Search Results

Search found 11197 results on 448 pages for 'handle leak'.

Page 438/448 | < Previous Page | 434 435 436 437 438 439 440 441 442 443 444 445  | Next Page >

  • Finding the heaviest length-constrained path in a weighted Binary Tree

    - by Hristo
    UPDATE I worked out an algorithm that I think runs in O(n*k) running time. Below is the pseudo-code: routine heaviestKPath( T, k ) // create 2D matrix with n rows and k columns with each element = -8 // we make it size k+1 because the 0th column must be all 0s for a later // function to work properly and simplicity in our algorithm matrix = new array[ T.getVertexCount() ][ k + 1 ] (-8); // set all elements in the first column of this matrix = 0 matrix[ n ][ 0 ] = 0; // fill our matrix by traversing the tree traverseToFillMatrix( T.root, k ); // consider a path that would arc over a node globalMaxWeight = -8; findArcs( T.root, k ); return globalMaxWeight end routine // node = the current node; k = the path length; node.lc = node’s left child; // node.rc = node’s right child; node.idx = node’s index (row) in the matrix; // node.lc.wt/node.rc.wt = weight of the edge to left/right child; routine traverseToFillMatrix( node, k ) if (node == null) return; traverseToFillMatrix(node.lc, k ); // recurse left traverseToFillMatrix(node.rc, k ); // recurse right // in the case that a left/right child doesn’t exist, or both, // let’s assume the code is smart enough to handle these cases matrix[ node.idx ][ 1 ] = max( node.lc.wt, node.rc.wt ); for i = 2 to k { // max returns the heavier of the 2 paths matrix[node.idx][i] = max( matrix[node.lc.idx][i-1] + node.lc.wt, matrix[node.rc.idx][i-1] + node.rc.wt); } end routine // node = the current node, k = the path length routine findArcs( node, k ) if (node == null) return; nodeMax = matrix[node.idx][k]; longPath = path[node.idx][k]; i = 1; j = k-1; while ( i+j == k AND i < k ) { left = node.lc.wt + matrix[node.lc.idx][i-1]; right = node.rc.wt + matrix[node.rc.idx][j-1]; if ( left + right > nodeMax ) { nodeMax = left + right; } i++; j--; } // if this node’s max weight is larger than the global max weight, update if ( globalMaxWeight < nodeMax ) { globalMaxWeight = nodeMax; } findArcs( node.lc, k ); // recurse left findArcs( node.rc, k ); // recurse right end routine Let me know what you think. Feedback is welcome. I think have come up with two naive algorithms that find the heaviest length-constrained path in a weighted Binary Tree. Firstly, the description of the algorithm is as follows: given an n-vertex Binary Tree with weighted edges and some value k, find the heaviest path of length k. For both algorithms, I'll need a reference to all vertices so I'll just do a simple traversal of the Tree to have a reference to all vertices, with each vertex having a reference to its left, right, and parent nodes in the tree. Algorithm 1 For this algorithm, I'm basically planning on running DFS from each node in the Tree, with consideration to the fixed path length. In addition, since the path I'm looking for has the potential of going from left subtree to root to right subtree, I will have to consider 3 choices at each node. But this will result in a O(n*3^k) algorithm and I don't like that. Algorithm 2 I'm essentially thinking about using a modified version of Dijkstra's Algorithm in order to consider a fixed path length. Since I'm looking for heaviest and Dijkstra's Algorithm finds the lightest, I'm planning on negating all edge weights before starting the traversal. Actually... this doesn't make sense since I'd have to run Dijkstra's on each node and that doesn't seem very efficient much better than the above algorithm. So I guess my main questions are several. Firstly, do the algorithms I've described above solve the problem at hand? I'm not totally certain the Dijkstra's version will work as Dijkstra's is meant for positive edge values. Now, I am sure there exist more clever/efficient algorithms for this... what is a better algorithm? I've read about "Using spine decompositions to efficiently solve the length-constrained heaviest path problem for trees" but that is really complicated and I don't understand it at all. Are there other algorithms that tackle this problem, maybe not as efficiently as spine decomposition but easier to understand? Thanks.

    Read the article

  • Qt drag & drop button; drop not detecting

    - by Thomas Verbeke
    I'm creating a 2D game in QT and i'm trying to implement a drag & drop into my program. For some reason the drop is not registered: qDebug should print a message on dropping but this doesn't happen. #include "dialog.h" #include "ui_dialog.h" #include "world.h" #include <vector> Dialog::Dialog(QWidget *parent) : QDialog(parent), ui(new Ui::Dialog) { ui->setupUi(this); scene = new QGraphicsScene(this); ui->graphicsView->setScene(scene); MySquare *item; QGraphicsRectItem *enemyItem; World *myWorld = new World(); std::vector<Tile*> tiles = myWorld->createWorld(":/texture.jpg"); int count = 0; foreach (Tile *tile, tiles){ count++; item = new MySquare(tile->getXPos()*4,tile->getYPos()*4,4,4); item->setBrush(QColor(tile->getValue()*255,tile->getValue()*255,tile->getValue()*255)); item->setAcceptDrops(true); scene->addItem(item); } player = new MySquare(10,20,10,10); player->setAcceptDrops(true); scene->addItem(player); //drag & drop part QPushButton *pushButton = new QPushButton("Click Me",this); connect(pushButton,SIGNAL(pressed()),this,SLOT(makeDrag())); setAcceptDrops(true); } void Dialog::makeDrag() { QDrag *dr = new QDrag(this); // The data to be transferred by the drag and drop operation is contained in a QMimeData object QMimeData *data = new QMimeData; data->setText("This is a test"); // Assign ownership of the QMimeData object to the QDrag object. dr->setMimeData(data); // Start the drag and drop operation dr->start(); } mysquare.cpp #include "mysquare.h" MySquare::MySquare(int _x,int _y, int _w, int _h) { isPlayer=false; Pressed=false; setFlag(ItemIsMovable); setFlag(ItemIsFocusable); setAcceptDrops(true); color=Qt::red; color_pressed = Qt::green; x = _x; y = _y; w = _w; h = _h; } QRectF MySquare::boundingRect() const { return QRectF(x,y,w,h); } void MySquare::paint(QPainter *painter, const QStyleOptionGraphicsItem *option, QWidget *widget) { QRectF rec = boundingRect(); QBrush brush(color); if (Pressed){ brush.setColor(color); } else { brush.setColor(color_pressed); } painter->fillRect(rec,brush); painter->drawRect(rec); } void MySquare::mousePressEvent(QGraphicsSceneMouseEvent *event) { Pressed=true; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Pressed"; } void MySquare::mouseReleaseEvent(QGraphicsSceneMouseEvent *event) { Pressed=false; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Released"; } void MySquare::keyPressEvent(QKeyEvent *event){ int x = pos().x(); int y = pos().y(); //key handling QGraphicsItem::keyPressEvent(event); } void MySquare::dropEvent(QDropEvent *event) { qDebug("dropEvent - square"); // Unpack dropped data and handle it the way you want qDebug("Contents: %s", event->mimeData()->text().toLatin1().data()); } void MySquare::dragMoveEvent(QDragMoveEvent *event){ qDebug("dragMoveEvent - square "); event->accept(); } void MySquare::dragEnterEvent(QDragEnterEvent *event){ event->setAccepted(true); qDebug("dragEnterEvent - square"); event->acceptProposedAction(); } void MySquare::setBrush(QColor _color){ color = _color; color_pressed = _color; update(); //repaint } edit; there is no problem with qDebug() i'm just using it to test them i'm inside the drag events..which i'm not

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Need help on Coda slider tabs to move inside an overflow:hidden div

    - by Reden
    I'm not too good at javascript. and hope I can get a bit of help. I'm using Coda Slider 2.0, and have designed it to where the tabs are another slider to the right of the main slider, and each item. Basically like this mootools plugin http://landofcoder.com/demo/mootool/lofslidernews/index2.1.html Problem is the items will not scroll. How do I make the items (or tabs to the right) scroll down as the slider rotates? Otherwise the slider will show the 4th slide but not scroll to the 4th item on the right, but Thanks everyone. Here is the Coda-Slider plugin: // when the DOM is ready... $(document).ready(function () { var $panels = $('#slider .scrollContainer > div'); var $container = $('#slider .scrollContainer'); // if false, we'll float all the panels left and fix the width // of the container var horizontal = true; // float the panels left if we're going horizontal if (horizontal) { $panels.css({ 'float' : 'left', 'position' : 'relative' // IE fix to ensure overflow is hidden }); // calculate a new width for the container (so it holds all panels) $container.css('width', $panels[0].offsetWidth * $panels.length); } // collect the scroll object, at the same time apply the hidden overflow // to remove the default scrollbars that will appear var $scroll = $('#slider .scroll').css('overflow', 'hidden'); // apply our left + right buttons $scroll .before('<img class="scrollButtons left" src="images/scroll_left.png" />') .after('<img class="scrollButtons right" src="images/scroll_right.png" />'); // handle nav selection function selectNav() { $(this) .parents('ul:first') .find('a') .removeClass('selected') .end() .end() .addClass('selected'); } $('#slider .navigation').find('a').click(selectNav); // go find the navigation link that has this target and select the nav function trigger(data) { var el = $('#slider .navigation').find('a[href$="' + data.id + '"]').get(0); selectNav.call(el); } if (window.location.hash) { trigger({ id : window.location.hash.substr(1) }); } else { $('ul.navigation a:first').click(); } // offset is used to move to *exactly* the right place, since I'm using // padding on my example, I need to subtract the amount of padding to // the offset. Try removing this to get a good idea of the effect var offset = parseInt((horizontal ? $container.css('paddingTop') : $container.css('paddingLeft')) || 0) * -1; var scrollOptions = { target: $scroll, // the element that has the overflow // can be a selector which will be relative to the target items: $panels, navigation: '.navigation a', // selectors are NOT relative to document, i.e. make sure they're unique prev: 'img.left', next: 'img.right', // allow the scroll effect to run both directions axis: 'xy', onAfter: trigger, // our final callback offset: offset, // duration of the sliding effect duration: 500, // easing - can be used with the easing plugin: // http://gsgd.co.uk/sandbox/jquery/easing/ easing: 'swing' }; // apply serialScroll to the slider - we chose this plugin because it // supports// the indexed next and previous scroll along with hooking // in to our navigation. $('#slider').serialScroll(scrollOptions); // now apply localScroll to hook any other arbitrary links to trigger // the effect $.localScroll(scrollOptions); // finally, if the URL has a hash, move the slider in to position, // setting the duration to 1 because I don't want it to scroll in the // very first page load. We don't always need this, but it ensures // the positioning is absolutely spot on when the pages loads. scrollOptions.duration = 1; $.localScroll.hash(scrollOptions); /////////////////////////////////////////////// // autoscroll /////////////////////////////////////////////// // start to automatically cycle the tabs cycleTimer = setInterval(function () { $scroll.trigger('next'); }, 2000); // how many milliseconds, change this to whatever you like // select some trigger elements to stop the auto-cycle var $stopTriggers = $('#slider .navigation').find('a') // tab headers .add('.scroll') // panel itself .add('.stopscroll') // links to the stop class div .add('.navigation') // links to navigation id for tabs .add("a[href^='#']"); // links to a tab // this is the function that will stop the auto-cycle function stopCycle() { // remove the no longer needed stop triggers clearInterval(cycleTimer); // stop the auto-cycle itself $buttons.show(); // show the navigation buttons document.getElementById('stopscroll').style.display='none'; // hide the stop div document.getElementById('startscroll').style.display='block'; // block the start div } // bind stop cycle function to the click event using namespaces $stopTriggers.bind('click.cycle', stopCycle); /////////////////////////////////////////////// // end autoscroll /////////////////////////////////////////////// // edit to start again /////////////////////////////////////////////// // select some trigger elements to stop the auto-cycle var $startTriggers_start = $('#slider .navigation').find('a') // tab headers .add('.startscroll'); // links to the start class div // this is the function that will stop the auto-cycle function startCycle() { // remove the no longer needed stop triggers $buttons.hide(); // show the navigation buttons $scroll.trigger('next'); // directly to the next first cycleTimer = setInterval(function () { // now set timer again $scroll.trigger('next'); }, 5000); // how many milliseconds, change this to whatever you like document.getElementById('stopscroll').style.display='block'; // block the stop div document.getElementById('startscroll').style.display='none'; // hide the start div } // bind stop cycle function to the click event using namespaces $startTriggers_start.bind('click.cycle', startCycle); /////////////////////////////////////////////// // end edit to start /////////////////////////////////////////////// });

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Problem with entityForName & ManagedObjectContext when extending tutorial material

    - by Martin KS
    Afternoon all, I tried to add a second data entity to the persistent store in the (locations) coredata tutorial code, and then access this in a new view. I think that I've followed the tutorial, and checked that I'm doing a clean build etc, but can't see what to change to prevent it crashing. I'm afraid I'm at my wits end with this one, and can't seem to find the step that I've missed. I've pasted the header and code files below, please let me know if I need to share any more of the code. The crash seems to happen on the line: NSEntityDescription *entity = [NSEntityDescription entityForName:@"Album" inManagedObjectContext:[self managedObjectContext]]; There is one other line in the code that refers to galleryviewcontroller at the moment, and that's in the main application delegate: galleryViewController.managedObjectContext = [self managedObjectContext]; GalleryViewController.h #import <UIKit/UIKit.h> @interface GalleryViewController : UIViewController { NSManagedObjectContext *managedObjectContext; int rowNumber; IBOutlet UILabel *lblMessage; UIBarButtonItem *addButton; NSMutableArray *imagesArray; } @property (readwrite) int rowNumber; @property (nonatomic,retain) UILabel *lblMessage; @property (nonatomic,retain) NSMutableArray *imagesArray; @property (nonatomic, retain) NSManagedObjectContext *managedObjectContext; @property (nonatomic, retain) UIBarButtonItem *addButton; -(void)updateRowNumber:(int)theIndex; -(void)addImage; @end GalleryViewController.m #import "RootViewController.h" #import "LocationsAppDelegate.h" #import "Album.h" #import "GalleryViewController.h" #import "Image.h" @implementation GalleryViewController @synthesize lblMessage,rowNumber,addButton,managedObjectContext; @synthesize imagesArray; /* // The designated initializer. Override if you create the controller programmatically and want to perform customization that is not appropriate for viewDidLoad. - (id)initWithNibName:(NSString *)nibNameOrNil bundle:(NSBundle *)nibBundleOrNil { if ((self = [super initWithNibName:nibNameOrNil bundle:nibBundleOrNil])) { // Custom initialization } return self; } */ -(void)updateRowNumber:(int)theIndex{ rowNumber=theIndex; LocationsAppDelegate *mainDelegate =(LocationsAppDelegate *)[[UIApplication sharedApplication] delegate]; Album *anAlbum = [mainDelegate.albumsArray objectAtIndex:rowNumber]; lblMessage.text = anAlbum.uniqueAlbumIdentifier; } // Implement viewDidLoad to do additional setup after loading the view, typically from a nib. - (void)viewDidLoad { [super viewDidLoad]; addButton = [[UIBarButtonItem alloc] initWithBarButtonSystemItem:UIBarButtonSystemItemAdd target:self action:@selector(addImage)]; addButton.enabled = YES; self.navigationItem.rightBarButtonItem = addButton; /* Found this in another answer, adding it to the code didn't help. if (managedObjectContext == nil) { managedObjectContext = [[[UIApplication sharedApplication] delegate] managedObjectContext]; } */ NSFetchRequest *request = [[NSFetchRequest alloc] init]; NSEntityDescription *entity = [NSEntityDescription entityForName:@"Album" inManagedObjectContext:[self managedObjectContext]]; [request setEntity:entity]; // Order the albums by creation date, most recent first. NSSortDescriptor *sortDescriptor = [[NSSortDescriptor alloc] initWithKey:@"imagePath" ascending:NO]; NSArray *sortDescriptors = [[NSArray alloc] initWithObjects:sortDescriptor, nil]; [request setSortDescriptors:sortDescriptors]; [sortDescriptor release]; [sortDescriptors release]; // Execute the fetch -- create a mutable copy of the result. NSError *error = nil; NSMutableArray *mutableFetchResults = [[managedObjectContext executeFetchRequest:request error:&error] mutableCopy]; if (mutableFetchResults == nil) { // Handle the error. } [self setImagesArray:mutableFetchResults]; int a = 5; int b = 10; for( int i=0; i<[imagesArray count]; i++ ) { if( a == 325 ) { a = 5; b += 70; } UIImageView *any = [[UIImageView alloc] initWithFrame:CGRectMake(a,b,70,60)]; any.image = [imagesArray objectAtIndex:i]; any.tag = i; [self.view addSubview:any]; [any release]; a += 80; } } -(void)addImage{ NSString *msg = [NSString stringWithFormat:@"%i",rowNumber]; UIAlertView *alert = [[UIAlertView alloc] initWithTitle:@"Add image to" message:msg delegate:self cancelButtonTitle:@"No" otherButtonTitles:@"Yes", nil]; [alert show]; [alert release]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { [super viewDidUnload]; } - (void)dealloc { [lblMessage release]; [managedObjectContext release]; [super dealloc]; } @end

    Read the article

  • Help needed with Javascript Variable Scope / OOP and Call Back Functions

    - by gargantaun
    I think this issue goes beyond typical variable scope and closure stuff, or maybe I'm an idiot. Here goes anyway... I'm creating a bunch of objects on the fly in a jQuery plugin. The object look something like this function WedgePath(canvas){ this.targetCanvas = canvas; this.label; this.logLabel = function(){ console.log(this.label) } } the jQuery plugin looks something like this (function($) { $.fn.myPlugin = function() { return $(this).each(function() { // Create Wedge Objects for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; globalFunction(i, newWedge]); } }); } })(jQuery); So... the plugin creates a bunch of wedgeObjects, then calls 'globalFunction' for each one, passing in the latest WedgePath instance. Global function looks like this. function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; targetWedge.logLabel(); } What happens next is that the console logs each wedges label correctly. However, I need a bit more complexity inside globalFunction. So it actually looks like this... function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; someSql = "SELECT * FROM myTable WHERE id = ?"; dbInterface.executeSql(someSql, [indicator_id], function(transaction, result){ targetWedge.logLabel(); }) } There's a lot going on here so i'll explain. I'm using client side database storage (WebSQL i call it). 'dbInterface' an instance of a simple javascript object I created which handles the basics of interacting with a client side database [shown at the end of this question]. the executeSql method takes up to 4 arguments The SQL String an optional arguments array an optional onSuccess handler an optional onError handler (not used in this example) What I need to happen is: When the WebSQL query has completed, it takes some of that data and manipulates some attribute of a particular wedge. But, when I call 'logLabel' on an instance of WedgePath inside the onSuccess handler, I get the label of the very last instance of WedgePath that was created way back in the plugin code. Now I suspect that the problem lies in the var newWedge = new WedgePath(canvas); line. So I tried pushing each newWedge into an array, which I thought would prevent that line from replacing or overwriting the WedgePath instance at every iteration... wedgeArray = []; // Inside the plugin... for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; wedgeArray.push(newWedge); } for(var i = 0; i < wedgeArray.length; i++){ wedgeArray[i].logLabel() } But again, I get the last instance of WedgePath to be created. This is driving me nuts. I apologise for the length of the question but I wanted to be as clear as possible. END ============================================================== Also, here's the code for dbInterface object should it be relevant. function DatabaseInterface(db){ var DB = db; this.sql = function(sql, arr, pSuccessHandler, pErrorHandler){ successHandler = (pSuccessHandler) ? pSuccessHandler : this.defaultSuccessHandler; errorHandler = (pErrorHandler) ? pErrorHandler : this.defaultErrorHandler; DB.transaction(function(tx){ if(!arr || arr.length == 0){ tx.executeSql(sql, [], successHandler, errorHandler); }else{ tx.executeSql(sql,arr, successHandler, errorHandler) } }); } // ---------------------------------------------------------------- // A Default Error Handler // ---------------------------------------------------------------- this.defaultErrorHandler = function(transaction, error){ // error.message is a human-readable string. // error.code is a numeric error code console.log('WebSQL Error: '+error.message+' (Code '+error.code+')'); // Handle errors here var we_think_this_error_is_fatal = true; if (we_think_this_error_is_fatal) return true; return false; } // ---------------------------------------------------------------- // A Default Success Handler // This doesn't do anything except log a success message // ---------------------------------------------------------------- this.defaultSuccessHandler = function(transaction, results) { console.log("WebSQL Success. Default success handler. No action taken."); } }

    Read the article

  • How should I change my Graph structure (very slow insertion)?

    - by Nazgulled
    Hi, This program I'm doing is about a social network, which means there are users and their profiles. The profiles structure is UserProfile. Now, there are various possible Graph implementations and I don't think I'm using the best one. I have a Graph structure and inside, there's a pointer to a linked list of type Vertex. Each Vertex element has a value, a pointer to the next Vertex and a pointer to a linked list of type Edge. Each Edge element has a value (so I can define weights and whatever it's needed), a pointer to the next Edge and a pointer to the Vertex owner. I have a 2 sample files with data to process (in CSV style) and insert into the Graph. The first one is the user data (one user per line); the second one is the user relations (for the graph). The first file is quickly inserted into the graph cause I always insert at the head and there's like ~18000 users. The second file takes ages but I still insert the edges at the head. The file has about ~520000 lines of user relations and takes between 13-15mins to insert into the Graph. I made a quick test and reading the data is pretty quickly, instantaneously really. The problem is in the insertion. This problem exists because I have a Graph implemented with linked lists for the vertices. Every time I need to insert a relation, I need to lookup for 2 vertices, so I can link them together. This is the problem... Doing this for ~520000 relations, takes a while. How should I solve this? Solution 1) Some people recommended me to implement the Graph (the vertices part) as an array instead of a linked list. This way I have direct access to every vertex and the insertion is probably going to drop considerably. But, I don't like the idea of allocating an array with [18000] elements. How practically is this? My sample data has ~18000, but what if I need much less or much more? The linked list approach has that flexibility, I can have whatever size I want as long as there's memory for it. But the array doesn't, how am I going to handle such situation? What are your suggestions? Using linked lists is good for space complexity but bad for time complexity. And using an array is good for time complexity but bad for space complexity. Any thoughts about this solution? Solution 2) This project also demands that I have some sort of data structures that allows quick lookup based on a name index and an ID index. For this I decided to use Hash Tables. My tables are implemented with separate chaining as collision resolution and when a load factor of 0.70 is reach, I normally recreate the table. I base the next table size on this http://planetmath.org/encyclopedia/GoodHashTablePrimes.html. Currently, both Hash Tables hold a pointer to the UserProfile instead of duplication the user profile itself. That would be stupid, changing data would require 3 changes and it's really dumb to do it that way. So I just save the pointer to the UserProfile. The same user profile pointer is also saved as value in each Graph Vertex. So, I have 3 data structures, one Graph and two Hash Tables and every single one of them point to the same exact UserProfile. The Graph structure will serve the purpose of finding the shortest path and stuff like that while the Hash Tables serve as quick index by name and ID. What I'm thinking to solve my Graph problem is to, instead of having the Hash Tables value point to the UserProfile, I point it to the corresponding Vertex. It's still a pointer, no more and no less space is used, I just change what I point to. Like this, I can easily and quickly lookup for each Vertex I need and link them together. This will insert the ~520000 relations pretty quickly. I thought of this solution because I already have the Hash Tables and I need to have them, then, why not take advantage of them for indexing the Graph vertices instead of the user profile? It's basically the same thing, I can still access the UserProfile pretty quickly, just go to the Vertex and then to the UserProfile. But, do you see any cons on this second solution against the first one? Or only pros that overpower the pros and cons on the first solution? Other Solution) If you have any other solution, I'm all ears. But please explain the pros and cons of that solution over the previous 2. I really don't have much time to be wasting with this right now, I need to move on with this project, so, if I'm doing to do such a change, I need to understand exactly what to change and if that's really the way to go. Hopefully no one fell asleep reading this and closed the browser, sorry for the big testament. But I really need to decide what to do about this and I really need to make a change. P.S: When answering my proposed solutions, please enumerate them as I did so I know exactly what are you talking about and don't confuse my self more than I already am.

    Read the article

  • Windows Impersonation failed

    - by skprocks
    I am using following code to implement impersonation for the particular windows account,which is failing.Please help. using System.Security.Principal; using System.Runtime.InteropServices; public partial class Source_AddNewProduct : System.Web.UI.Page { [DllImport("advapi32.dll", SetLastError = true)] static extern bool LogonUser( string principal, string authority, string password, LogonSessionType logonType, LogonProvider logonProvider, out IntPtr token); [DllImport("kernel32.dll", SetLastError = true)] static extern bool CloseHandle(IntPtr handle); enum LogonSessionType : uint { Interactive = 2, Network, Batch, Service, NetworkCleartext = 8, NewCredentials } enum LogonProvider : uint { Default = 0, // default for platform (use this!) WinNT35, // sends smoke signals to authority WinNT40, // uses NTLM WinNT50 // negotiates Kerb or NTLM } //impersonation is used when user tries to upload an image to a network drive protected void btnPrimaryPicUpload_Click1(object sender, EventArgs e) { try { string mDocumentExt = string.Empty; string mDocumentName = string.Empty; HttpPostedFile mUserPostedFile = null; HttpFileCollection mUploadedFiles = null; string xmlPath = string.Empty; FileStream fs = null; StreamReader file; string modify; mUploadedFiles = HttpContext.Current.Request.Files; mUserPostedFile = mUploadedFiles[0]; if (mUserPostedFile.ContentLength >= 0 && Path.GetFileName(mUserPostedFile.FileName) != "") { mDocumentName = Path.GetFileName(mUserPostedFile.FileName); mDocumentExt = Path.GetExtension(mDocumentName); mDocumentExt = mDocumentExt.ToLower(); if (mDocumentExt != ".jpg" && mDocumentExt != ".JPG" && mDocumentExt != ".gif" && mDocumentExt != ".GIF" && mDocumentExt != ".jpeg" && mDocumentExt != ".JPEG" && mDocumentExt != ".tiff" && mDocumentExt != ".TIFF" && mDocumentExt != ".png" && mDocumentExt != ".PNG" && mDocumentExt != ".raw" && mDocumentExt != ".RAW" && mDocumentExt != ".bmp" && mDocumentExt != ".BMP" && mDocumentExt != ".TIF" && mDocumentExt != ".tif") { Page.RegisterStartupScript("select", "<script language=" + Convert.ToChar(34) + "VBScript" + Convert.ToChar(34) + "> MsgBox " + Convert.ToChar(34) + "Please upload valid picture file format" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "64" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "WFISware" + Convert.ToChar(34) + "</script>"); } else { int intDocLen = mUserPostedFile.ContentLength; byte[] imageBytes = new byte[intDocLen]; mUserPostedFile.InputStream.Read(imageBytes, 0, mUserPostedFile.ContentLength); //xmlPath = @ConfigurationManager.AppSettings["ImagePath"].ToString(); xmlPath = Server.MapPath("./../ProductImages/"); mDocumentName = Guid.NewGuid().ToString().Replace("-", "") + System.IO.Path.GetExtension(mUserPostedFile.FileName); //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".jpg") //{ //} //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".gif") //{ //} mUserPostedFile.SaveAs(xmlPath + mDocumentName); //Remove commenting till upto stmt xmlPath = "./../ProductImages/"; to implement impersonation byte[] bytContent; IntPtr token = IntPtr.Zero; WindowsImpersonationContext impersonatedUser = null; try { // Note: Credentials should be encrypted in configuration file bool result = LogonUser(ConfigurationManager.AppSettings["ServiceAccount"].ToString(), "ad-ent", ConfigurationManager.AppSettings["ServiceAccountPassword"].ToString(), LogonSessionType.Network, LogonProvider.Default, out token); if (result) { WindowsIdentity id = new WindowsIdentity(token); // Begin impersonation impersonatedUser = id.Impersonate(); mUserPostedFile.SaveAs(xmlPath + mDocumentName); } else { throw new Exception("Identity impersonation has failed."); } } catch { throw; } finally { // Stop impersonation and revert to the process identity if (impersonatedUser != null) impersonatedUser.Undo(); // Free the token if (token != IntPtr.Zero) CloseHandle(token); } xmlPath = "./../ProductImages/"; xmlPath = xmlPath + mDocumentName; string o_image = xmlPath; //For impersoantion uncomment this line and comment next line //string o_image = "../ProductImages/" + mDocumentName; ViewState["masterImage"] = o_image; //fs = new FileStream(xmlPath, FileMode.Open, FileAccess.Read); //file = new StreamReader(fs, Encoding.UTF8); //modify = file.ReadToEnd(); //file.Close(); //commented by saurabh kumar 28may'09 imgImage.Visible = true; imgImage.ImageUrl = ViewState["masterImage"].ToString(); img_Label1.Visible = false; } //e.Values["TemplateContent"] = modify; //e.Values["TemplateName"] = mDocumentName.Replace(".xml", ""); } } catch (Exception ex) { ExceptionUtil.UI(ex); Response.Redirect("errorpage.aspx"); } } } The code on execution throws system.invalidoperation exception.I have provided full control to destination folder to the windows service account that i am impersonating.

    Read the article

  • The Tab1.java from API Demo has exception.

    - by Kooper
    I don't know why.All my Tab programs have exception.Even from API Demo. Here is the code: package com.example.android.apis.view; import android.app.TabActivity; import android.os.Bundle; import android.widget.TabHost; import android.widget.TabHost.TabSpec; import android.view.LayoutInflater; import android.view.View; public class Tab1 extends TabActivity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); TabHost tabHost = getTabHost(); LayoutInflater.from(this).inflate(R.layout.main,tabHost.getTabContentView(), true); tabHost.addTab(tabHost.newTabSpec("tab1") .setIndicator("tab1") .setContent(R.id.view1)); tabHost.addTab(tabHost.newTabSpec("tab2") .setIndicator("tab2") .setContent(R.id.view2)); tabHost.addTab(tabHost.newTabSpec("tab3") .setIndicator("tab3") .setContent(R.id.view3)); } } Here is the log: 06-13 17:24:38.336: WARN/jdwp(262): Debugger is telling the VM to exit with code=1 06-13 17:24:38.336: INFO/dalvikvm(262): GC lifetime allocation: 2511 bytes 06-13 17:24:38.416: DEBUG/Zygote(30): Process 262 exited cleanly (1) 06-13 17:24:38.456: INFO/ActivityManager(54): Process com.example.android.apis.view (pid 262) has died. 06-13 17:24:38.696: INFO/UsageStats(54): Unexpected resume of com.android.launcher while already resumed in com.example.android.apis.view 06-13 17:24:38.736: WARN/InputManagerService(54): Window already focused, ignoring focus gain of: com.android.internal.view.IInputMethodClient$Stub$Proxy@44dc4b38 06-13 17:24:48.337: DEBUG/AndroidRuntime(269): AndroidRuntime START <<<<<<<<<<<<<< 06-13 17:24:48.346: DEBUG/AndroidRuntime(269): CheckJNI is ON 06-13 17:24:48.856: DEBUG/AndroidRuntime(269): --- registering native functions --- 06-13 17:24:49.596: DEBUG/ddm-heap(269): Got feature list request 06-13 17:24:50.576: DEBUG/AndroidRuntime(269): Shutting down VM 06-13 17:24:50.576: DEBUG/dalvikvm(269): DestroyJavaVM waiting for non-daemon threads to exit 06-13 17:24:50.576: DEBUG/dalvikvm(269): DestroyJavaVM shutting VM down 06-13 17:24:50.576: DEBUG/dalvikvm(269): HeapWorker thread shutting down 06-13 17:24:50.586: DEBUG/dalvikvm(269): HeapWorker thread has shut down 06-13 17:24:50.586: DEBUG/jdwp(269): JDWP shutting down net... 06-13 17:24:50.586: INFO/dalvikvm(269): Debugger has detached; object registry had 1 entries 06-13 17:24:50.596: ERROR/AndroidRuntime(269): ERROR: thread attach failed 06-13 17:24:50.606: DEBUG/dalvikvm(269): VM cleaning up 06-13 17:24:50.676: DEBUG/dalvikvm(269): LinearAlloc 0x0 used 628628 of 5242880 (11%) 06-13 17:24:51.476: DEBUG/AndroidRuntime(278): AndroidRuntime START <<<<<<<<<<<<<< 06-13 17:24:51.486: DEBUG/AndroidRuntime(278): CheckJNI is ON 06-13 17:24:51.986: DEBUG/AndroidRuntime(278): --- registering native functions --- 06-13 17:24:52.746: DEBUG/ddm-heap(278): Got feature list request 06-13 17:24:53.716: DEBUG/ActivityManager(54): Uninstalling process com.example.android.apis.view 06-13 17:24:53.726: INFO/ActivityManager(54): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.example.android.apis.view/.Tab1 } 06-13 17:24:53.876: DEBUG/AndroidRuntime(278): Shutting down VM 06-13 17:24:53.886: DEBUG/dalvikvm(278): DestroyJavaVM waiting for non-daemon threads to exit 06-13 17:24:53.916: DEBUG/dalvikvm(278): DestroyJavaVM shutting VM down 06-13 17:24:53.926: DEBUG/dalvikvm(278): HeapWorker thread shutting down 06-13 17:24:53.936: DEBUG/dalvikvm(278): HeapWorker thread has shut down 06-13 17:24:53.936: DEBUG/jdwp(278): JDWP shutting down net... 06-13 17:24:53.936: INFO/dalvikvm(278): Debugger has detached; object registry had 1 entries 06-13 17:24:53.957: DEBUG/dalvikvm(278): VM cleaning up 06-13 17:24:54.026: ERROR/AndroidRuntime(278): ERROR: thread attach failed 06-13 17:24:54.146: DEBUG/dalvikvm(278): LinearAlloc 0x0 used 638596 of 5242880 (12%) 06-13 17:24:54.286: INFO/ActivityManager(54): Start proc com.example.android.apis.view for activity com.example.android.apis.view/.Tab1: pid=285 uid=10054 gids={1015} 06-13 17:24:54.676: DEBUG/ddm-heap(285): Got feature list request 06-13 17:24:55.006: WARN/ActivityThread(285): Application com.example.android.apis.view is waiting for the debugger on port 8100... 06-13 17:24:55.126: INFO/System.out(285): Sending WAIT chunk 06-13 17:24:55.186: INFO/dalvikvm(285): Debugger is active 06-13 17:24:55.378: INFO/System.out(285): Debugger has connected 06-13 17:24:55.386: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.586: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.796: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.996: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.196: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.406: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.606: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.806: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.016: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.216: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.416: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.626: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.836: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.039: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.246: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.451: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.656: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.866: INFO/System.out(285): debugger has settled (1367) 06-13 17:24:59.126: ERROR/gralloc(54): [unregister] handle 0x129980 still locked (state=40000001) 06-13 17:25:03.816: WARN/ActivityManager(54): Launch timeout has expired, giving up wake lock! 06-13 17:25:04.906: WARN/ActivityManager(54): Activity idle timeout for HistoryRecord{44d60e10 com.example.android.apis.view/.Tab1}

    Read the article

  • Help required in adding new methods, properties into existing classes dynamically

    - by Bepenfriends
    Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

    Read the article

  • Perl LWP::UserAgent mishandling UTF-8 response

    - by RedGrittyBrick
    When I use LWP::UserAgent to retrieve content encoded in UTF-8 it seems LWP::UserAgent doesn't handle the encoding correctly. Here's the output after setting the Command Prompt window to Unicode by the command chcp 65001 Note that this initially gives the appearance that all is well, but I think it's just the shell reassembling bytes and decoding UTF-8, From the other output you can see that perl itself is not handling wide characters correctly. C:\perl getutf8.pl ====================================================================== HTTP/1.1 200 OK Connection: close Date: Fri, 31 Dec 2010 19:24:04 GMT Accept-Ranges: bytes Server: Apache/2.2.8 (Win32) PHP/5.2.6 Content-Length: 75 Content-Type: application/xml; charset=utf-8 Last-Modified: Fri, 31 Dec 2010 19:20:18 GMT Client-Date: Fri, 31 Dec 2010 19:24:04 GMT Client-Peer: 127.0.0.1:80 Client-Response-Num: 1 <?xml version="1.0" encoding="UTF-8"? <nameBudejovický Budvar</name ====================================================================== response content length is 33 ....v....1....v....2....v....3....v....4 <nameBudejovický Budvar</name . . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . 3c6e616d653e427564c49b6a6f7669636bc3bd204275647661723c2f6e616d653e < n a m e B u d ? ? j o v i c k ? ? B u d v a r < / n a m e Above you can see the payload length is 31 characters but Perl thinks it is 33. For confirmation, in the hex, we can see that the UTF-8 sequences c49b and c3bd are being interpreted as four separate characters and not as two Unicode characters. Here's the code #!perl use strict; use warnings; use LWP::UserAgent; my $ua = LWP::UserAgent-new(); my $response = $ua-get('http://localhost/Bud.xml'); if (! $response-is_success) { die $response-status_line; } print '='x70,"\n",$response-as_string(), '='x70,"\n"; my $r = $response-decoded_content((charset = 'UTF-8')); $/ = "\x0d\x0a"; # seems to be \x0a otherwise! chomp($r); # Remove any xml prologue $r =~ s/^<\?.*\?\x0d\x0a//; print "Response content length is ", length($r), "\n\n"; print "....v....1....v....2....v....3....v....4\n"; print $r,"\n"; print ". . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . \n"; print unpack("H*", $r), "\n"; print join(" ", split("", $r)), "\n"; Note that Bud.xml is UTF-8 encoded without a BOM. How can I persuade LWP::UserAgent to do the right thing? P.S. Ultimately I want to translate the Unicode data into an ASCII encoding, even if it means replacing each non-ASCII character with one question mark or other marker. I have accepted Ysth's "upgrade" answer - because I know it is the right thing to do when possible. However I am going to use a work-around (which may depress Tom further): $r = encode("cp437", decode("utf8", $r));

    Read the article

  • Is there a better way to avoid an infinite loop using winforms?

    - by Hamish Grubijan
    I am using .Net 3.5 for now. Right now I am using a using trick to disable and enable events around certain sections of code. The user can change either days, hours, minutes or total minutes, and that should not cause an infinite cascade of events (e.g. minutes changing total, total changing minutes, etc.) While the code does what I want, there might be a better / more straight-forward way. Do you know of any? For brawny points: This control will be used by multiple teams - I do not want to make it embarrassing. I suspect that I do not need to reinvent the wheel when defining hours in a day, days in week, etc. Some other standard .Net library out there must have it. Any other remarks regarding code? This using (EventHacker.DisableEvents(this)) business - that must be a common pattern in .Net ... changing the setting temporarily. What is the name of it? I'd like to be able to refer to it in a comment and also read up more on current implementations. In the general case not only a handle to the thing being changed needs to be remembered, but also the previous state (in this case previous state does not matter - events are turned on and off unconditionally). Then there is also a possibility of multi-threaded hacking. One could also utilize generics to make the code arguably cleaner. Figuring all this out can lead to a multi-page blog post. I'd be happy to hear some of the answers. P.S. Does it seem like I suffer from obsessive compulsive disorder? Some people like to get things finished and move on; I like to keep them open ... there is always a better way. // Corresponding Designer class is omitted. using System; using System.Windows.Forms; namespace XYZ // Real name masked { interface IEventHackable { void EnableEvents(); void DisableEvents(); } public partial class PollingIntervalGroupBox : GroupBox, IEventHackable { private const int DAYS_IN_WEEK = 7; private const int MINUTES_IN_HOUR = 60; private const int HOURS_IN_DAY = 24; private const int MINUTES_IN_DAY = MINUTES_IN_HOUR * HOURS_IN_DAY; private const int MAX_TOTAL_DAYS = 100; private static readonly decimal MIN_TOTAL_NUM_MINUTES = 1; // Anything faster than once per minute can bog down our servers. private static readonly decimal MAX_TOTAL_NUM_MINUTES = (MAX_TOTAL_DAYS * MINUTES_IN_DAY) - 1; // 99 days should be plenty. // The value above was chosen so to not cause an overflow exception. // Watch out for it - numericUpDownControls each have a MaximumValue setting. public PollingIntervalGroupBox() { InitializeComponent(); InitializeComponentCustom(); } private void InitializeComponentCustom() { this.m_upDownDays.Maximum = MAX_TOTAL_DAYS - 1; this.m_upDownHours.Maximum = HOURS_IN_DAY - 1; this.m_upDownMinutes.Maximum = MINUTES_IN_HOUR - 1; this.m_upDownTotalMinutes.Maximum = MAX_TOTAL_NUM_MINUTES; this.m_upDownTotalMinutes.Minimum = MIN_TOTAL_NUM_MINUTES; } private void m_upDownTotalMinutes_ValueChanged(object sender, EventArgs e) { setTotalMinutes(this.m_upDownTotalMinutes.Value); } private void m_upDownDays_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownHours_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownMinutes_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void updateTotalMinutes() { this.setTotalMinutes( MINUTES_IN_DAY * m_upDownDays.Value + MINUTES_IN_HOUR * m_upDownHours.Value + m_upDownMinutes.Value); } public decimal TotalMinutes { get { return m_upDownTotalMinutes.Value; } set { m_upDownTotalMinutes.Value = value; } } public decimal TotalHours { set { setTotalMinutes(value * MINUTES_IN_HOUR); } } public decimal TotalDays { set { setTotalMinutes(value * MINUTES_IN_DAY); } } public decimal TotalWeeks { set { setTotalMinutes(value * DAYS_IN_WEEK * MINUTES_IN_DAY); } } private void setTotalMinutes(decimal nTotalMinutes) { if (nTotalMinutes < MIN_TOTAL_NUM_MINUTES) { setTotalMinutes(MIN_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } if (nTotalMinutes > MAX_TOTAL_NUM_MINUTES) { setTotalMinutes(MAX_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } using (EventHacker.DisableEvents(this)) { // First set the total minutes this.m_upDownTotalMinutes.Value = nTotalMinutes; // Then set the rest this.m_upDownDays.Value = (int)(nTotalMinutes / MINUTES_IN_DAY); nTotalMinutes = nTotalMinutes % MINUTES_IN_DAY; // variable reuse. this.m_upDownHours.Value = (int)(nTotalMinutes / MINUTES_IN_HOUR); nTotalMinutes = nTotalMinutes % MINUTES_IN_HOUR; this.m_upDownMinutes.Value = nTotalMinutes; } } // Event magic public void EnableEvents() { this.m_upDownTotalMinutes.ValueChanged += this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged += this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged += this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged += this.m_upDownMinutes_ValueChanged; } public void DisableEvents() { this.m_upDownTotalMinutes.ValueChanged -= this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged -= this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged -= this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged -= this.m_upDownMinutes_ValueChanged; } // We give as little info as possible to the 'hacker'. private sealed class EventHacker : IDisposable { IEventHackable _hackableHandle; public static IDisposable DisableEvents(IEventHackable hackableHandle) { return new EventHacker(hackableHandle); } public EventHacker(IEventHackable hackableHandle) { this._hackableHandle = hackableHandle; this._hackableHandle.DisableEvents(); } public void Dispose() { this._hackableHandle.EnableEvents(); } } } }

    Read the article

  • SOLR date faceting and BC / BCE dates / negative date ranges

    - by Nigel_V_Thomas
    Date ranges including BC dates is this possible? I would like to return facets for all years between 11000 BCE (BC) and 9000 BCE (BC) using SOLR. A sample query might be with date ranges converted to ISO 8601: q=*:*&facet.date=myfield_earliestDate&facet.date.end=-92009-01-01T00:00:00&facet.date.gap=%2B1000YEAR&facet.date.other=all&facet=on&f.myfield_earliestDate.facet.date.start=-112009-01-01T00:00:00 However the returned results seem to be suggest that dates are in positive range, ie CE, not BCE... see sample returned results <response> <lst name="responseHeader"> <int name="status">0</int> <int name="QTime">6</int> <lst name="params"> <str name="f.vra.work.creation.earliestDate.facet.date.start">-112009-01-01T00:00:00Z</str> <str name="facet">on</str> <str name="q">*:*</str> <str name="facet.date">vra.work.creation.earliestDate</str> <str name="facet.date.gap">+1000YEAR</str> <str name="facet.date.other">all</str> <str name="facet.date.end">-92009-01-01T00:00:00Z</str> </lst> </lst> <result name="response" numFound="9556" start="0">ommitted</result> <lst name="facet_counts"> <lst name="facet_queries"/> <lst name="facet_fields"/> <lst name="facet_dates"> <lst name="vra.work.creation.earliestDate"> <int name="112010-01-01T00:00:00Z">0</int> <int name="111010-01-01T00:00:00Z">0</int> <int name="110010-01-01T00:00:00Z">0</int> <int name="109010-01-01T00:00:00Z">0</int> <int name="108010-01-01T00:00:00Z">0</int> <int name="107010-01-01T00:00:00Z">0</int> <int name="106010-01-01T00:00:00Z">0</int> <int name="105010-01-01T00:00:00Z">0</int> <int name="104010-01-01T00:00:00Z">0</int> <int name="103010-01-01T00:00:00Z">0</int> <int name="102010-01-01T00:00:00Z">0</int> <int name="101010-01-01T00:00:00Z">0</int> <int name="100010-01-01T00:00:00Z">5781</int> <int name="99010-01-01T00:00:00Z">0</int> <int name="98010-01-01T00:00:00Z">0</int> <int name="97010-01-01T00:00:00Z">0</int> <int name="96010-01-01T00:00:00Z">0</int> <int name="95010-01-01T00:00:00Z">0</int> <int name="94010-01-01T00:00:00Z">0</int> <int name="93010-01-01T00:00:00Z">0</int> <str name="gap">+1000YEAR</str> <date name="end">92010-01-01T00:00:00Z</date> <int name="before">224</int> <int name="after">0</int> <int name="between">5690</int> </lst> </lst> </lst> </response> Any ideas why this is the case, can solr handle negative dates such as -112009-01-01T00:00:00Z?

    Read the article

  • Update table rows in a non-sequential way using the output of a php script

    - by moviemaniac
    Good evening everybody, this is my very first question and I hope I've done my search in stack's archive at best!!! I need to monitor several devices by querying theyr mysql database and gather some informations. Then these informations are presented to the operator in an html table. I have wrote a php script wich loads devices from a multidimensional array, loops through the array and gather data and create the table. The table structure is the following: <table id="monitoring" class="rt cf"> <thead class="cf"> <tr> <th>Device</th> <th>Company</th> <th>Data1</th> <th>Data2</th> <th>Data3</th> <th>Data4</th> <th>Data5</th> <th>Data6</th> <th>Data7</th> <th>Data8</th> <th>Data9</th> </tr> </thead> <tbody> <tr id="Device1"> <td>Devide 1 name</td> <td>xx</td> <td><img src="/path_to_images/ajax_loader.gif" width="24px" /></td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> </tr> <tr id="Device2"> <td>Devide 1 name</td> <td>xx</td> <td><img src="/path_to_images/ajax_loader.gif" width="24px" /></td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> </tr> <tr id="DeviceN"> <td>Devide 1 name</td> <td>xx</td> <td><img src="/path_to_images/ajax_loader.gif" width="24px" /></td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> </tr> </tbody> </table> The above table is directly populated when I first load the page; then, with a very simple function, i update this table every minute without reloading the page: <script> var auto_refresh = setInterval( function() { jQuery("#monitoring").load('/overview.php').fadeIn("slow"); var UpdateTime= new Date(); var StrUpdateTime; StrUpdateTime= ('0' + UpdateTime.getHours()).slice(-2) + ':' + ('0' + UpdateTime.getMinutes()).slice(-2) + ':' + ('0' + UpdateTime.getSeconds()).slice(-2); jQuery("#progress").text("Updated on: " + StrUpdateTime); }, 60000); </script> The above code runs in a wordpress environment. It comes out that when devices are too much and internet connection is not that fast, the script times out, even if i dramatically increase the timeout period. So it is impossible even to load the page the first time... Therefore I would like to change my code so that I can handle each row as a single entity, with its own refresh period. So when the user first loads the page, he sees n rows (one per device) with the ajax loader image... then an update cycle should start independently for each row, so that the user sees data gathered from each database... then ajax loader when the script is trying to retrieve data, then the gathered data once it has been collected or an error message stating that it is not possible to gather data since hour xx:yy:zz. So rows updating should be somewhat independent from the others, like if each row updating was a single closed process. So that rows updating is not done sequentially from the first row to the last. I hope I've sufficiently detailed my problem. Currently I feel like I am at a dead-end. Could someone please show me somewhere to start from?

    Read the article

  • how to click on a button in python

    - by Ciobanu Alexandru
    Trying to build some bot for clicking "skip-ad" button on a page. So far, i manage to use Mechanize to load a web-driver browser and to connect to some page but Mechanize module do not support js directly so now i need something like Selenium if i understand correct. I am also a beginner in programming so please be specific. How can i use Selenium or if there is any other solution, please explain details. This is the inner html code for the button: <a id="skip-ad" class="btn btn-inverse" onclick="open_url('http://imgur.com/gallery/tDK9V68', 'go'); return false;" style="font-weight: bold; " target="_blank" href="http://imgur.com/gallery/tDK9V68"> … </a> And this is my source so far: #!/usr/bin/python # FILENAME: test.py import mechanize import os, time from random import choice, randrange prox_list = [] #list of common UAS to apply to each connection attempt to impersonate browsers user_agent_strings = [ 'Mozilla/5.0 (Windows NT 6.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/28.0.1468.0 Safari/537.36', 'Mozilla/5.0 (X11; U; Linux i686; en-US; rv:1.9.0.1) Gecko/2008071615 Fedora/3.0.1-1.fc9 Firefox/3.0.1', 'Opera/9.80 (Windows NT 6.0) Presto/2.12.388 Version/12.14', 'Opera/9.80 (Macintosh; Intel Mac OS X 10.6.8; U; fr) Presto/2.9.168 Version/11.52', 'Mozilla/5.0 (Windows NT 6.1; Win64; x64; rv:23.0) Gecko/20131011 Firefox/23.0', 'Mozilla/5.0 (compatible; MSIE 9.0; Windows NT 6.1; WOW64; Trident/5.0; SLCC2; Media Center PC 6.0; InfoPath.3; MS-RTC LM 8; Zune 4.7', 'Mozilla/5.0 (compatible; MSIE 9.0; Windows NT 6.1; Win64; x64; Trident/5.0; .NET CLR 2.0.50727; SLCC2; .NET CLR 3.5.30729; .NET CLR 3.0.30729; Media Center PC 6.0; Zune 4.0; Tablet PC 2.0; InfoPath.3; .NET4.0C; .NET4.0E)', 'Mozilla/5.0 (compatible; MSIE 10.6; Windows NT 6.1; Trident/5.0; InfoPath.2; SLCC1; .NET CLR 3.0.4506.2152; .NET CLR 3.5.30729; .NET CLR 2.0.50727) 3gpp-gba UNTRUSTED/1.0', 'Mozilla/5.0 (compatible; MSIE 9.0; Windows NT 6.0; Trident/5.0; chromeframe/11.0.696.57)', 'Mozilla/5.0 (compatible; MSIE 8.0; Windows NT 6.0; Trident/4.0; InfoPath.1; SV1; .NET CLR 3.8.36217; WOW64; en-US)', 'Mozilla/5.0 (compatible; MSIE 8.0; Windows NT 6.1; Trident/4.0; GTB7.4; InfoPath.2; SV1; .NET CLR 3.3.69573; WOW64; en-US)' ] def load_proxy_list(target): #loads and parses the proxy list file = open(target, 'r') count = 0 for line in file: prox_list.append(line) count += 1 print "Loaded " + str(count) + " proxies!" load_proxy_list('proxies.txt') #for i in range(1,(len(prox_list) - 1)): # depreceated for overloading for i in range(1,30): br = mechanize.Browser() #pick a random UAS to add some extra cover to the bot br.addheaders = [('User-agent', choice(user_agent_strings))] print "----------------------------------------------------" #This is bad internet ethics br.set_handle_robots(False) #choose a proxy proxy = choice(prox_list) br.set_proxies({"http": proxy}) br.set_debug_http(True) try: print "Trying connection with: " + str(proxy) #currently using: BTC CoinURL - Grooveshark Broadcast br.open("http://cur.lv/4czwj") print "Opened successfully!" #act like a nice little drone and view the ads sleep_time_on_link = randrange(17.0,34.0) time.sleep(sleep_time_on_link) except mechanize.HTTPError, e: print "Oops Request threw " + str(e.code) #future versions will handle codes properly, 404 most likely means # the ad-linker has noticed bot-traffic and removed the link # or the used proxy is terrible. We will either geo-locate # proxies beforehand and pick good hosts, or ditch the link # which is worse case scenario, account is closed because of botting except mechanize.URLError, e: print "Oops! Request was refused, blacklisting proxy!" + str(e) prox_list.remove(proxy) del br #close browser entirely #wait between 5-30 seconds like a good little human sleep_time = randrange(5.0, 30.0) print "Waiting for %.1f seconds like a good bot." % (sleep_time) time.sleep(sleep_time)

    Read the article

  • JTabbedPane: only first tab is drawn, the second is always empty (newbie Q)

    - by paul
    I created a very simple JTabbedPane by first creating an empty JTabbedPane object, then 2 JPanels that I later add. Each JPanel is holding a object that extends JButton and implements MouseListener. Each of these holds a different image loaded from a file; the image is held locally as a buffered image and as an image icon, etc., all of which works great. The point of all that is to allow resizing of the image when the button is resized (using getscaledinstance()), because the panel is resized, because the JTabbedPane is resized, etc., within the JFrame that holds everything. I override paintComponent() to accomplish this in the class that extends JButton. I am using MigLayout Manager, and all is well on that front controlling layout constraints, growing, filling, initial sizes, preferred sizes, etc. The images the buttons hold are of different sizes and proportions, but this caused no trouble before. Up until 2 days ago everything worked fairly well. I made some changes trying to tweak some resizing issues as I was picking up MigLayout manager. At the time I was playing around with setting various min, max, and preferred sizes using the methods provided for by the components, not the layout manager. I also fooled a bit with pack(), validate(), visible(), opaque() etc., and yes I read the article about Swing and AWT painting here: http://java.sun.com/products/jfc/tsc/articles/painting/ , and I switched to relying more and more on MigLayout. On an unrelated note, it appears JFrame's do not honor maxsize? Somehow, today, with and without using any of these methods provided by swing, with or without using MigLayout manager to handle some of these matters instead, I now have a JTabbedPane that correctly displays the FIRST JPanel I add, but NOT THE SECOND JPanel--which, while present as a tab--does not show when selected. I have switched the order of which panel is added first, and this still holds true regardless of which JPanel I add first, telling me the JPanels are ok, and the problem is most likely in the JTabbedPane. I click on the second tab, the JTabbedPane switches, but I have what appears to be a blank button in the JPanel. A few console system-out statements reveal the following: a) that the second panel and its button are constructed b) no mouse events are being captured when I click on where the second panel and button should reside, as if it didn't exist at that point; c) when I switch to the second tab, the overrided paintComponent() method of the button within that second JPanel is never called, so it is in fact never being painted despite the tab in which it resides becoming visible; d) the JTabbpedPane getComponentCount() returns a correct value of 2 after adding the 2nd panel; e) MigLayout manager actually rocks, but I digress... I cannot now revert to my older code, and despite my best efforts to undo whatever changes caused this, I cannot fix my new problem. I've commented out everything but the most essential calls: constructors for each object--with MigLayout; add() for placing the buttons on the panels using string-arguments appropriate for MigLayout; add() for placing the panels on the JTabbedPane, also with MigLayout string arguments; setting the default op on close for the JFrame; and setting the JFrame visible. This means I do not fiddle with optimization settings, double buffering settings, opaque settings, but leave them as default, and still, no fix; the second panel will not show itself. Each panel, I should add, when it is the first to be loaded, works fine, again re-affirming that the panels and buttons are themselves ok. Here is part of what I am doing: //Note: BuildaButton is a class that merely constructs my instances File f = new File("/foo.jpg"); button1 = new BuildaButton().BuildaButton(f).buildfoo1Button(); f = new File("/foo2.jpg"); button2 = new BuildaButton().BuildaButton(f).buildfoo2Button(); MigLayout ml = new MigLayout("wrap 1", "[fill, grow]0[fill, grow]", "[fill, grow]0[fill, grow]"); MigLayout ml2 = new MigLayout("wrap 2", "[fill, grow]5[fill, grow]", "[fill, grow]0[fill, grow]"); foo1panel = new JPanel(ml); foo1panel.add(button1, "w 234:945:, h 200:807:"); foo2panel = new JPanel(ml); foo2panel.add(button2, "w 186:752:, h 200:807:"); tabs.add("foo1", foo1panel); tabs.add("foo2", foo2panel); System.out.println("contents of tabs: " + tabs.getComponentCount() + " elements"); mainframe.setLayout(ml2); mainframe.setMinimumSize(new Dimension(850,800)); mainframe.add(tabs, "w 600:800:, h 780:780:"); //controlpanel is a still blank jpanel that holds nothing--it is a space holder for now & will be utilized mainframe.add(controlpanel, "w 200:200:200, h 780:780:"); mainframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); mainframe.setVisible(true); Thank you in advance for any help you can give.

    Read the article

  • Get the property, as a string, from an Expression<Func<TModel,TProperty>>

    - by Jaxidian
    I use some strongly-typed expressions that get serialized to allow my UI code to have strongly-typed sorting and searching expressions. These are of type Expression<Func<TModel,TProperty>> and are used as such: SortOption.Field = (p => p.FirstName);. I've gotten this working perfectly for this simple case. The code that I'm using for parsing the "FirstName" property out of there is actually reusing some existing functionality in a third-party product that we use and it works great, until we start working with deeply-nested properties(SortOption.Field = (p => p.Address.State.Abbreviation);). This code has some very different assumptions in the need to support deeply-nested properties. As for what this code does, I don't really understand it and rather than changing that code, I figured I should just write from scratch this functionality. However, I don't know of a good way to do this. I suspect we can do something better than doing a ToString() and performing string parsing. So what's a good way to do this to handle the trivial and deeply-nested cases? Requirements: Given the expression p => p.FirstName I need a string of "FirstName". Given the expression p => p.Address.State.Abbreviation I need a string of "Address.State.Abbreviation" While it's not important for an answer to my question, I suspect my serialization/deserialization code could be useful to somebody else who finds this question in the future, so it is below. Again, this code is not important to the question - I just thought it might help somebody. Note that DynamicExpression.ParseLambda comes from the Dynamic LINQ stuff and Property.PropertyToString() is what this question is about. /// <summary> /// This defines a framework to pass, across serialized tiers, sorting logic to be performed. /// </summary> /// <typeparam name="TModel">This is the object type that you are filtering.</typeparam> /// <typeparam name="TProperty">This is the property on the object that you are filtering.</typeparam> [Serializable] public class SortOption<TModel, TProperty> : ISerializable where TModel : class { /// <summary> /// Convenience constructor. /// </summary> /// <param name="property">The property to sort.</param> /// <param name="isAscending">Indicates if the sorting should be ascending or descending</param> /// <param name="priority">Indicates the sorting priority where 0 is a higher priority than 10.</param> public SortOption(Expression<Func<TModel, TProperty>> property, bool isAscending = true, int priority = 0) { Property = property; IsAscending = isAscending; Priority = priority; } /// <summary> /// Default Constructor. /// </summary> public SortOption() : this(null) { } /// <summary> /// This is the field on the object to filter. /// </summary> public Expression<Func<TModel, TProperty>> Property { get; set; } /// <summary> /// This indicates if the sorting should be ascending or descending. /// </summary> public bool IsAscending { get; set; } /// <summary> /// This indicates the sorting priority where 0 is a higher priority than 10. /// </summary> public int Priority { get; set; } #region Implementation of ISerializable /// <summary> /// This is the constructor called when deserializing a SortOption. /// </summary> protected SortOption(SerializationInfo info, StreamingContext context) { IsAscending = info.GetBoolean("IsAscending"); Priority = info.GetInt32("Priority"); // We just persisted this by the PropertyName. So let's rebuild the Lambda Expression from that. Property = DynamicExpression.ParseLambda<TModel, TProperty>(info.GetString("Property"), default(TModel), default(TProperty)); } /// <summary> /// Populates a <see cref="T:System.Runtime.Serialization.SerializationInfo"/> with the data needed to serialize the target object. /// </summary> /// <param name="info">The <see cref="T:System.Runtime.Serialization.SerializationInfo"/> to populate with data. </param> /// <param name="context">The destination (see <see cref="T:System.Runtime.Serialization.StreamingContext"/>) for this serialization. </param> public void GetObjectData(SerializationInfo info, StreamingContext context) { // Just stick the property name in there. We'll rebuild the expression based on that on the other end. info.AddValue("Property", Property.PropertyToString()); info.AddValue("IsAscending", IsAscending); info.AddValue("Priority", Priority); } #endregion }

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • How to programatically read native DLL imports in C#?

    - by Eric
    The large hunk of C# code below is intended to print the imports of a native DLL. I copied it from from this link and modified it very slightly, just to use LoadLibraryEx as Mike Woodring does here. I find that when I call the Foo.Test method with the original example's target, MSCOREE.DLL, it prints all the imports fine. But when I use other dlls like GDI32.DLL or WSOCK32.DLL the imports do not get printed. What's missing from this code that would let it print all the imports as, for example, DUMPBIN.EXE does? (Is there a hint I'm not grokking in the original comment that says, "using mscoree.dll as an example as it doesnt export any thing"?) Here's the extract that just shows how it's being invoked: public static void Test() { // WORKS: var path = @"c:\windows\system32\mscoree.dll"; // NO ERRORS, BUT NO IMPORTS PRINTED EITHER: //var path = @"c:\windows\system32\gdi32.dll"; //var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } And here is the whole code example: namespace PETest2 { [StructLayout(LayoutKind.Explicit)] public unsafe struct IMAGE_IMPORT_BY_NAME { [FieldOffset(0)] public ushort Hint; [FieldOffset(2)] public fixed char Name[1]; } [StructLayout(LayoutKind.Explicit)] public struct IMAGE_IMPORT_DESCRIPTOR { #region union /// <summary> /// CSharp doesnt really support unions, but they can be emulated by a field offset 0 /// </summary> [FieldOffset(0)] public uint Characteristics; // 0 for terminating null import descriptor [FieldOffset(0)] public uint OriginalFirstThunk; // RVA to original unbound IAT (PIMAGE_THUNK_DATA) #endregion [FieldOffset(4)] public uint TimeDateStamp; [FieldOffset(8)] public uint ForwarderChain; [FieldOffset(12)] public uint Name; [FieldOffset(16)] public uint FirstThunk; } [StructLayout(LayoutKind.Explicit)] public struct THUNK_DATA { [FieldOffset(0)] public uint ForwarderString; // PBYTE [FieldOffset(4)] public uint Function; // PDWORD [FieldOffset(8)] public uint Ordinal; [FieldOffset(12)] public uint AddressOfData; // PIMAGE_IMPORT_BY_NAME } public unsafe class Interop { #region Public Constants public static readonly ushort IMAGE_DIRECTORY_ENTRY_IMPORT = 1; #endregion #region Private Constants #region CallingConvention CALLING_CONVENTION /// <summary> /// Specifies the calling convention. /// </summary> /// <remarks> /// Specifies <see cref="CallingConvention.Winapi" /> for Windows to /// indicate that the default should be used. /// </remarks> private const CallingConvention CALLING_CONVENTION = CallingConvention.Winapi; #endregion CallingConvention CALLING_CONVENTION #region IMPORT DLL FUNCTIONS private const string KERNEL_DLL = "kernel32"; private const string DBGHELP_DLL = "Dbghelp"; #endregion #endregion Private Constants [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleA"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleA(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleW"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleW(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "IsBadReadPtr"), SuppressUnmanagedCodeSecurity] public static extern bool IsBadReadPtr(void* lpBase, uint ucb); [DllImport(DBGHELP_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "ImageDirectoryEntryToData"), SuppressUnmanagedCodeSecurity] public static extern void* ImageDirectoryEntryToData(void* Base, bool MappedAsImage, ushort DirectoryEntry, out uint Size); } static class Foo { // From winbase.h in the Win32 platform SDK. // const uint DONT_RESOLVE_DLL_REFERENCES = 0x00000001; const uint LOAD_IGNORE_CODE_AUTHZ_LEVEL = 0x00000010; [DllImport("kernel32.dll"), SuppressUnmanagedCodeSecurity] static extern uint LoadLibraryEx(string fileName, uint notUsedMustBeZero, uint flags); public static void Test() { //var path = @"c:\windows\system32\mscoree.dll"; //var path = @"c:\windows\system32\gdi32.dll"; var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } // using mscoree.dll as an example as it doesnt export any thing // so nothing shows up if you use your own module. // and the only none delayload in mscoree.dll is the Kernel32.dll private static void TestImports( uint hLib, bool mappedAsImage ) { unsafe { //fixed (char* pszModule = "mscoree.dll") { //void* hMod = Interop.GetModuleHandleW(pszModule); void* hMod = (void*)hLib; uint size = 0; uint BaseAddress = (uint)hMod; if (hMod != null) { Console.WriteLine("Got handle"); IMAGE_IMPORT_DESCRIPTOR* pIID = (IMAGE_IMPORT_DESCRIPTOR*)Interop.ImageDirectoryEntryToData((void*)hMod, mappedAsImage, Interop.IMAGE_DIRECTORY_ENTRY_IMPORT, out size); if (pIID != null) { Console.WriteLine("Got Image Import Descriptor"); while (!Interop.IsBadReadPtr((void*)pIID->OriginalFirstThunk, (uint)size)) { try { char* szName = (char*)(BaseAddress + pIID->Name); string name = Marshal.PtrToStringAnsi((IntPtr)szName); Console.WriteLine("pIID->Name = {0} BaseAddress - {1}", name, (uint)BaseAddress); THUNK_DATA* pThunkOrg = (THUNK_DATA*)(BaseAddress + pIID->OriginalFirstThunk); while (!Interop.IsBadReadPtr((void*)pThunkOrg->AddressOfData, 4U)) { char* szImportName; uint Ord; if ((pThunkOrg->Ordinal & 0x80000000) > 0) { Ord = pThunkOrg->Ordinal & 0xffff; Console.WriteLine("imports ({0}).Ordinal{1} - Address: {2}", name, Ord, pThunkOrg->Function); } else { IMAGE_IMPORT_BY_NAME* pIBN = (IMAGE_IMPORT_BY_NAME*)(BaseAddress + pThunkOrg->AddressOfData); if (!Interop.IsBadReadPtr((void*)pIBN, (uint)sizeof(IMAGE_IMPORT_BY_NAME))) { Ord = pIBN->Hint; szImportName = (char*)pIBN->Name; string sImportName = Marshal.PtrToStringAnsi((IntPtr)szImportName); // yes i know i am a lazy ass Console.WriteLine("imports ({0}).{1}@{2} - Address: {3}", name, sImportName, Ord, pThunkOrg->Function); } else { Console.WriteLine("Bad ReadPtr Detected or EOF on Imports"); break; } } pThunkOrg++; } } catch (AccessViolationException e) { Console.WriteLine("An Access violation occured\n" + "this seems to suggest the end of the imports section\n"); Console.WriteLine(e); } pIID++; } } } } } Console.WriteLine("Press Any Key To Continue......"); Console.ReadKey(); } }

    Read the article

  • Problem creating calculations 'engine' in two class java calculator

    - by tokee
    i have hit a brick wall whilst attempting to create a two class java calculator but have been unsuccessful so far in getting it working. i have the code for an interface which works and displays ok but creating a seperate class 'CalcEngine' to do the actual calculations has proven to be beyond me. I'd appreciate it if someone could kick start things for me and create a class calcEngine which works with the interface class and allows input when from single button i.e. if one is pressed on the calc then 1 displays onscreen. please note i'm not asking someone to do the whole thing for me as i want to learn and i'm confident i can do the rest including addition subtraction etc. once i get over the obstacle of getting the two classes to communicate. any and all assistance would be very much appreciated. Please see the calcInterface class code below - import java.awt.*; import javax.swing.*; import javax.swing.border.*; import java.awt.event.*; /** *A Class that operates as the framework for a calculator. *No calculations are performed in this section */ public class CalcFrame implements ActionListener { private CalcEngine calc; private JFrame frame; private JTextField display; private JLabel status; /** * Constructor for objects of class GridLayoutExample */ public CalcFrame() { makeFrame(); //calc = engine; } /** * This allows you to quit the calculator. */ // Alows the class to quit. private void quit() { System.exit(0); } // Calls the dialog frame with the information about the project. private void showAbout() { JOptionPane.showMessageDialog(frame, "Group Project", "About Calculator Group Project", JOptionPane.INFORMATION_MESSAGE); } private void makeFrame() { frame = new JFrame("Group Project Calculator"); makeMenuBar(frame); JPanel contentPane = (JPanel)frame.getContentPane(); contentPane.setLayout(new BorderLayout(8, 8)); contentPane.setBorder(new EmptyBorder( 10, 10, 10, 10)); /** * Insert a text field */ display = new JTextField(); contentPane.add(display, BorderLayout.NORTH); //Container contentPane = frame.getContentPane(); contentPane.setLayout(new GridLayout(4, 4)); JPanel buttonPanel = new JPanel(new GridLayout(4, 4)); contentPane.add(new JButton("1")); contentPane.add(new JButton("2")); contentPane.add(new JButton("3")); contentPane.add(new JButton("4")); contentPane.add(new JButton("5")); contentPane.add(new JButton("6")); contentPane.add(new JButton("7")); contentPane.add(new JButton("8")); contentPane.add(new JButton("9")); contentPane.add(new JButton("0")); contentPane.add(new JButton("+")); contentPane.add(new JButton("-")); contentPane.add(new JButton("/")); contentPane.add(new JButton("*")); contentPane.add(new JButton("=")); contentPane.add(new JButton("C")); contentPane.add(buttonPanel, BorderLayout.CENTER); //status = new JLabel(calc.getAuthor()); //contentPane.add(status, BorderLayout.SOUTH); frame.pack(); frame.setVisible(true); } /** * Create the main frame's menu bar. * The frame that the menu bar should be added to. */ private void makeMenuBar(JFrame frame) { final int SHORTCUT_MASK = Toolkit.getDefaultToolkit().getMenuShortcutKeyMask(); JMenuBar menubar = new JMenuBar(); frame.setJMenuBar(menubar); JMenu menu; JMenuItem item; // create the File menu menu = new JMenu("File"); menubar.add(menu); // create the Quit menu with a shortcut "Q" key. item = new JMenuItem("Quit"); item.setAccelerator(KeyStroke.getKeyStroke(KeyEvent.VK_Q, SHORTCUT_MASK)); item.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { quit(); } }); menu.add(item); // Adds an about menu. menu = new JMenu("About"); menubar.add(menu); // Displays item = new JMenuItem("Calculator Project"); item.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { showAbout(); } }); menu.add(item); } /** * An interface action has been performed. * Find out what it was and handle it. * @param event The event that has occured. */ public void actionPerformed(ActionEvent event) { String command = event.getActionCommand(); if(command.equals("0") || command.equals("1") || command.equals("2") || command.equals("3") || command.equals("4") || command.equals("5") || command.equals("6") || command.equals("7") || command.equals("8") || command.equals("9")) { int number = Integer.parseInt(command); calc.numberPressed(number); } else if(command.equals("+")) { calc.plus(); } else if(command.equals("-")) { calc.minus(); } else if(command.equals("=")) { calc.equals(); } else if(command.equals("C")) { calc.clear(); } else if(command.equals("?")) { } // else unknown command. redisplay(); } /** * Update the interface display to show the current value of the * calculator. */ private void redisplay() { display.setText("" + calc.getDisplayValue()); } /** * Toggle the info display in the calculator's status area between the * author and version information. */ }

    Read the article

  • Https in java ends up with strange results

    - by Senne
    I'm trying to illustrate to students how https is used in java. But i have the feeling my example is not really the best out there... The code works well on my windows 7: I start the server, go to https://localhost:8080/somefile.txt and i get asked to trust the certificate, and all goes well. When I try over http (before or after accepting the certificate) I just get a blank page, which is ok for me. BUT when I try the exact same thing on my windows XP: Same thing, all goes well. But then (after accepting the certificate first), I'm also able to get all the the files through http! (if I first try http before https followed by accepting the certificate, I get no answer..) I tried refreshing, hard refreshing a million times but this should not be working, right? Is there something wrong in my code? I'm not sure if I use the right approach to implement https here... package Security; import java.io.*; import java.net.*; import java.util.*; import java.util.concurrent.Executors; import java.security.*; import javax.net.ssl.*; import com.sun.net.httpserver.*; public class HTTPSServer { public static void main(String[] args) throws IOException { InetSocketAddress addr = new InetSocketAddress(8080); HttpsServer server = HttpsServer.create(addr, 0); try { System.out.println("\nInitializing context ...\n"); KeyStore ks = KeyStore.getInstance("JKS"); char[] password = "vwpolo".toCharArray(); ks.load(new FileInputStream("myKeys"), password); KeyManagerFactory kmf = KeyManagerFactory.getInstance("SunX509"); kmf.init(ks, password); SSLContext sslContext = SSLContext.getInstance("TLS"); sslContext.init(kmf.getKeyManagers(), null, null); // a HTTPS server must have a configurator for the SSL connections. server.setHttpsConfigurator (new HttpsConfigurator(sslContext) { // override configure to change default configuration. public void configure (HttpsParameters params) { try { // get SSL context for this configurator SSLContext c = getSSLContext(); // get the default settings for this SSL context SSLParameters sslparams = c.getDefaultSSLParameters(); // set parameters for the HTTPS connection. params.setNeedClientAuth(true); params.setSSLParameters(sslparams); System.out.println("SSL context created ...\n"); } catch(Exception e2) { System.out.println("Invalid parameter ...\n"); e2.printStackTrace(); } } }); } catch(Exception e1) { e1.printStackTrace(); } server.createContext("/", new MyHandler1()); server.setExecutor(Executors.newCachedThreadPool()); server.start(); System.out.println("Server is listening on port 8080 ...\n"); } } class MyHandler implements HttpHandler { public void handle(HttpExchange exchange) throws IOException { String requestMethod = exchange.getRequestMethod(); if (requestMethod.equalsIgnoreCase("GET")) { Headers responseHeaders = exchange.getResponseHeaders(); responseHeaders.set("Content-Type", "text/plain"); exchange.sendResponseHeaders(200, 0); OutputStream responseBody = exchange.getResponseBody(); String response = "HTTP headers included in your request:\n\n"; responseBody.write(response.getBytes()); Headers requestHeaders = exchange.getRequestHeaders(); Set<String> keySet = requestHeaders.keySet(); Iterator<String> iter = keySet.iterator(); while (iter.hasNext()) { String key = iter.next(); List values = requestHeaders.get(key); response = key + " = " + values.toString() + "\n"; responseBody.write(response.getBytes()); System.out.print(response); } response = "\nHTTP request body: "; responseBody.write(response.getBytes()); InputStream requestBody = exchange.getRequestBody(); byte[] buffer = new byte[256]; if(requestBody.read(buffer) > 0) { responseBody.write(buffer); } else { responseBody.write("empty.".getBytes()); } URI requestURI = exchange.getRequestURI(); String file = requestURI.getPath().substring(1); response = "\n\nFile requested = " + file + "\n\n"; responseBody.write(response.getBytes()); responseBody.flush(); System.out.print(response); Scanner source = new Scanner(new File(file)); String text; while (source.hasNext()) { text = source.nextLine() + "\n"; responseBody.write(text.getBytes()); } source.close(); responseBody.close(); exchange.close(); } } }

    Read the article

  • What is the best strategy for populating a TableView from a service?

    - by alrutherford
    I have an application which has a potentially long running background process. I want this process to populate a TableView as results objects are generated. The results objects are added to an observableList and have properties which are bound to the columns in the usual fashion for JavaFX. As an example of this consider the following sample code Main Application import java.util.LinkedList; import javafx.application.Application; import javafx.collections.FXCollections; import javafx.collections.ObservableList; import javafx.event.ActionEvent; import javafx.event.EventHandler; import javafx.geometry.Insets; import javafx.scene.Group; import javafx.scene.Scene; import javafx.scene.control.Button; import javafx.scene.control.TableColumn; import javafx.scene.control.TableView; import javafx.scene.control.cell.PropertyValueFactory; import javafx.scene.layout.VBox; import javafx.stage.Stage; public class DataViewTest extends Application { private TableView<ServiceResult> dataTable = new TableView<ServiceResult>(); private ObservableList<ServiceResult> observableList; private ResultService resultService; public static void main(String[] args) { launch(args); } @Override public void start(Stage stage) { observableList = FXCollections.observableArrayList(new LinkedList<ServiceResult>()); resultService = new ResultService(observableList); Button refreshBtn = new Button("Update"); refreshBtn.setOnAction(new EventHandler<ActionEvent>() { @Override public void handle(ActionEvent arg0) { observableList.clear(); resultService.reset(); resultService.start(); } }); TableColumn<ServiceResult, String> nameCol = new TableColumn<ServiceResult, String>("Value"); nameCol.setCellValueFactory(new PropertyValueFactory<ServiceResult, String>("value")); nameCol.setPrefWidth(200); dataTable.getColumns().setAll(nameCol); // productTable.getItems().addAll(products); dataTable.setItems(observableList); Scene scene = new Scene(new Group()); stage.setTitle("Table View Sample"); stage.setWidth(300); stage.setHeight(500); final VBox vbox = new VBox(); vbox.setSpacing(5); vbox.setPadding(new Insets(10, 0, 0, 10)); vbox.getChildren().addAll(refreshBtn, dataTable); ((Group) scene.getRoot()).getChildren().addAll(vbox); stage.setScene(scene); stage.show(); } } Service public class ResultService extends Service<Void> { public static final int ITEM_COUNT = 100; private ObservableList<ServiceResult> observableList; /** * Construct service. * */ public ResultService(ObservableList<ServiceResult> observableList) { this.observableList = observableList; } @Override protected Task<Void> createTask() { return new Task<Void>() { @Override protected Void call() throws Exception { process(); return null; } }; } public void process() { for (int i = 0; i < ITEM_COUNT; i++) { observableList.add(new ServiceResult(i)); } } } Data public class ServiceResult { private IntegerProperty valueProperty; /** * Construct property object. * */ public ServiceResult(int value) { valueProperty = new SimpleIntegerProperty(); setValue(value); } public int getValue() { return valueProperty.get(); } public void setValue(int value) { this.valueProperty.set(value); } public IntegerProperty valueProperty() { return valueProperty; } } Both the service and the TableView share a reference to the observable list? Is this good practise in JavaFx and if not what is the correct strategy? If you hit the the 'Update' button the list will not always refresh to the ITEM_COUNT length. I believe this is because the observableList.clear() is interfering with the update which is running in the background thread. Can anyone shed some light on this?

    Read the article

  • Access violation using LocalAlloc()

    - by PaulH
    I have a Visual Studio 2008 Windows Mobile 6 C++ application that is using an API that requires the use of LocalAlloc(). To make my life easier, I created an implementation of a standard allocator that uses LocalAlloc() internally: /// Standard library allocator implementation using LocalAlloc and LocalReAlloc /// to create a dynamically-sized array. /// Memory allocated by this allocator is never deallocated. That is up to the /// user. template< class T, int max_allocations > class LocalAllocator { public: typedef T value_type; typedef size_t size_type; typedef ptrdiff_t difference_type; typedef T* pointer; typedef const T* const_pointer; typedef T& reference; typedef const T& const_reference; pointer address( reference r ) const { return &r; }; const_pointer address( const_reference r ) const { return &r; }; LocalAllocator() throw() : c_( NULL ) { }; /// Attempt to allocate a block of storage with enough space for n elements /// of type T. n>=1 && n<=max_allocations. /// If memory cannot be allocated, a std::bad_alloc() exception is thrown. pointer allocate( size_type n, const void* /*hint*/ = 0 ) { if( NULL == c_ ) { c_ = LocalAlloc( LPTR, sizeof( T ) * n ); } else { HLOCAL c = LocalReAlloc( c_, sizeof( T ) * n, LHND ); if( NULL == c ) LocalFree( c_ ); c_ = c; } if( NULL == c_ ) throw std::bad_alloc(); return reinterpret_cast< T* >( c_ ); }; /// Normally, this would release a block of previously allocated storage. /// Since that's not what we want, this function does nothing. void deallocate( pointer /*p*/, size_type /*n*/ ) { // no deallocation is performed. that is up to the user. }; /// maximum number of elements that can be allocated size_type max_size() const throw() { return max_allocations; }; private: /// current allocation point HLOCAL c_; }; // class LocalAllocator My application is using that allocator implementation in a std::vector< #define MAX_DIRECTORY_LISTING 512 std::vector< WIN32_FIND_DATA, LocalAllocator< WIN32_FIND_DATA, MAX_DIRECTORY_LISTING > > file_list; WIN32_FIND_DATA find_data = { 0 }; HANDLE find_file = ::FindFirstFile( folder.c_str(), &find_data ); if( NULL != find_file ) { do { // access violation here on the 257th item. file_list.push_back( find_data ); } while ( ::FindNextFile( find_file, &find_data ) ); ::FindClose( find_file ); } // data submitted to the API that requires LocalAlloc()'d array of WIN32_FIND_DATA structures SubmitData( &file_list.front() ); On the 257th item added to the vector<, the application crashes with an access violation: Data Abort: Thread=8e1b0400 Proc=8031c1b0 'rapiclnt' AKY=00008001 PC=03f9e3c8(coredll.dll+0x000543c8) RA=03f9ff04(coredll.dll+0x00055f04) BVA=21ae0020 FSR=00000007 First-chance exception at 0x03f9e3c8 in rapiclnt.exe: 0xC0000005: Access violation reading location 0x01ae0020. LocalAllocator::allocate is called with an n=512 and LocalReAlloc() succeeds. The actual Access Violation exception occurs within the std::vector< code after the LocalAllocator::allocate call: 0x03f9e3c8 0x03f9ff04 > MyLib.dll!stlp_std::priv::__copy_trivial(const void* __first = 0x01ae0020, const void* __last = 0x01b03020, void* __result = 0x01b10020) Line: 224, Byte Offsets: 0x3c C++ MyLib.dll!stlp_std::vector<_WIN32_FIND_DATAW,LocalAllocator<_WIN32_FIND_DATAW,512> >::_M_insert_overflow(_WIN32_FIND_DATAW* __pos = 0x01b03020, _WIN32_FIND_DATAW& __x = {...}, stlp_std::__true_type& __formal = {...}, unsigned int __fill_len = 1, bool __atend = true) Line: 112, Byte Offsets: 0x5c C++ MyLib.dll!stlp_std::vector<_WIN32_FIND_DATAW,LocalAllocator<_WIN32_FIND_DATAW,512> >::push_back(_WIN32_FIND_DATAW& __x = {...}) Line: 388, Byte Offsets: 0xa0 C++ MyLib.dll!Foo(unsigned long int cbInput = 16, unsigned char* pInput = 0x01a45620, unsigned long int* pcbOutput = 0x1dabfbbc, unsigned char** ppOutput = 0x1dabfbc0, IRAPIStream* __formal = 0x00000000) Line: 66, Byte Offsets: 0x1e4 C++ If anybody can point out what I may be doing wrong, I would appreciate it. Thanks, PaulH

    Read the article

  • Using C# to detect whether a filename character is considered international

    - by Morten Mertner
    I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

    Read the article

< Previous Page | 434 435 436 437 438 439 440 441 442 443 444 445  | Next Page >