Search Results

Search found 9926 results on 398 pages for 'lookup tables'.

Page 44/398 | < Previous Page | 40 41 42 43 44 45 46 47 48 49 50 51  | Next Page >

  • Interactive console based CSV editor

    - by Penguin Nurse
    Although spreadsheet applications for editing CSV files on the console used to be one of the earliest killer applications for personal computers, only few of them and even less documentation about them is still actively maintained. After having done extensive search on the web, manpages and source code, I ended up with the following three applications that all have fundamental drawbacks: sc: abbrev. for spreadsheet calculator; nice tool with vi keybings, but it does not put strings containing the delimiter into quotas when exporting to delimiter separated format and can't import csv files correctly, i.e. all numbers are interpreted as strings GNU oleo: doesn't seem to be actively maintained any longer since 2001 and there are therefore no packages for major linux distributions teapot: offers packages for various operating systems, but uses for example counter-intuitive naming for cells (numbers for row and column, i.e. 11 seems to be intended to be row 1, column 1) and superfluous code for FLTK GUI Various Emacs modes also do not quote strings containing the delimiter well or are require much more typing for entering the scaffold of a table. Therefore I would be very grateful for overcoming one of theses drawbacks or any hints towards another console based CSV editor. It actually needn't do any calculations just editing cells or column- and rowise.

    Read the article

  • How to add a footer to a table in Microsoft Word?

    - by dewalla
    I have a table that is longer than one page. I have found the option to make the header of the table to be added to the second portion of the table after the page break. Is there a way to do the same thing but with a footer on the table? I want to add a footer so that if my table was 1000 entries long (12 pages), that the first and last row of each page would be consistant; a header and footer for the table. If I edit the rest of the document (above the table) the table will shift up/down and I want to header and footer of the table to remain at the pagge breaks. Any Ideas? PAGE BREAK HEADER OF TABLE TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL FOOTER OF TABLE PAGE BREAK HEADER OF TABLE TBL TBL TBL TBL TBL TBL FOOTER OF TABLE TEXT TEXT TEXT TEXT TEXT TEXT PAGE BREAK

    Read the article

  • Creating Routes using the second NIC in the box

    - by Aditya Sehgal
    OS: Linux I need some advice on how to set up the routing table. I have a box with two physical NIC cards eth0 & eth1 with two associated IPs IP1 & IP2 (both of the same subnet). I need to setup a route which will force all messages from IP1 towards IP3 (of the same subnet) to go via IP2. I have a raw socket capture program listening on IP2 (This is not for malicious use). I have set up the routing table as Destination Gateway Genmask Flags Metric Ref Use Iface IP3 IP2 255.255.255.255 UGH 0 0 0 eth1 If I try to specify eth0 while adding the above rule, I get an error "SIOCADDRT: Network is unreachable". I understand from the manpage of route that if the GW specified is a local interface, then that would be use as the outgoing interface. After setting up this rule, if i do a traceroute (-i eth0), the packet goes first to the default gateway and then to IP3. How do I force the packet originating from eth0 towards IP3 to first come to IP2. I cannot make changes to the routing table of the gateway. Please suggest.

    Read the article

  • How can I change my mysql user that has all privileges on a database to only have select privileges on one specific table?

    - by Glenn
    I gave my mysql user the "GRANT ALL PRIVILEGES ON database_name.* to my_user@localhost" treatment. Now I would like to be more granular, starting with lowering privileges on a specific table. I am hoping mysql has or can be set to follow a "least amount of privileges" policy, so I can keep the current setup and lower it for the one table. But I have not seen anything like this in the docs or online. Other than removing the DB level grant and re-granting on a table level, is there a way to get the same result by adding another rule?

    Read the article

  • Excel or OpenOffice Table Summary: how to reconstruct a table from another, with "missing" values

    - by Gilberto
    I have a table of values (partial) with 3 columns: month (from 1 to 12), code and value. E.g., MONTH | CODE | VALUE 1 | aaa | 111 1 | bbb | 222 1 | ccc | 333 2 | aaa | 1111 2 | ccc | 2222 The codes are clients and the values are sales volumes. Each row represents the sales for one month for one client. So I have three clients, namely aaa, bbb, and ccc. For month=1 their sales volumes are: aaa-111, bbb-222, and ccc-333. A client may or may not have sales for every month; for example, for the month 2, the client bbb has no sales. I have to construct a completed summary table for all the MONTH / CODE pairs with their corresponding VALUE (using the value from the "partial" table, if present, otherwise print a string "missing"). MONTH | CODE | VALUE 1 | aaa | 111 1 | bbb | 222 1 | ccc | 333 2 | aaa | 1111 2 | bbb | missing 2 | ccc | 2222 Or, to put it another way, the table is a linear representation of a matrix:                                 and I want to identify the cells for which no value was provided. How can I do that?

    Read the article

  • What can cause peaks in pagetables in /proc/meminfo ?

    - by Fuzzy76
    I have a gameserver running Debian Lenny on a VPS host. Even when experiencing a fairly low load, the players start experiencing major lag (ping times rise from 50 ms to 150-500 ms) in bursts of 3 - 10 seconds. I have installed Munin server monitoring, but when looking at the graphs it looks like the server has plenty of CPU, RAM and bandwidth available. The only weird thing I noticed is some peaks in the memory graph attributed to "page_tables" which maps to PageTables in /proc/meminfo but I can't find any good information on what this might mean. Any ideas what might be causing this? If you need any more graps, just let me know. The interrupts/second count is at roughly 400-600 during this period (nearly all from eth0). The drop in committed was caused by me trying to lower the allocated memory for the server from 512MB to 256MB, but that didn't seem to help.

    Read the article

  • Cumulative average using data from multiple rows in an excel table

    - by Aaron E
    I am trying to calculate a cumulative average column on a table I'm making in excel. I use the totals row for the ending cumulative average, but I would like to add a column that gives a cumulative average for each row up to that point. So, if I have 3 rows I want each row to have a column giving the average up to that row and then the ending cumulative average in the totals row. Right now I can't figure this out because I'd be having to reference in a formula rows above and below the current row and I'm unsure about how to go about it because it's a table and not just cells. If it was just cells then I know how to do the formula and copy it down each row, but being that the formula I need depends on whether or not a new row in the table is added or not I keep thinking that my formula would be something like: (Completion rate row 1/n) where n is the number of rows up to that point, here row 1, then ((Completion rate row 1 + Completion rate row 2)/n) for row 2 so n=2, and so on for each new row added. Please advise.

    Read the article

  • Use Excel Table Column in ComboBox Input Range property

    - by V7L
    I asked this in StackOverflow and was redirected here. Apologies for redundancy. I have an Excel worksheet with a combo box on Sheet1 that is populated via its Input Range property from a Dynamic Named Range on Sheet2. It works fine and no VBA is required. My data on Sheet2 is actually in an Excel Table (all data is in the XLS file, no external data sources). For clarity, I wanted to use a structured table reference for the combo box's Input Range, but cannot seem to find a syntax that works, e.g. myTable[[#Data],[myColumn3]] I cannot find any indications that the combo box WILL accept structured table references, though I cannot see why it wouldn't. So, two part question: 1. Is is possible to use a table column reference in the combo box input range property (not using VBA) and 2. HOW?

    Read the article

  • How to edit a table in the email reply (in Gmail)?

    - by imz
    I've received an email with an embedded table. I want to put some marks inside that table (i.e., edit the contentof the table) and send it back. Unfortunately, the Gmail interface doesn't seem to have table editing capabilities: after I hit reply, I see the table in the quoted text of the original message, but is not editable... If this is not possible in Gmail, how do I export the HTML source of this messsage and edit in another installed word processor?

    Read the article

  • Dates not recognized as dates in pivot table pulling directly from SQL Server

    - by Michael K
    My pivot pulls from an external data source with a date column. Excel doesn't see this column as a date and the 'Format Cells' option panel doesn't change how the dates are displayed. The cell data is left-aligned, suggesting a string rather than a date. I have tried cast(myvar as date) and convert(varchar, myvar, 101) and convert(varchar, myvar, 1) in the base table, but none of these have been picked up by Excel as dates. If the column is recognized as a date, I can group by week and month. I understand that if I can't fix this, the next step is to add columns with weeks and months for each date to the table, but I'd like to give formatting the column one more shot before doing that.

    Read the article

  • OpenVPN + iptables / NAT routing

    - by Mikeage
    Hi, I'm trying to set up an OpenVPN VPN, which will carry some (but not all) traffic from the clients to the internet via the OpenVPN server. My OpenVPN server has a public IP on eth0, and is using tap0 to create a local network, 192.168.2.x. I have a client which connects from local IP 192.168.1.101 and gets VPN IP 192.168.2.3. On the server, I ran: iptables -A INPUT -i tap+ -j ACCEPT iptables -A FORWARD -i tap+ -j ACCEPT iptables -t nat -A POSTROUTING -s 192.168.2.0/24 -o eth0 -j MASQUERADE On the client, the default remains to route via 192.168.1.1. In order to point it to 192.168.2.1 for HTTP, I ran ip rule add fwmark 0x50 table 200 ip route add table 200 default via 192.168.2.1 iptables -t mangle -A OUTPUT -j MARK -p tcp --dport 80 --set-mark 80 Now, if I try accessing a website on the client (say, wget google.com), it just hangs there. On the server, I can see $ sudo tcpdump -n -i tap0 tcpdump: verbose output suppressed, use -v or -vv for full protocol decode listening on tap0, link-type EN10MB (Ethernet), capture size 96 bytes 05:39:07.928358 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 558838 0,nop,wscale 5> 05:39:10.751921 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 559588 0,nop,wscale 5> Where 74.125.67.100 is the IP it gets for google.com . Why isn't the MASQUERADE working? More precisely, I see that the source showing up as 192.168.1.101 -- shouldn't there be something to indicate that it came from the VPN? Edit: Some routes [from the client] $ ip route show table main 192.168.2.0/24 dev tap0 proto kernel scope link src 192.168.2.4 192.168.1.0/24 dev wlan0 proto kernel scope link src 192.168.1.101 metric 2 169.254.0.0/16 dev wlan0 scope link metric 1000 default via 192.168.1.1 dev wlan0 proto static $ ip route show table 200 default via 192.168.2.1 dev tap0

    Read the article

  • Problems creating a functioning table

    - by Hoser
    This is a pretty simple SQL query I would assume, but I'm having problems getting it to work. if (object_id('#InfoTable')is not null) Begin Drop Table #InfoTable End create table #InfoTable (NameOfObject varchar(50), NameOfCounter varchar(50), SampledValue float(30), DayStamp datetime) insert into #InfoTable(NameOfObject, NameOfCounter, SampledValue, DayStamp) select vPerformanceRule.ObjectName AS NameOfObject, vPerformanceRule.CounterName AS NameOfCounter, Perf.vPerfRaw.SampleValue AS SampledValue, Perf.vPerfHourly.DateTime AS DayStamp from vPerformanceRule, vPerformanceRuleInstance, Perf.vPerfHourly, Perf.vPerfRaw where (ObjectName like 'Logical Disk' and CounterName like '% Free Space' AND SampleValue > 95 AND SampleValue < 100) order by DayStamp desc select NameOfObject, NameOfCounter, SampledValue, DayStamp from #InfoTable Drop Table #InfoTable I've tried various other forms of syntax, but no matter what I do, I get these error messages. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'DayStamp'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'DayStamp'. Line 10 is the first 'insert into' line, and line 22 is the second select line. Any ideas?

    Read the article

  • MySQL: how to convert many MyISAM tables to InnoDB in a production database?

    - by Continuation
    We have a production database that is made up entirely of MyISAM tables. We are considering converting them to InnoDB to gain better concurrency & reliability. Can I just alter the myISAM tables to InnoDB without shutting down MySQL? What are the recommend procedures here? How long will such a conversion take? All the tables have a total size of about 700MB There are quite a large number of tables. Is there any way to apply ALTER TABLE to all the MyISAM tables at once instead of doing it one by one? Any pitfalls I need to be aware of? Thank you

    Read the article

  • Split a table in Word without losing row title

    - by Shane Hsu
    Word has the feature to repeat title row of a table when a table is so long that it spans a bunch of pages. I need to categorize my data into several pages, and I did that by splitting the table and insert page split to put them all in a page of itself. So now I got several page of data, but only the first page has title row. Is there anyway else to do this beside manually adding the title row to all the other pages? Original data: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 2 * | | 2 * | | 2 * | | 2 * | | 3 * | |___3______*______| And then turn it into: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | |___1______*______| Next page _________________ | Cat. Data | | 2 * | | 2 * | | 2 * | |___2______*______| Next Page _________________ | Cat. Data | | 3 * | |___3______*______|

    Read the article

  • Table Formatting in Excel 2007: How do I remove it?

    - by RocketGoal
    I've used the new Table Formatting option in Excel 2007. Now I can't remove it. I've dragged the little blue square up to the last cell on the top left, but it just won't go any further. In fact it just won't go at all. Clear all doesn't remove it. What does? I want my table back! I'm not a beginner with Excel, but this little annoyance has made me feel like on. Surely there must be some way to remove table format without deleting something or clearing all! Thanks Mike

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Issues with "There is already an object named 'xxx' in the database'

    - by Hoser
    I'm fairly new to SQL so this may be an easy mistake, but I haven't been able to find a solid solution anywhere else. Problem is whenever I try to use my temp table, it tells me it cannot be used because there is already an object with that name. I frequently try switching up the names, and sometimes it'll let me work with the table for a little while, but it never lasts for long. Am I dropping the table incorrectly? Also, I've had people suggest to just use a permanent table, but this database does not allow me to do that. create table #RandomTableName(NameOfObject varchar(50), NameOfCounter varchar(50), SampledValue decimal) select vPerformanceRule.ObjectName, vPerformanceRule.CounterName, Perf.vPerfRaw.SampleValue into #RandomTableName from vPerformanceRule, vPerformanceRuleInstance, Perf.vPerfRaw where (ObjectName like 'Processor' AND CounterName like '% Processor Time') OR(ObjectName like 'System' AND CounterName like 'Processor Queue Length') OR(ObjectName like 'Memory' AND CounterName like 'Pages/Sec') OR(ObjectName like 'Physical Disk' AND CounterName like 'Avg. Disk Queue Length') OR(ObjectName like 'Physical Disk' AND CounterName like 'Avg. Disk sec/Read') OR(ObjectName like 'Physical Disk' and CounterName like '% Disk Time') OR(ObjectName like 'Logical Disk' and CounterName like '% Free Space' AND SampleValue > 70 AND SampleValue < 100) order by ObjectName, SampleValue drop table #RandomTableName

    Read the article

  • Does OSB has any database dependency?

    - by Manoj Neelapu
    Major functionality of OSB is database independent. Most of the internal data-structures that re required by OSB are stored in-memory.Reporting functionality of OSB requires DB tables be accessible.http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABCJHDJ It should hover be noted that we can still run OSB with out creating any tables on database.In such cases the reporting functionality cannot be used where as other functions in OSB will work just as fine.We also see few errors in the log file indicating the absence of these tables which we can ignore.  If reporting function is required we will have to install few tables. http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABBBEHD indicates running RCU recommended. OSB reporting tables are bundled along with SOA schema in RCU. OSB requires two simple tables for reporting functionality and installing complete SOA schema is little far fetched. SOA schema contains lot of tables which OSB doesn't require at all. More over OSB tables are too simple to require a tool like an RCU.Solution to it would be to manually create those tables required for OSB. To make  life easier the definition of tables is available in dbscripts folder under OSB_HOME.eg. D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1\dbscripts. $OSB_HOME=D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1If you are not planning to use reporting feature in OSB, then we can also delete the JDBC data sources that comes along with standard OSB domain.WLST script to delete cgDataSources from OSB domain . OSB will work fine with out DB tables and JDBC Datasource.

    Read the article

  • [Flex 4 and .Net] Retrieving tables from SQL database

    - by mG
    Hi everyone, As the title says, I want to retrieve tables of data from a SQL database, using Flex 4 and .Net WebService. I'm new to both Flex and DotNet. Please tell me a proper way to do it. This is what I've done so far: Retrieving an array of string: (this works) .Net: [WebMethod] public String[] getTestArray() { String[] arStr = { "AAA", "BBB", "CCC", "DDD" }; return arStr; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getTestArray(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application> Retrieving a DataTable: (this does not work) DotNet: [WebMethod] public DataTable getUsers() { DataTable dt = new DataTable("Users"); SqlConnection conn = new SqlConnection("server = 192.168.1.50; database = MyDatabase; user id = sa; password = 1234; integrated security = false"); SqlDataAdapter da = new SqlDataAdapter("select vFName, vLName, vEmail from Users", conn); da.Fill(dt); return dt; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getUsers(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application>

    Read the article

  • Comparing 2 tables column values and copying the next column content to the second table

    - by Sullan
    Hi All.. I am comparing between two tables first column each. If there is find a match i am copying the text from the adjacent cell of the first table to the second table. I am able to compare strings and get the value, but finding it difficult to print it in the second table. I am getting the value in the var "replaceText", but how to print it in the second table ?? Please help... Sample code is as follows.. <script type="text/javascript"> jQuery.noConflict(); jQuery(document).ready(function(){ jQuery('.itemname').each(function(){ var itemName = jQuery(this).text(); jQuery('.comparerow').each(function() { var compareRow = jQuery(this).text(); if (itemName == compareRow) { var replaceText = jQuery(this).next('td').text(); alert(replaceText); } }); }); }); </script> HTML is as follows <table width="100%"><thead> <tr> <th align="left" >Name</th><th>Description</th></tr></thead> <tbody> <tr> <td class="comparerow">IX0001</td> <td class="desc">Desc 1 </td> </tr> <tr> <td class="comparerow">IX0002</td> <td class="desc" >Desc 2 </td> </tr> <tr> <td class="comparerow">IX0003</td> <td class="desc">Desc 3 </td> </tr> <tr> <td class="comparerow">IX0004</td> <td class="desc">Desc 4 </td> </tr> </tbody> </table> <br /> <table width="100%"> <tr> <th>Name</th><th>Description</th> </tr> <tr > <td class="itemname">IX0001</td><td></td> </tr> <tr> <td class="itemname">IX0002</td><td></td> </tr> <tr> <td class="itemname">IX0003</td><td></td> </tr> </table>

    Read the article

  • Parsing tables, cells with Html agility in C#

    - by Kaeso
    I need to parse Html code. More specifically, parse each cell of every rows in all tables. Each row represent a single object and each cell represent different properties. I want to parse these to be able to write an XML file with every data inside (without the useless HTML code). This is the way I thought it out initially but I ran out of ideas: HTML: <tr> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF"> 1 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="left"> <a href="/ice/player.htm?id=8471675">Sidney Crosby</a> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="center"> PIT </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="center"> C </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 39 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 32 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 33 </td> <td class="statBox sorted" style="border-width:0px 1px 1px 0px; background-color: #E0E0E0" align="right"> <font color="#000000"> 65 </font> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 20 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 29 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 10 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 1 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 3 </td> <td class="statBox" style="border-width:0px 0px 1px 0px; background-color: #FFFFFF" align="right"> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 0 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 154 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 20.8 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 21:54 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 22.6 </td> <td class="statBox" style="border-width:0px 0px 1px 0px; background-color: #FFFFFF" align="right"> 55.7 </td> </tr> C#: using HtmlAgilityPack; using System.Data; namespace Stats { class StatsParser { private string htmlCode; private static string fileName = "[" + DateTime.Now.ToShortDateString() + " NHL Stats].xml"; public StatsParser(string htmlCode) { this.htmlCode = htmlCode; this.ParseHtml(); } public DataTable ParseHtml() { var result = new DataTable(); HtmlDocument doc = new HtmlDocument(); doc.LoadHtml(htmlCode); HtmlNode row = doc.DocumentNode.SelectNodes("//tr"); foreach (var statBox in row.SelectNodes("//td[@class='statBox']")) { System.Windows.MessageBox.Show(statBox.InnerText); } } } }

    Read the article

  • Database with 5 Tables with Insert and Select

    - by kirbby
    hi guys, my problem is that i have 5 tables and need inserts and selects. what i did is for every table a class and there i wrote the SQL Statements like this public class Contact private static String IDCont = "id_contact"; private static String NameCont = "name_contact"; private static String StreetCont = "street_contact"; private static String Street2Cont = "street2_contact"; private static String Street3Cont = "street3_contact"; private static String ZipCont = "zip_contact"; private static String CityCont = "city_contact"; private static String CountryCont = "country_contact"; private static String Iso2Cont = "iso2_contact"; private static String PhoneCont = "phone_contact"; private static String Phone2Cont = "phone2_contact"; private static String FaxCont = "fax_contact"; private static String MailCont = "mail_contact"; private static String Mail2Cont = "mail2_contact"; private static String InternetCont = "internet_contact"; private static String DrivemapCont = "drivemap_contact"; private static String PictureCont = "picture_contact"; private static String LatitudeCont = "latitude_contact"; private static String LongitudeCont = "longitude_contact"; public static final String TABLE_NAME = "contact"; public static final String SQL_CREATE = "CREATE TABLE IF NOT EXISTS " + TABLE_NAME + "(" + IDCont + "INTEGER not NULL," + NameCont + " TEXT not NULL," + StreetCont + " TEXT," + Street2Cont + " TEXT," + Street3Cont + " TEXT," + ZipCont + " TEXT," + CityCont + " TEXT," + CountryCont + " TEXT," + Iso2Cont + " TEXT," + PhoneCont + " TEXT," + Phone2Cont + " TEXT," + FaxCont + " TEXT," + MailCont + " TEXT," + Mail2Cont + " TEXT," + InternetCont + " TEXT," + //website of the contact DrivemapCont + " TEXT," + //a link to a drivemap to the contact PictureCont + " TEXT," + //a photo of the contact building (contact is not a person) LatitudeCont + " TEXT," + LongitudeCont + " TEXT," + "primary key(id_contact)" + "foreign key(iso2)"; and my insert looks like this public boolean SQL_INSERT_CONTACT(int IDContIns, String NameContIns, String StreetContIns, String Street2ContIns, String Street3ContIns, String ZipContIns, String CityContIns, String CountryContIns, String Iso2ContIns, String PhoneContIns, String Phone2ContIns, String FaxContIns, String MailContIns, String Mail2ContIns, String InternetContIns, String DrivemapContIns, String PictureContIns, String LatitudeContIns, String LongitudeContIns) { try{ db.execSQL("INSERT INTO " + "contact" + "(" + IDCont + ", " + NameCont + ", " + StreetCont + ", " + Street2Cont + ", " + Street3Cont + ", " + ZipCont + ", " + CityCont + ", " + CountryCont + ", " + Iso2Cont + ", " + PhoneCont + ", " + Phone2Cont + ", " + FaxCont + ", " + MailCont + ", " + Mail2Cont + ", " + InternetCont + ", " + DrivemapCont + ", " + PictureCont + ", " + LatitudeCont + ", " + LongitudeCont + ") " + "VALUES (" + IDContIns + ", " + NameContIns +", " + StreetContIns + ", " + Street2ContIns + ", " + Street3ContIns + ", " + ZipContIns + ", " + CityContIns + ", " + CountryContIns + ", " + Iso2ContIns + ", " + PhoneContIns + ", " + Phone2ContIns + ", " + FaxContIns + ", " + MailContIns + ", " + Mail2ContIns + ", " + InternetContIns + ", " + DrivemapContIns + ", " + PictureContIns + ", " + LatitudeContIns + ", " + LongitudeContIns +")"); return true; } catch (SQLException e) { return false; } } i have a DBAdapter class there i created the database public class DBAdapter { public static final String DB_NAME = "mol.db"; private static final int DB_VERSION = 1; private static final String TAG = "DBAdapter"; //to log private final Context context; private SQLiteDatabase db; public DBAdapter(Context context) { this.context = context; OpenHelper openHelper = new OpenHelper(this.context); this.db = openHelper.getWritableDatabase(); } public static class OpenHelper extends SQLiteOpenHelper { public OpenHelper(Context context) { super(context, DB_NAME, null, DB_VERSION); } @Override public void onCreate(SQLiteDatabase db) { // TODO Auto-generated method stub db.execSQL(Contact.SQL_CREATE); db.execSQL(Country.SQL_CREATE); db.execSQL(Picture.SQL_CREATE); db.execSQL(Product.SQL_CREATE); db.execSQL(Project.SQL_CREATE); } @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { // TODO Auto-generated method stub Log.w(TAG, "Upgrading database from version " + oldVersion + " to " + newVersion + ", which will destroy all old data"); db.execSQL(Contact.SQL_DROP); db.execSQL(Country.SQL_DROP); db.execSQL(Picture.SQL_DROP); db.execSQL(Product.SQL_DROP); db.execSQL(Project.SQL_DROP); onCreate(db); } i found so many different things and tried them but i didn't get anything to work... i need to know how can i access the database in my activity and how i can get the insert to work and is there sth wrong in my code? thanks for your help thats how i tried to get it into my activity public class MainTabActivity extends TabActivity { private Context context; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.maintabactivity); TabHost mTabHost = getTabHost(); Intent intent1 = new Intent().setClass(this,MapOfLight.class); //Intent intent2 = new Intent().setClass(this,Test.class); //Testactivity //Intent intent2 = new Intent().setClass(this,DetailView.class); //DetailView Intent intent2 = new Intent().setClass(this,ObjectList.class); //ObjectList //Intent intent2 = new Intent().setClass(this,Gallery.class); //Gallery Intent intent3 = new Intent().setClass(this,ContactDetail.class); mTabHost.addTab(mTabHost.newTabSpec("tab_mol").setIndicator(this.getText(R.string.mol), getResources().getDrawable(R.drawable.ic_tab_mol)).setContent(intent1)); mTabHost.addTab(mTabHost.newTabSpec("tab_highlights").setIndicator(this.getText(R.string.highlights),getResources().getDrawable(R.drawable.ic_tab_highlights)).setContent(intent2)); mTabHost.addTab(mTabHost.newTabSpec("tab_contacts").setIndicator(this.getText(R.string.contact),getResources().getDrawable(R.drawable.ic_tab_contact)).setContent(intent3)); mTabHost.setCurrentTab(1); SQLiteDatabase db; DBAdapter dh = null; OpenHelper openHelper = new OpenHelper(this.context); dh = new DBAdapter(this); db = openHelper.getWritableDatabase(); dh.SQL_INSERT_COUNTRY("AT", "Austria", "AUT"); } } i tried it with my country table because it has only 3 columns public class Country { private static String Iso2Count = "iso2_country"; private static String NameCount = "name_country"; private static String FlagCount = "flag_image_url_country"; public static final String TABLE_NAME = "country"; public static final String SQL_CREATE = "CREATE TABLE IF NOT EXISTS " + TABLE_NAME + "(" + Iso2Count + " TEXT not NULL," + NameCount + " TEXT not NULL," + FlagCount + " TEXT not NULL," + "primary key(iso2_country)"; public boolean SQL_INSERT_COUNTRY(String Iso2CountIns, String NameCountIns, String FlagCountIns) { try{ db.execSQL("INSERT INTO " + "country" + "(" + Iso2Count + ", " + NameCount + ", " + FlagCount + ") " + "VALUES ( " + Iso2CountIns + ", " + NameCountIns +", " + FlagCountIns + " )"); return true; } catch (SQLException e) { return false; } } another question is it better to put the insert and select from each table into a separate class, so i have 1 class for each table or put them all into the DBAdapter class?

    Read the article

  • tables wrapping to next line when width 100%

    - by jmo
    I'm encountering some weirdness with tables in css. The layout is fairly simple, a fixed-width nav bar on the left and the content on the right. When the content includes a table with a width of 100% the table ends up getting pushed down until it has room to take up the full width of the screen (instead of just the area to the right of the nav bar). If I remove the width=100% from the table's css, then it looks fine, but obviously the table doesn't grow to fill the space of the div. The problem is that i want the table to grow and shrink with the window but still stay in the bounds of its div. Thanks. Here's a simple example: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html> <head> <title>Test</title> <style type="text/css"> #content { padding-right:20px; background:white; overflow:hidden; margin:20px; } #content .column { position:relative; padding-bottom: 20010px; margin-bottom: -20000px; } #center { width:100%; padding-top:15px; } body { min-width:700px; } #left { width: 330px; padding: 0 10px; padding-top:10px; float:left; } .tableData { width:100%; } </style> </head> <body> <div id="content"> <div class="column" id="left"> <div> Some text goes in here<br/> some more text<br/> some more text<br/> some more text<br/> some more text<br/> some more text<br/> </div> </div> <div class="column" id="center"> Some text at the top; <hr/> <table class="tableData"> <thead> <tr><th>A</th><th>B</th><th>C</th></tr> </thead> <tbody> <tr> <td>A1 A1 A1 A1</td> <td>B1 B1 B1 B1</td> <td>C1 C1 C1 C1 C</td> </tr> <tr> <td>A2 A2 A2 A2 </td> <td>B2 B2 B2 B2 </td> <td>C2 C2 C2 C2</td> </tr> <tr> <td>A3 A3 A3 A3 A3 </td> <td>B3 B3 B3 B3 B3 </td> <td>C3 C3 C3 C3 C3</td> </tr> <tr> <td>A4 A4 A4 A4 A4</td> <td>B4 B4 B4 B4 B4</td> <td>C4 C4 C4 C4 C4</td> </tr> </tbody> </table> </div> </div> </body> </html>

    Read the article

  • How do you version/track changes to SQL tables?

    - by gabe.
    When working in a team of developers, where everyone is making changes to local tables, and development tables, how do you keep all the changes in sync? A central log file where everyone keeps their sql changes? A wiki page to track alter table statements, individual .sql files that the devs can run to bring their local db's to the latest version? I've used some of these solutions, and I'm tyring to get a good solid solution together that works, so I'd appreciate your ideas.

    Read the article

  • How can I compile an IP address to country lookup database to make available for free?

    - by Nick
    How would I go about compiling an accurate database of IP addresses and their related countries to make available as an open source download for any web developer who wants to perform a geographic IP lookup? It seems that a company called MaxMind has a monopoly on geographic IP data, because most online tutorials I've seen for country lookups based on IP addresses start by suggesting a subscription to MaxMind's paid service (or their less accurate free 'Lite' version). I'm not completely averse to paying for their solution or using the free one, but the concept of an accurate open source equivalent that anyone can use without restriction appeals to me, and I think it would be useful for the web development community. How is geographic IP data collected, and how realistic is it to hope to maintain an up-to-date open version?

    Read the article

< Previous Page | 40 41 42 43 44 45 46 47 48 49 50 51  | Next Page >