Search Results

Search found 46039 results on 1842 pages for 'system diagnostics proces'.

Page 435/1842 | < Previous Page | 431 432 433 434 435 436 437 438 439 440 441 442  | Next Page >

  • Ubuntu: Multiple NICs, one used only for Wake-On-LAN

    - by jcwx86
    This is similar to some other questions, but I have a specific need which is not covered in the other questions. I have an Ubuntu server (11.10) with two NICs. One is built into the motherboard and the other is a PCI express card. I want to have my server connected to the internet via my NAT router and also have it able to wake from suspend using a Magic Packet (henceforth referred to as Wake-On-LAN, WOL). I can't do this with just one of the NICs because each has an issue - the built-in NIC will crash the system if it is placed under heavy load (typically downloading data), whilst the PCI express NIC will crash the system if it is used for WOL. I have spent some time investigating these individual problems, to no avail. My plan is thus: use the built-in NIC solely for WOL, and use the PCI express card for all other network communication except WOL. Since I send the WOL Magic Packet to a specific MAC address, there is no danger of hitting the wrong NIC, but there is a danger of using the built-in NIC for general network access, overloading it and crashing the system. Both NICs are wired to the same LAN with address space 192.168.0.0/24. The built-in ethernet card is set to have interface name eth1 and the PCI express card is eth0 in Ubuntu's udev persistent rules (so they stay the same upon reboot). I have been trying to set this up with the /etc/network/interfaces file. Here is where I am currently: auto lo iface lo inet loopback auto eth0 iface eth0 inet static address 192.168.0.3 netmask 255.255.255.0 network 192.168.0.0 broadcast 192.168.0.255 gateway 192.168.0.1 auto eth1 iface eth1 inet static address 192.168.0.254 netmask 255.255.255.0 I think by not specifying a gateway for eth1, I prevent it being used for outgoing requests. I don't mind if it can be reached on 192.168.0.254 on the LAN, i.e. via SSH -- it's IP is irrelevant to WOL, which is based on MAC addresses -- I just don't want it to be used to access internet resources. My kernel routing table (from route -n) is Kernel IP routing table Destination Gateway Genmask Flags Metric Ref Use Iface 0.0.0.0 192.168.0.1 0.0.0.0 UG 100 0 0 eth0 169.254.0.0 0.0.0.0 255.255.0.0 U 1000 0 0 eth0 192.168.0.0 0.0.0.0 255.255.255.0 U 0 0 0 eth0 192.168.0.0 0.0.0.0 255.255.255.0 U 0 0 0 eth1 My question is this: Is this sufficient for what I want to achieve? My research has thrown up the idea of using static routing to specify that eth1 should only be used for WOL on the local network, but I'm not sure this is necessary. I have been monitoring the activity of the interfaces using iptraf and it seems like eth0 takes the vast majority of the packets, though I am not sure that this will be consistent based on my configuration. Given that if I mess up the configuration, my system will likely crash, it is important to me to have this set up correctly!

    Read the article

  • cant get my listbox to display objects

    - by Silvia Stoyanova
    Hello everyone I've been trying to put some objects in an ASP.NET list box but its just not working. I do have an overriden ToString method so I cant understand why this statement wont work. Here's the code that I use: for (int i = 0; i < fitnessClassList.Count(); i++) { lbDisplayItems.Items.Add(fitnessClassList.getFitnessClass(i)); } And the errors that I get: Error 2 Argument 1: cannot convert from 'FitnessClassManager.FitnessClassOpportunity' to 'System.Web.UI.WebControls.ListItem' Error 1 The best overloaded method match for 'System.Web.UI.WebControls.ListItemCollection.Add(System.Web.UI.WebControls.ListItem)' has some invalid arguments

    Read the article

  • What are the best options for a root filesystem hosted on SSD under Linux

    - by stsquad
    I'm working on an embedded system which is going to be booting and hosting it's rootfs on an SSD disk. We are currently looking at using Intel X-18M SSDs. The file system structure will have a fairly static /usr section (modulo software upgrades) and an active /var and /var/log for maintaining state and logging. Given the wear-levelling done by the underlying flash does having separate partitions help or hinder? As modern SSDs appear as straight block devices and hide their mapping magic behind their firmware is there any point trying to optimise the choice of file-system that sits on-top of the SSD? Finally does enable SMART monitoring make any sense in this context or are their SSD specific ways of determining the underlying health of the storage hardware?

    Read the article

  • Adding KeyListener to a JWindow not getting any key events

    - by Untitled
    Hello everyone, In Java, I am adding a KeyListener to a JWindow, but it is not getting any key events. If I used the same code but extend a JFrame instead, then everything works fine. public class MyWindow extends JWindow { ... ... private void initComponents() { ... ... addKeyListener(new KeyListener() { public void keyPressed(KeyEvent e) { System.out.println("KEY PRESSED: " + e.getKeyCode()); } public void keyReleased(KeyEvent e) { System.out.println("KEY RELEASED: " + e.getKeyCode()); } public void keyTyped(KeyEvent e) { System.out.println("KEY TYPED: " + e.getKeyCode()); } }); } } Anyone know how can I solve this by using a JWindow? Please note that I am using Linux, so I am not sure if it is something to do with the platform. Thanks

    Read the article

  • Desktop icons and taskbar not shown in Windows XP

    - by phoenix
    Hi, I am not able see any desktop icons, taskbar in my Windows XP system. Also none of the keyboard shortcuts like Win Key + R, Win Key + E are not working. Yesterday I installed AVG 9.0 in my machine and was working fine. But today when I started the system an svchost error occured saying "the memory at location could not be written". What would be the cause of this issue? Thanks in advance

    Read the article

  • Comparison between operational systems

    - by Gustavo Bandeira
    Some years ago, I've heard people saying that the OSX and Linux were better than Windows, I also remember of reading something that said the Solaris operating system didn't fragment their files and that the Linux file system was almost in the same step but none of these claims seemed to have basis or references. I got two questions: When comparing operating systems, what are the main points for comparison? How's the comparison between the main operating systems today?

    Read the article

  • Explain JAVA code

    - by MIW
    I need some help to explain the meaning from line 5 to line 9. Thanks String words = "Rain Rain go away"; String mutation1, mutation2, mutation3, mutation4; mutation1 = words.toUpperCase(); System.out.println ("** " + mutation1 + " Nursery Rhyme **"); mutation1 = words.concat ("\nCome again another day"); mutation2 = "Johnny Johnny wants to play"; mutation3 = mutation2.replace (mutation2.charAt(5), 'i'); mutation4 = mutation3.substring (7, 27); System.out.print ("\'" + mutation1 + "\n" + mutation4 + "\'\n"); 10.System.out.println ("Title length: " + words.length());

    Read the article

  • Organising photos using Picasa

    - by Casebash
    I am kind of confused by Picasa's photo organisation system which involves albums on one hand and folders plus collections on the other. Does anyone have a good system for using these to keep everything organised?

    Read the article

  • Why my application ask for a codec to pla the MVI(.MOV) video files while i can play them on WMP and QuickTime?

    - by Daniel Lip
    I have an application i did some time ago when im loading the video file its ok when trying to play/use the file im getting the messageBox message say that its need a codec to use gspot or search the internet. Wehn im playing this files on my hard disk with Windows Media Play or either QuickTime there is no problems. The Video files for example name are: MVI_2483 in the file name properties i see its type: Quick Time Movie (.MOV) In my application im using DirectShowLib-2005.dll this is the class im using in my case to extract the video file im using it in my application to extract only lightnings from the video file name. In Form1 i have a button click event that just starting the action: private void button8_Click(object sender, EventArgs e) { viewToolStripMenuItem.Enabled = false; fileToolStripMenuItem.Enabled = false; button2.Enabled = false; label14.Visible = false; label15.Visible = false; label21.Visible = false; label22.Visible = false; label24.Visible = false; label25.Visible = false; ExtractAutomatic = true; DirectoryInfo info = new DirectoryInfo(_videoFile); string dirName = info.Name; automaticModeDirectory = dirName + "_Automatic"; subDirectoryName = _outputDir + "\\" + automaticModeDirectory; if (secondPass == true) { Start(true); } Start(false); } This is the function start in Form1: private void Start(bool secondpass) { setpicture(-1); if (Directory.Exists(_outputDir) && secondpass == false) { } else { Directory.CreateDirectory(_outputDir); } if (ExtractAutomatic == true) { string subDirectory_Automatic_Name = _outputDir + "\\" + automaticModeDirectory; Directory.CreateDirectory(subDirectory_Automatic_Name); f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Automatic_Name)); } else { string subDirectory_Manual_Name; if (Directory.Exists(subDirectoryName)) { subDirectory_Manual_Name = subDirectoryName; f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Manual_Name)); } else { subDirectory_Manual_Name = _outputDir + "\\" + averagesListTextFileDirectory + "_Manual"; Directory.CreateDirectory(subDirectory_Manual_Name); f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Manual_Name)); } } button1.Enabled = false; f.Secondpass = secondpass; f.FramesToSave = _fts; f.FrameCountAvailable += new WmvAdapter.FrameCountEventHandler(f_FrameCountAvailable); f.StatusChanged += new WmvAdapter.EventHandler(f_StatusChanged); f.ProgressChanged += new WmvAdapter.ProgressEventHandler(f_ProgressChanged); this.Text = "Processing Please Wait..."; label5.ForeColor = Color.Green; label5.Text = "Processing Please Wait"; button8.Enabled = false; button5.Enabled = false; label5.Visible = true; pictureBox1.Image = Lightnings_Extractor.Properties.Resources.Weather_Michmoret; Hrs = 0; //number of hours Min = 0; //number of Minutes Sec = 0; //number of Sec timeElapsed = 0; label10.Text = "00:00:00"; label11.Visible = false; label12.Visible = false; label9.Visible = false; label8.Visible = false; this.button1.Enabled = false; myTrackPanelss1.trackBar1.Enabled = false; this.checkBox2.Enabled = false; this.checkBox1.Enabled = false; numericUpDown1.Enabled = false; timer1.Start(); label2.Text = ""; label1.Visible = true; label2.Visible = true; label3.Visible = true; label4.Visible = true; f.Start(); } And this is the class wich is not my oqn class i just just defined it in some places wich making the problem: using System; using System.Diagnostics; using System.Drawing; using System.Drawing.Imaging; using System.IO; using System.Runtime.InteropServices; using DirectShowLib; using System.Collections.Generic; using Extracting_Frames; using System.Windows.Forms; namespace Polkan.DataSource { internal class WmvAdapter : ISampleGrabberCB, IDisposable { #region Fields_Properties_and_Events bool dis = false; int count = 0; const string fileName = @"d:\histogramValues.dat"; private IFilterGraph2 _filterGraph; private IMediaControl _mediaCtrl; private IMediaEvent _mediaEvent; private int _width; private int _height; private readonly string _outFolder; private int _frameId; //better use a custom EventHandler that passes the results of the action to the subscriber. public delegate void EventHandler(object sender, EventArgs e); public event EventHandler StatusChanged; public delegate void FrameCountEventHandler(object sender, FrameCountEventArgs e); public event FrameCountEventHandler FrameCountAvailable; public delegate void ProgressEventHandler(object sender, ProgressEventArgs e); public event ProgressEventHandler ProgressChanged; private IMediaSeeking _mSeek; private long _duration = 0; private long _avgFrameTime = 0; //just save the averages to a List (not to fs) public List<double> AveragesList { get; set; } public List<long> histogramValuesList; public bool Secondpass { get; set; } public List<int> FramesToSave { get; set; } #endregion #region Constructors and Destructors public WmvAdapter(string file, string outFolder) { _outFolder = outFolder; try { SetupGraph(file); } catch { Dispose(); MessageBox.Show("A codec is required to load this video file. Please use http://www.headbands.com/gspot/ or search the web for the correct codec"); } } ~WmvAdapter() { CloseInterfaces(); } #endregion public void Dispose() { CloseInterfaces(); } public void Start() { EstimateFrameCount(); int hr = _mediaCtrl.Run(); WaitUntilDone(); DsError.ThrowExceptionForHR(hr); } public void WaitUntilDone() { int hr; const int eAbort = unchecked((int)0x80004004); do { System.Windows.Forms.Application.DoEvents(); EventCode evCode; if (dis == true) { return; } hr = _mediaEvent.WaitForCompletion(100, out evCode); }while (hr == eAbort); DsError.ThrowExceptionForHR(hr); OnStatusChanged(); } //Edit: added events protected virtual void OnStatusChanged() { if (StatusChanged != null) StatusChanged(this, new EventArgs()); } protected virtual void OnFrameCountAvailable(long frameCount) { if (FrameCountAvailable != null) FrameCountAvailable(this, new FrameCountEventArgs() { FrameCount = frameCount }); } protected virtual void OnProgressChanged(int frameID) { if (ProgressChanged != null) ProgressChanged(this, new ProgressEventArgs() { FrameID = frameID }); } /// <summary> build the capture graph for grabber. </summary> private void SetupGraph(string file) { ISampleGrabber sampGrabber = null; IBaseFilter capFilter = null; IBaseFilter nullrenderer = null; _filterGraph = (IFilterGraph2)new FilterGraph(); _mediaCtrl = (IMediaControl)_filterGraph; _mediaEvent = (IMediaEvent)_filterGraph; _mSeek = (IMediaSeeking)_filterGraph; var mediaFilt = (IMediaFilter)_filterGraph; try { // Add the video source int hr = _filterGraph.AddSourceFilter(file, "Ds.NET FileFilter", out capFilter); DsError.ThrowExceptionForHR(hr); // Get the SampleGrabber interface sampGrabber = new SampleGrabber() as ISampleGrabber; var baseGrabFlt = sampGrabber as IBaseFilter; ConfigureSampleGrabber(sampGrabber); // Add the frame grabber to the graph hr = _filterGraph.AddFilter(baseGrabFlt, "Ds.NET Grabber"); DsError.ThrowExceptionForHR(hr); // --------------------------------- // Connect the file filter to the sample grabber // Hopefully this will be the video pin, we could check by reading it's mediatype IPin iPinOut = DsFindPin.ByDirection(capFilter, PinDirection.Output, 0); // Get the input pin from the sample grabber IPin iPinIn = DsFindPin.ByDirection(baseGrabFlt, PinDirection.Input, 0); hr = _filterGraph.Connect(iPinOut, iPinIn); DsError.ThrowExceptionForHR(hr); // Add the null renderer to the graph nullrenderer = new NullRenderer() as IBaseFilter; hr = _filterGraph.AddFilter(nullrenderer, "Null renderer"); DsError.ThrowExceptionForHR(hr); // --------------------------------- // Connect the sample grabber to the null renderer iPinOut = DsFindPin.ByDirection(baseGrabFlt, PinDirection.Output, 0); iPinIn = DsFindPin.ByDirection(nullrenderer, PinDirection.Input, 0); hr = _filterGraph.Connect(iPinOut, iPinIn); DsError.ThrowExceptionForHR(hr); // Turn off the clock. This causes the frames to be sent // thru the graph as fast as possible hr = mediaFilt.SetSyncSource(null); DsError.ThrowExceptionForHR(hr); // Read and cache the image sizes SaveSizeInfo(sampGrabber); //Edit: get the duration hr = _mSeek.GetDuration(out _duration); DsError.ThrowExceptionForHR(hr); } finally { if (capFilter != null) { Marshal.ReleaseComObject(capFilter); } if (sampGrabber != null) { Marshal.ReleaseComObject(sampGrabber); } if (nullrenderer != null) { Marshal.ReleaseComObject(nullrenderer); } GC.Collect(); } } private void EstimateFrameCount() { try { //1sec / averageFrameTime double fr = 10000000.0 / _avgFrameTime; double frameCount = fr * (_duration / 10000000.0); OnFrameCountAvailable((long)frameCount); } catch { } } public double framesCounts() { double fr = 10000000.0 / _avgFrameTime; double frameCount = fr * (_duration / 10000000.0); return frameCount; } private void SaveSizeInfo(ISampleGrabber sampGrabber) { // Get the media type from the SampleGrabber var media = new AMMediaType(); int hr = sampGrabber.GetConnectedMediaType(media); DsError.ThrowExceptionForHR(hr); if ((media.formatType != FormatType.VideoInfo) || (media.formatPtr == IntPtr.Zero)) { throw new NotSupportedException("Unknown Grabber Media Format"); } // Grab the size info var videoInfoHeader = (VideoInfoHeader)Marshal.PtrToStructure(media.formatPtr, typeof(VideoInfoHeader)); _width = videoInfoHeader.BmiHeader.Width; _height = videoInfoHeader.BmiHeader.Height; //Edit: get framerate _avgFrameTime = videoInfoHeader.AvgTimePerFrame; DsUtils.FreeAMMediaType(media); GC.Collect(); } private void ConfigureSampleGrabber(ISampleGrabber sampGrabber) { var media = new AMMediaType { majorType = MediaType.Video, subType = MediaSubType.RGB24, formatType = FormatType.VideoInfo }; int hr = sampGrabber.SetMediaType(media); DsError.ThrowExceptionForHR(hr); DsUtils.FreeAMMediaType(media); GC.Collect(); hr = sampGrabber.SetCallback(this, 1); DsError.ThrowExceptionForHR(hr); } private void CloseInterfaces() { try { if (_mediaCtrl != null) { _mediaCtrl.Stop(); _mediaCtrl = null; dis = true; } } catch (Exception ex) { Debug.WriteLine(ex); } if (_filterGraph != null) { Marshal.ReleaseComObject(_filterGraph); _filterGraph = null; } GC.Collect(); } int ISampleGrabberCB.SampleCB(double sampleTime, IMediaSample pSample) { Marshal.ReleaseComObject(pSample); return 0; } int ISampleGrabberCB.BufferCB(double sampleTime, IntPtr pBuffer, int bufferLen) { if (Form1.ExtractAutomatic == true) { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { long[] HistogramValues = Form1.GetHistogram(bitmap); long t = Form1.GetTopLumAmount(HistogramValues, 1000); Form1.averagesTest.Add(t); } else { //this is the changed part if (_frameId > 0) { if (Form1.averagesTest[_frameId] / 1000.0 - Form1.averagesTest[_frameId - 1] / 1000.0 > 150.0) { count = 6; } if (count > 0) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); count --; } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } } else { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { //get avg double average = GetAveragePixelValue(bitmap); if (AveragesList == null) AveragesList = new List<double>(); //save avg AveragesList.Add(average); //***************************\\ // for (int i = 0; i < (int)framesCounts(); i++) // { // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); //***************************\\ //} } else { if (FramesToSave != null && FramesToSave.Contains(_frameId)) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); using (BinaryWriter binWriter = new BinaryWriter(File.Open(fileName, FileMode.Create))) { for (int i = 0; i < histogramValuesList.Count; i++) { binWriter.Write(histogramValuesList[(int)i]); } binWriter.Close(); } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } } return 0; } /* int ISampleGrabberCB.SampleCB(double sampleTime, IMediaSample pSample) { Marshal.ReleaseComObject(pSample); return 0; } int ISampleGrabberCB.BufferCB(double sampleTime, IntPtr pBuffer, int bufferLen) { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { //get avg double average = GetAveragePixelValue(bitmap); if (AveragesList == null) AveragesList = new List<double>(); //save avg AveragesList.Add(average); //***************************\\ // for (int i = 0; i < (int)framesCounts(); i++) // { // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); long t = Form1.GetTopLumAmount(HistogramValues, 1000); //***************************\\ Form1.averagesTest.Add(t); // to add this list to a text file or binary file and read the averages from the file when its is Secondpass !!!!! //} } else { if (FramesToSave != null && FramesToSave.Contains(_frameId)) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); using (BinaryWriter binWriter = new BinaryWriter(File.Open(fileName, FileMode.Create))) { for (int i = 0; i < histogramValuesList.Count; i++) { binWriter.Write(histogramValuesList[(int)i]); } binWriter.Close(); } } for (int x = 1; x < Form1.averagesTest.Count; x++) { double fff = Form1.averagesTest[x] / 1000.0 - Form1.averagesTest[x - 1] / 1000.0; if (Form1.averagesTest[x] / 1000.0 - Form1.averagesTest[x - 1] / 1000.0 > 180.0) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); _frameId++; } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } return 0; }*/ private unsafe double GetAveragePixelValue(Bitmap bmp) { BitmapData bmData = null; try { bmData = bmp.LockBits(new Rectangle(0, 0, bmp.Width, bmp.Height), ImageLockMode.ReadOnly, PixelFormat.Format24bppRgb); int stride = bmData.Stride; IntPtr scan0 = bmData.Scan0; int w = bmData.Width; int h = bmData.Height; double sum = 0; long pixels = bmp.Width * bmp.Height; byte* p = (byte*)scan0.ToPointer(); for (int y = 0; y < h; y++) { p = (byte*)scan0.ToPointer(); p += y * stride; for (int x = 0; x < w; x++) { double i = ((double)p[0] + p[1] + p[2]) / 3.0; sum += i; p += 3; } //no offset incrementation needed when getting //the pointer at the start of each row } bmp.UnlockBits(bmData); double result = sum / (double)pixels; return result; } catch { try { bmp.UnlockBits(bmData); } catch { } } return -1; } } public class FrameCountEventArgs { public long FrameCount { get; set; } } public class ProgressEventArgs { public int FrameID { get; set; } } } I remember i had this codec problem/s before and i installed the codec/'s that were needed but in this case both quick time and windows media player can play the video files so why the application cant detect and find the codec/'s on my computer ? Gspot say that the codec is AVC1 but again wmp and quicktime play the video files no problems. The video files are from my digital camera !

    Read the article

  • Vbscript / webcam. using flash API - Save streaming file as image

    - by remi
    Hi. Based on a php app we've tried to developp our own webapp in vbscript. All is working well. The camera starts, etc.. The problem we're left with is the following: the flash API is streaming the content of the video to a webpage, this page saves the photo as a jpg. The PHP code we're trying to emulate is as follow $str = file_get_contents("php://input"); file_put_contents("/tmp/upload.jpg", pack("H*", $str)); After intensive googling the best we can come up with is Protected Sub Page_Load(ByVal sender As Object, ByVal e As System.EventArgs) Dim sImagePath As String = Server.MapPath("/registration/") & "test.jpg" Dim data As Byte() = Request.BinaryRead(Request.TotalBytes) Dim Ret As Array Dim imgbmp As New System.Drawing.Bitmap("test.jpg") Dim ms As MemoryStream = New MemoryStream(data) imgbmp.Save(ms, System.Drawing.Imaging.ImageFormat.Jpeg) Ret = ms.ToArray() Dim fs As New FileStream(sImagePath, FileMode.Create, FileAccess.Write) fs.Write(Ret, 0, Ret.Length) fs.Flush() fs.Close() End Sub which is not working, does anybody have any suggestion?

    Read the article

  • Trying to execute netdom.exe from a ruby script or IRB does nothing

    - by Joraff
    I'm trying to write a script that will rename a computer and join it to a domain, and was planning to call on netdom.exe to do the dirty work. However, trying to run this utility in the script (same results in irb) does absolutely nothing. No output, no execution. I tried with backticks and with the system() method. System() returns false for everything but system("netdom") (which returns true). Backticks never return anything but an empty string. I have verified that netdom runs and works in the environment the script will be running in, and I'm calling other command-line utilities earlier in the script that work (w32tm, getmac, ping). Here's the exact line that gets executed: `netdom renamecomputer %COMPUTERNAME% /NewName:#{newname} /force` FYI, This is windows 7 x64

    Read the article

  • SWT Filedialog Open into home folder

    - by Ivan
    I want to open a FileDialog window into the user home folder (i.e. /home/user or /Users/unsername) I read the user home folder, using System.getProperty: String homefolder = System.getProperty(user.home); And the variable containts the correct home folder. But when i set the filterpath in FileDialog, it opens (in linux) only the /home level not entering into the user home dir. This is the source code: FileDialog dialog = new FileDialog(shell); dialog.setText("Choose a certificate"); String platform = SWT.getPlatform(); String homefolder = System.getProperty("user.home"); dialog.setFilterPath(homefolder); Any idea? Here a screenshot:

    Read the article

  • Black berry: Getting NULL string for exception message.

    - by vikram deshpande
    I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread( String textMsg, String mobileNumber ) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+"+ mobilenumber); TextMessage text = (TextMessage) msgConn.newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); }catch (IOCancelledException ioce){ System.out.println("IOCancelledException: " + ioce.getMessage()); }catch(IOException ioe){ System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

    Read the article

  • Is it possible to write C# code as below and send email using my home network?

    - by kedar karthik
    Is it possible to write C# code as below and send email using my home network? I have a valid user name and password on that exchange server. Is there any configuration that I can set to achieve this? BTW this code blow works when I run it within office network. I want this code to work when run from any network. String cMSExchangeWebServiceURL = (String)System.Configuration.ConfigurationSettings.AppSettings["MSExchangeWebServiceURL"]; String cEmail = (String)System.Configuration.ConfigurationSettings.AppSettings["Cemail"]; String cPassword = (String)System.Configuration.ConfigurationSettings.AppSettings["Cpassword"]; String cTo = (String)System.Configuration.ConfigurationSettings.AppSettings["CTo"]; ExchangeServiceBinding esb = new ExchangeServiceBinding(); esb.Timeout = 1800000; esb.AllowAutoRedirect = true; esb.UseDefaultCredentials = false; esb.Credentials = new NetworkCredential(cEmail, cPassword); esb.Url = cMSExchangeWebServiceURL; ServicePointManager.ServerCertificateValidationCallback += delegate(object sender1, X509Certificate certificate, X509Chain chain, SslPolicyErrors sslPolicyErrors) { return true; }; // Create a CreateItem request object CreateItemType request = new CreateItemType(); // Setup the request: // Indicate that we only want to send the message. No copy will be saved. request.MessageDisposition = MessageDispositionType.SendOnly; request.MessageDispositionSpecified = true; // Create a message object and set its properties MessageType message = new MessageType(); message.Subject = subject; message.Body = new TestOutgoingEmailServer.com.cogniti.mail1.BodyType(); message.Body.BodyType1 = BodyTypeType.HTML; message.Body.Value = body; message.ToRecipients = new EmailAddressType[3]; message.ToRecipients[0] = new EmailAddressType(); //message.ToRecipients[1] = new EmailAddressType(); //message.ToRecipients[2] = new EmailAddressType(); message.ToRecipients[0].EmailAddress = "[email protected]"; message.ToRecipients[0].RoutingType = "SMTP"; //message.CcRecipients = new EmailAddressType[1]; //message.CcRecipients[0] = new EmailAddressType(); //message.CcRecipients[0].EmailAddress = toEmailAddress.ElementAt(1).ToString(); //message.CcRecipients[0].RoutingType = "SMTP"; //There are some more properties in MessageType object //you can set all according to your requirement // Construct the array of items to send request.Items = new NonEmptyArrayOfAllItemsType(); request.Items.Items = new ItemType[1]; request.Items.Items[0] = message; // Call the CreateItem EWS method. CreateItemResponseType response = esb.CreateItem(request);

    Read the article

  • Problem with EditText.requestFocus()

    - by synic
    In the onCreate() of an activity, I've got a call to requestFocus() on an EditText. Immediately after, I've got the following: System.out.println(mEdit.isFocusableInTouchMode()); System.out.println(mEdit.isFocusable()); System.out.println(mEdit.isFocused()); These were just put in while I was trying to figure out what is wrong with this activity... they all print "true". However, as you may have guessed, the EditText does NOT have focus, and if I try to start typing, nothing happens. I have to click on the EditText to being typing. I can't see that anything else has focus, but obviously something has to have it.. how can I find out what it is?

    Read the article

  • Best way to store sales tax information

    - by Seph
    When designing a stock management database system (sales / purchases) what would be the best way to store the various taxes and other such amounts? A few of the fields that could be saved are: Unit price excluding tax Unit price including tax Tax per item Total excluding tax (rounded to 2 decimals) Total including tax (rounded to 2 decimals) Total tax (rounded to 2 decimals) Currently the most reasonable solution so far is storing down (roughly) item, quantity, total excluding tax (rounded) and the total tax (rounded). Can anyone suggest some better way of storing this details for a generic system? Also, given the system needs to be robust, what should be done if there were multiple tax values (eg: state and city) which might need to be separated, in this case a separate table would be in order, but would it be considered excessive to just have a rowID and some taxID mapping to a totalTax column?

    Read the article

  • VB.net Cross-Thread

    - by PandaNL
    Hello, I have a cmd command that needs to be executed, when the command starts it starts to fill a progressbar. When the cmd command is done the progressbar needs to fill up to 100. This is the code i use, but it gives me an error when the progressbar.Value = 100 comes up. Public Class Form1 Dim teller As Integer Private Sub Timer1_Tick(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles TimerProgressbar.Tick teller += 1 ProgressBar1.Value = teller If ProgressBar1.Value = ProgressBar1.Maximum Then TimerProgressbar.Stop() End If End Sub This are the tow commands in another private sub where the app is crashing on ProgressBar1.Value = 100 TimerProgressbar.Stop() When i debug it and i try it out it crashes on ProgressBar1.Value = 100 But when i build it under Windows 7 it runs fine without crashing, however a few people reported me it crashes on there Windows xp system. VB gives me a suggestions about Cross Thread, but i don't know how i could make it work with this.

    Read the article

  • How can you extend the Bitmap class

    - by vrish88
    Hello, I am trying to extend the Bitmap class so that I can apply my own effects to an image. When I use this code: namespace ImageEditor { public class Effects : System.Drawing.Bitmap { public void toBlackAndWhite() { System.Drawing.Bitmap image = (Bitmap)this; AForge.Imaging.Filters.Grayscale filter = new AForge.Imaging.Filters.Grayscale(); this = filter.Apply(this); } } } I get the following error: 'ImageEditor.Effects': cannot derive from sealed type 'System.Drawing.Bitmap' So is there a way to get around this or is it simply not possible to extend the class? Thanks.

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • Hang while starting several daemons [solved]

    - by Adrian Lang
    I’m running a Debian Squeeze AMD64 server. Target runlevel after boot is runlevel 2, which includes rsyslogd, cron, sshd and some other stuff, but not dovecot, postfix, apache2, etc. The system fails to reach runlevel 2 with several symptoms: The system hangs at trying to start rsyslogd Booting into runlevel 1 works, then login from the console works Starting rsyslogd from runlevel 1 via /etc/init.d/rsyslog hangs Starting runlevel 2 with rsyslogd disabled works But then, logging in via console fails: I get the motd, and then nothing Starting sshd from runlevel 1 succeeds But then, I cannot login via ssh. Sometimes password ssh login gives me the motd and then nothing, sometimes not even this. Trying to offer a public key seems to annoy the sshd enough to not talk to me any further. When rebooting from runlevel 1, the server hangs at trying to stop apache2 (which is not running, so this really should be trivial). Trying to stop apache2 when logged in in runleve 1 does hang as well. And that’s just the stuff which fails all the time. RAM has been tested, dmesg shows no problems. I have no clue. Update: (shortened) output from rsyslogd -c4 -d called in runlevel 1 rsyslogd 4.6.4 startup, compatibility mode 4, module path '' caller requested object 'net', not found (iRet -3003) Requested to load module 'lmnet' loading module '/user/lib/rsyslog/lmnet.so' module of type 2 being loaded conf.c requested ref for 'lmnet', refcount 1 rsylog runtime initialized, version 4.6.4, current users 1 syslogd.c requested ref for 'lmnet', refcount now 2 I can kill rsyslogd with Strg+C, then. /var/log shows none of the configured log files, though. Update2: Thanks to @DerfK I still have no clue, but at least I narrowed down the problem. I’m now testing with /etc/init.d/apache2 stop (without an apache2 running, of course) which hangs as well and looks like an even more obvious failure. After some testing I found out that a file with one single line: /usr/sbin/apache2ctl configtest /dev/null 2&1 hangs, while the same line executed in an interactive shell works. I was not able to further reduce this line while, i. e. every single part, the stream redirections and the commando itself is necessary to reproduce the hang. @DerfK also pointed me to strace which gave a shallow hint about what kind of hang we have here: wait4(-1for the init scripts futex(0xsomepointer, FUTEX_WAIT_PRIVATE, 2, NULL for rsyslogd / apache2 binaries called by the init scripts The system was installed as a Debian Lenny by my hoster in autumn 2011, I upgraded it to Squeeze immediately and kept it up to date with Squeeze, which then used to be testing. There were no big changes, though. I guess I never tried to reboot the system before. Update3: I found the problem. My /etc/nsswitch.conf specified ldap as hosts lookup backup, which is not available at that time of the boot. Relying on dns solely fixes my boot problems.

    Read the article

  • Java - getClassLoader().getResource() driving me bonkers

    - by Click Upvote
    I have this test app: import java.applet.*; import java.awt.*; import java.net.URL; public class Test extends Applet { public void init() { URL some=Test.class.getClass().getClassLoader().getResource("/assets/pacman.png"); System.out.println(some.toString()); System.out.println(some.getFile()); System.out.println(some.getPath()); } } When I run it from Eclipse, I get the error: java.lang.NullPointerException at Test.init(Test.java:9) at sun.applet.AppletPanel.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Classpath (from .CLASSPATH file) <classpathentry kind="src" path="src"/> In my c:\project\src folder, I have only the Test.java file and the 'assets' directory which contains pacman.png. What am I doing wrong and how to resolve it?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • C#/.NET: TextBox is not 'focused' after a process was initiated

    - by eibhrum
    Hi, I am having a problem after opening the notepad once I click the button "btnSearch". The idea is that once I clicked the button 'btnSearch', the textbox 'txtSearch' should be 'focused' even after a process was initiated/opened outside the main window. Here's my code: private void btnSearch_Click(object sender, RoutedEventArgs e) { System.Diagnostics.Process.Start("notepad"); txtSearch.Focus(); // not working } Any suggestions?

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • Generate SQL Server Express database from Entity Framework 4 model

    - by Cranialsurge
    I am able to auto-generate a SQL Server CE 4.0 *.sdf file using code-first generation as explained by Scott Guthrie here. The connection string for the same is as follows: <add name="NerdDinners" providerName="System.Data.SqlServerCe.4.0" connectionString="data source=|DataDirectory|NerdDinner.sdf"/> However if I try to generate an mdf instead using the following connection string, it fails to do so with the following error - "The provider did not return a ProviderManifestToken string.". <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="data source=|DataDirectory|NerdDinner.mdf"/> Even directly hooking into a SQLEXPRESS instance using the following connection string fails <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=NerdDinner;Integrated Security=True"/> Does EF 4 only support SQL CE 4.0 for database creation from a model for now or am I doing something wrong here?

    Read the article

< Previous Page | 431 432 433 434 435 436 437 438 439 440 441 442  | Next Page >