries never got off the ground, mainly because early incarnations were squarely aimed at control/component developers rather than application developers. For all the functionality that these controls provided for control developers they lacked in useful and easily usable application developer functionality that was easily accessible in day to day client side development. The result was that even though Microsoft shipped support for these tools in the box (in .NET 3.5 and 4.0), other than for the internal support in ASP.NET for things like the UpdatePanel and the ASP.NET AJAX Control Toolkit as well as some third party vendors, the Microsoft client libraries were largely ignored by the developer community opening the door for other client side solutions. Microsoft seems to be acknowledging developer choice in this case: Many more developers were going down the jQuery path rather than using the Microsoft built libraries and there seems to be little sense in continuing development of a technology that largely goes unused by the majority of developers. Kudos for Microsoft for recognizing this and gracefully changing directions. Note that even though there will be no further development in the Microsoft client libraries they will continue to be supported so if you’re using them in your applications there’s no reason to start running for the exit in a panic and start re-writing everything with jQuery. Although that might be a reasonable choice in some cases, jQuery and the Microsoft libraries work well side by side so that you can leave existing solutions untouched even as you enhance them with jQuery. The Microsoft jQuery Plug-ins – Solid Core Features One of the most interesting developments in Microsoft’s embracing of jQuery is that Microsoft has started contributing to jQuery via standard mechanism set for jQuery developers: By submitting plug-ins. Microsoft took some of the nicest new features of the unpublished Microsoft Ajax Client Library and re-wrote these components for jQuery and then submitted them as plug-ins to the jQuery plug-in repository. Accepted plug-ins get taken over by the jQuery team and that’s exactly what happened with the three plug-ins submitted by Microsoft with the templating plug-in even getting slated to be published as part of the jQuery core in the next major release (1.5). The following plug-ins are provided by Microsoft: jQuery Templates – a client side template rendering engine jQuery Data Link – a client side databinder that can synchronize changes without code jQuery Globalization – provides formatting and conversion features for dates and numbers The first two are ports of functionality that was slated for the Microsoft Ajax Library while functionality for the globalization library provides functionality that was already found in the original ASP.NET AJAX library. To me all three plug-ins address a pressing need in client side applications and provide functionality I’ve previously used in other incarnations, but with more complete implementations. Let’s take a close look at these plug-ins. jQuery Templates http://api.jquery.com/category/plugins/templates/ Client side templating is a key component for building rich JavaScript applications in the browser. Templating on the client lets you avoid from manually creating markup by creating DOM nodes and injecting them individually into the document via code. Rather you can create markup templates – similar to the way you create classic ASP server markup – and merge data into these templates to render HTML which you can then inject into the document or replace existing content with. Output from templates are rendered as a jQuery matched set and can then be easily inserted into the document as needed. Templating is key to minimize client side code and reduce repeated code for rendering logic. Instead a single template can be used in many places for updating and adding content to existing pages. Further if you build pure AJAX interfaces that rely entirely on client rendering of the initial page content, templates allow you to a use a single markup template to handle all rendering of each specific HTML section/element. I’ve used a number of different client rendering template engines with jQuery in the past including jTemplates (a PHP style templating engine) and a modified version of John Resig’s MicroTemplating engine which I built into my own set of libraries because it’s such a commonly used feature in my client side applications. jQuery templates adds a much richer templating model that allows for sub-templates and access to the data items. Like John Resig’s original Micro Template engine, the core basics of the templating engine create JavaScript code which means that templates can include JavaScript code. To give you a basic idea of how templates work imagine I have an application that downloads a set of stock quotes based on a symbol list then displays them in the document. To do this you can create an ‘item’ template that describes how each of the quotes is renderd as a template inside of the document: <script id="stockTemplate" type="text/x-jquery-tmpl"> <div id="divStockQuote" class="errordisplay" style="width: 500px;"> <div class="label">Company:</div><div><b>${Company}(${Symbol})</b></div> <div class="label">Last Price:</div><div>${LastPrice}</div> <div class="label">Net Change:</div><div> {{if NetChange > 0}} <b style="color:green" >${NetChange}</b> {{else}} <b style="color:red" >${NetChange}</b> {{/if}} </div> <div class="label">Last Update:</div><div>${LastQuoteTimeString}</div> </div> </script> The ‘template’ is little more than HTML with some markup expressions inside of it that define the template language. Notice the embedded ${} expressions which reference data from the quote objects returned from an AJAX call on the server. You can embed any JavaScript or value expression in these template expressions. There are also a number of structural commands like {{if}} and {{each}} that provide for rudimentary logic inside of your templates as well as commands ({{tmpl}} and {{wrap}}) for nesting templates. You can find more about the full set of markup expressions available in the documentation. To load up this data you can use code like the following: <script type="text/javascript"> //var Proxy = new ServiceProxy("../PageMethods/PageMethodsService.asmx/"); $(document).ready(function () { $("#btnGetQuotes").click(GetQuotes); }); function GetQuotes() { var symbols = $("#txtSymbols").val().split(","); $.ajax({ url: "../PageMethods/PageMethodsService.asmx/GetStockQuotes", data: JSON.stringify({ symbols: symbols }), // parameter map type: "POST", // data has to be POSTed contentType: "application/json", timeout: 10000, dataType: "json", success: function (result) { var quotes = result.d; var jEl = $("#stockTemplate").tmpl(quotes); $("#quoteDisplay").empty().append(jEl); }, error: function (xhr, status) { alert(status + "\r\n" + xhr.responseText); } }); }; </script> In this case an ASMX AJAX service is called to retrieve the stock quotes. The service returns an array of quote objects. The result is returned as an object with the .d property (in Microsoft service style) that returns the actual array of quotes. The template is applied with: var jEl = $("#stockTemplate").tmpl(quotes); which selects the template script tag and uses the .tmpl() function to apply the data to it. The result is a jQuery matched set of elements that can then be appended to the quote display element in the page. The template is merged against an array in this example. When the result is an array the template is automatically applied to each each array item. If you pass a single data item – like say a stock quote – the template works exactly the same way but is applied only once. Templates also have access to a $data item which provides the current data item and information about the tempalte that is currently executing. This makes it possible to keep context within the context of the template itself and also to pass context from a parent template to a child template which is very powerful. Templates can be evaluated by using the template selector and calling the .tmpl() function on the jQuery matched set as shown above or you can use the static $.tmpl() function to provide a template as a string. This allows you to dynamically create templates in code or – more likely – to load templates from the server via AJAX calls. In short there are options The above shows off some of the basics, but there’s much for functionality available in the template engine. Check the documentation link for more information and links to additional examples. The plug-in download also comes with a number of examples that demonstrate functionality. jQuery templates will become a native component in jQuery Core 1.5, so it’s definitely worthwhile checking out the engine today and get familiar with this interface. As much as I’m stoked about templating becoming part of the jQuery core because it’s such an integral part of many applications, there are also a couple shortcomings in the current incarnation: Lack of Error Handling Currently if you embed an expression that is invalid it’s simply not rendered. There’s no error rendered into the template nor do the various  template functions throw errors which leaves finding of bugs as a runtime exercise. I would like some mechanism – optional if possible – to be able to get error info of what is failing in a template when it’s rendered. No String Output Templates are always rendered into a jQuery matched set and there’s no way that I can see to directly render to a string. String output can be useful for debugging as well as opening up templating for creating non-HTML string output. Limited JavaScript Access Unlike John Resig’s original MicroTemplating Engine which was entirely based on JavaScript code generation these templates are limited to a few structured commands that can ‘execute’. There’s no code execution inside of script code which means you’re limited to calling expressions available in global objects or the data item passed in. This may or may not be a big deal depending on the complexity of your template logic. Error handling has been discussed quite a bit and it’s likely there will be some solution to that particualar issue by the time jQuery templates ship. The others are relatively minor issues but something to think about anyway. jQuery Data Link http://api.jquery.com/category/plugins/data-link/ jQuery Data Link provides the ability to do two-way data binding between input controls and an underlying object’s properties. The typical scenario is linking a textbox to a property of an object and have the object updated when the text in the textbox is changed and have the textbox change when the value in the object or the entire object changes. The plug-in also supports converter functions that can be applied to provide the conversion logic from string to some other value typically necessary for mapping things like textbox string input to say a number property and potentially applying additional formatting and calculations. In theory this sounds great, however in reality this plug-in has some serious usability issues. Using the plug-in you can do things like the following to bind data: person = { firstName: "rick", lastName: "strahl"}; $(document).ready( function() { // provide for two-way linking of inputs $("form").link(person); // bind to non-input elements explicitly $("#objFirst").link(person, { firstName: { name: "objFirst", convertBack: function (value, source, target) { $(target).text(value); } } }); $("#objLast").link(person, { lastName: { name: "objLast", convertBack: function (value, source, target) { $(target).text(value); } } }); }); This code hooks up two-way linking between a couple of textboxes on the page and the person object. The first line in the .ready() handler provides mapping of object to form field with the same field names as properties on the object. Note that .link() does NOT bind items into the textboxes when you call .link() – changes are mapped only when values change and you move out of the field. Strike one. The two following commands allow manual binding of values to specific DOM elements which is effectively a one-way bind. You specify the object and a then an explicit mapping where name is an ID in the document. The converter is required to explicitly assign the value to the element. Strike two. You can also detect changes to the underlying object and cause updates to the input elements bound. Unfortunately the syntax to do this is not very natural as you have to rely on the jQuery data object. To update an object’s properties and get change notification looks like this: function updateFirstName() { $(person).data("firstName", person.firstName + " (code updated)"); } This works fine in causing any linked fields to be updated. In the bindings above both the firstName input field and objFirst DOM element gets updated. But the syntax requires you to use a jQuery .data() call for each property change to ensure that the changes are tracked properly. Really? Sure you’re binding through multiple layers of abstraction now but how is that better than just manually assigning values? The code savings (if any) are going to be minimal. As much as I would like to have a WPF/Silverlight/Observable-like binding mechanism in client script, this plug-in doesn’t help much towards that goal in its current incarnation. While you can bind values, the ‘binder’ is too limited to be really useful. If initial values can’t be assigned from the mappings you’re going to end up duplicating work loading the data using some other mechanism. There’s no easy way to re-bind data with a different object altogether since updates trigger only through the .data members. Finally, any non-input elements have to be bound via code that’s fairly verbose and frankly may be more voluminous than what you might write by hand for manual binding and unbinding. Two way binding can be very useful but it has to be easy and most importantly natural. If it’s more work to hook up a binding than writing a couple of lines to do binding/unbinding this sort of thing helps very little in most scenarios. In talking to some of the developers the feature set for Data Link is not complete and they are still soliciting input for features and functionality. If you have ideas on how you want this feature to be more useful get involved and post your recommendations. As it stands, it looks to me like this component needs a lot of love to become useful. For this component to really provide value, bindings need to be able to be refreshed easily and work at the object level, not just the property level. It seems to me we would be much better served by a model binder object that can perform these binding/unbinding tasks in bulk rather than a tool where each link has to be mapped first. I also find the choice of creating a jQuery plug-in questionable – it seems a standalone object – albeit one that relies on the jQuery library – would provide a more intuitive interface than the current forcing of options onto a plug-in style interface. Out of the three Microsoft created components this is by far the least useful and least polished implementation at this point. jQuery Globalization http://github.com/jquery/jquery-global Globalization in JavaScript applications often gets short shrift and part of the reason for this is that natively in JavaScript there’s little support for formatting and parsing of numbers and dates. There are a number of JavaScript libraries out there that provide some support for globalization, but most are limited to a particular portion of globalization. As .NET developers we’re fairly spoiled by the richness of APIs provided in the framework and when dealing with client development one really notices the lack of these features. While you may not necessarily need to localize your application the globalization plug-in also helps with some basic tasks for non-localized applications: Dealing with formatting and parsing of dates and time values. Dates in particular are problematic in JavaScript as there are no formatters whatsoever except the .toString() method which outputs a verbose and next to useless long string. With the globalization plug-in you get a good chunk of the formatting and parsing functionality that the .NET framework provides on the server. You can write code like the following for example to format numbers and dates: var date = new Date(); var output = $.format(date, "MMM. dd, yy") + "\r\n" + $.format(date, "d") + "\r\n" + // 10/25/2010 $.format(1222.32213, "N2") + "\r\n" + $.format(1222.33, "c") + "\r\n"; alert(output); This becomes even more useful if you combine it with templates which can also include any JavaScript expressions. Assuming the globalization plug-in is loaded you can create template expressions that use the $.format function. Here’s the template I used earlier for the stock quote again with a couple of formats applied: <script id="stockTemplate" type="text/x-jquery-tmpl"> <div id="divStockQuote" class="errordisplay" style="width: 500px;"> <div class="label">Company:</div><div><b>${Company}(${Symbol})</b></div> <div class="label">Last Price:</div> <div>${$.format(LastPrice,"N2")}</div> <div class="label">Net Change:</div><div> {{if NetChange > 0}} <b style="color:green" >${NetChange}</b> {{else}} <b style="color:red" >${NetChange}</b> {{/if}} </div> <div class="label">Last Update:</div> <div>${$.format(LastQuoteTime,"MMM dd, yyyy")}</div> </div> </script> There are also parsing methods that can parse dates and numbers from strings into numbers easily: alert($.parseDate("25.10.2010")); alert($.parseInt("12.222")); // de-DE uses . for thousands separators As you can see culture specific options are taken into account when parsing. The globalization plugin provides rich support for a variety of locales: Get a list of all available cultures Query cultures for culture items (like currency symbol, separators etc.) Localized string names for all calendar related items (days of week, months) Generated off of .NET’s supported locales In short you get much of the same functionality that you already might be using in .NET on the server side. The plugin includes a huge number of locales and an Globalization.all.min.js file that contains the text defaults for each of these locales as well as small locale specific script files that define each of the locale specific settings. It’s highly recommended that you NOT use the huge globalization file that includes all locales, but rather add script references to only those languages you explicitly care about. Overall this plug-in is a welcome helper. Even if you use it with a single locale (like en-US) and do no other localization, you’ll gain solid support for number and date formatting which is a vital feature of many applications. Changes for Microsoft It’s good to see Microsoft coming out of its shell and away from the ‘not-built-here’ mentality that has been so pervasive in the past. It’s especially good to see it applied to jQuery – a technology that has stood in drastic contrast to Microsoft’s own internal efforts in terms of design, usage model and… popularity. It’s great to see that Microsoft is paying attention to what customers prefer to use and supporting the customer sentiment – even if it meant drastically changing course of policy and moving into a more open and sharing environment in the process. The additional jQuery support that has been introduced in the last two years certainly has made lives easier for many developers on the ASP.NET platform. It’s also nice to see Microsoft submitting proposals through the standard jQuery process of plug-ins and getting accepted for various very useful projects. Certainly the jQuery Templates plug-in is going to be very useful to many especially since it will be baked into the jQuery core in jQuery 1.5. I hope we see more of this type of involvement from Microsoft in the future. Kudos!© Rick Strahl, West Wind Technologies, 2005-2010Posted in jQuery  ASP.NET  

    Read the article

< Previous Page | 428 429 430 431 432 433 434 435 436 437 438 439  | Next Page >