Search Results

Search found 5852 results on 235 pages for 'ram kumar sharma'.

Page 44/235 | < Previous Page | 40 41 42 43 44 45 46 47 48 49 50 51  | Next Page >

  • GTA 4 crashes while trying to run it

    - by Damian
    Hi! I got those two errors when I'm trying to run GTA4: Description: Critical runtime problem Problem signature: Event Name Problem: APPLICATION CRASH System RAM: -1 Available RAM: -532590592 Number of CPUs: 4 Video Card Manufacturer: NVIDIA Video Card Description: NVIDIA GeForce 9800 GT Video Card Driver Version: 8.17.0012.5919 Version system OS: 6.1.7600.2.0.0.256.1 ID settings Regional: 1045 And the second error: Problem signature: Event Name Problem: BEX Name Application: GTAIV.exe Version Application: 1.0.7.0 Timestamp Application: 4bd9efbe Module Name error: StackHash_fea7 Module Version with the error: 0.0.0.0 Timestamp module with error: 00000000 Exception Offset: 0000b513 Code exception: c0000005 Data exception: 00000008 System Version OS: 6.1.7600.2.0.0.256.1 ID settings Regional: 1045 Additional Information 1: fea7 Additional information 2: fea78afc140967119290cc27385e0510 Additional Information 3: 20ce Additional Information 4: 20ce3e492a2aa7e5b8cfe9b7b1f05b42 My PC spec: Proc: Intel i5 (4x2,66ghz) RAM: 8GB DDR3 1066mhz Graphics: ASUS EN9800GT/DI/1GD3 OS: WINDOWS 7 64-bit I think it should work well on my PC, I couldn't find the solution to get it working so I hope You can help me. P.S. Sorry for my English - I'm from Poland.

    Read the article

  • Android : SQL Lite insertion or create table issue

    - by Ram
    Team, can anyone please help me to understand what could be the problem in the below snippet of code? It fails after insertion 2 and insertion 3 debug statements I have the contentValues in the Array list, I am iterating the arraylist and inserting the content values in to the database. Log.d("database","before insertion 1 "); liteDatabase = this.openOrCreateDatabase("Sales", MODE_PRIVATE, null); Log.d("database","before insertion 2 "); liteDatabase .execSQL("Create table activity ( ActivityId VARCHAR,Created VARCHAR,AMTaps_X VARCHAR,AMTemperature_X VARCHAR,AccountId VARCHAR,AccountLocation VARCHAR,AccountName VARCHAR,Classification VARCHAR,ActivityType VARCHAR,COTaps_X VARCHAR,COTemperature_X VARCHAR,Comment VARCHAR,ContactWorkPhone VARCHAR,CreatedByName VARCHAR,DSCycleNo_X VARCHAR,DSRouteNo_X VARCHAR,DSSequenceNo_X VARCHAR,Description VARCHAR,HETaps_X VARCHAR,HETemperature_X VARCHAR,Pro_Setup VARCHAR,LastUpdated VARCHAR,LastUpdatedBy VARCHAR,Licensee VARCHAR,MUTaps_X VARCHAR,MUTemperature_X VARCHAR,Objective VARCHAR,OwnerFirstName VARCHAR,OwnerLastName VARCHAR,PhoneNumber VARCHAR,Planned VARCHAR,PlannedCleanActualDt_X VARCHAR,PlannedCleanReason_X VARCHAR,PrimaryOwnedBy VARCHAR,Pro_Name VARCHAR,ServiceRepTerritory_X VARCHAR,ServiceRep_X VARCHAR,Status VARCHAR,Type VARCHAR,HEINDSTapAuditDate VARCHAR,HEINEmployeeType VARCHAR)"); Log.d("database","before insertion 3 "); int counter = 0; int size = arrayList.size(); for (counter = 0; counter < size; counter++) { ContentValues contentValues = (ContentValues) arrayList .get(counter); liteDatabase.insert("activity", "activityInfo", contentValues); Log.d("database", "Database insertion is done"); } }

    Read the article

  • idle proccesses and high memory bad? uwsgi/django

    - by JimJimThe3rd
    I have a VPS with 256MB of ram. I'm running nginx, uwsgi and postgresql on Ubuntu 12.04 for a soon to be Django site. About 200MB of ram are being used despite the website not being active, the uwsgi processes seem to just be idling. Is this bad? I once heard that having a bunch of free memory isn't necessarily a good metric because it is possible that the memory in use can easily be freed up. I mean, it is possible that the server is storing commonly used "stuff" in case it is accessed but is more than happy to dump it if the ram is needed. But I'm really not sure, hence me asking this question. If it is bad I could set some of the application loading options for uwsgi like "cheap" or "idle" mode. Screenshot of my htop

    Read the article

  • Determining Performance Limits

    - by JeffV
    I have a number of windows processes that pass messages between them hat a high rate using tcp to local host. Aside from testing on actual hardware how can I assess what my hardware limit will be. These applications are not doing CPU intensive work, mostly decomposing and combining messages, scanning over them for special flag in the data etc.. The message size is typically 3k and the rate is typically ~10k messages per second. ~30MB per second between processing stages. There may be 10 or more stages depending. For this type of application, what should I look to for assessing performance? What do I look for in a server performance wise? I am currently running an XEON L5408 with 32 GB ram. But I am assuming cache is more important than actual ram size as I am barely touching the ram.

    Read the article

  • Choosing the right web service

    - by Ratan Sharma
    My website currently working in ASP.NET 1.1 Old Process In our database we have huge amount of data stored for a decoding purpose. We have to update this huge set of data table each week(Data is supplied from a vendor). In our website (in asp.net 1.1) we query our database to decode information. New process Now instead of storing data in our database and query them, we want to replace this through the web service, AS now the vendor is supplying us a DLL, which will give us the decoded information. Information on the DLL provided by the vendor The DLL provided, can only be added in 4.0 sites. SO that also impleies that i can not directly add the dll to my 1.1 site. This DLL is exposing certain methods, we simply have to add the DLL refernce in our web service and call the method and fetch the needed information. Thus we will not have to store those information in our database. So which type of web service I should go for (asmx OR WCF) that will use the DLLs provided by vendor to fetch the decoded information ?? Flexibility i am looking for in the web service are: It can be consumed from asp.net 1.1 site directly and also using jQuery ajax. It can be consumed from other web services running on the server. It can be consumed from some windows services running from the server. NOTE : Moreover we have a plan to migrate our website from asp.net 1.1 to 4.0 version in future.So it should be that much supportive for future upgrade.

    Read the article

  • insert multiple elements in string in python

    - by Anurag Sharma
    I have to build a string like this { name: "john", url: "www.dkd.com", email: "[email protected]" } where john, www.dkd.com and [email protected] are to be supplied by variables I tried to do the following s1 = "{'name:' {0},'url:' {1},'emailid:' {2}}" s1.format("john","www.dkd.com","[email protected]") I am getting the following error Traceback (most recent call last): File "<stdin>", line 1, in <module> KeyError: "'name" Dont able to understand what I am doing wrong

    Read the article

  • yahoo connectivity with java code

    - by sharma
    Dear all, I want to develop a yahoo client (core java) which connects to yahoo messenger ,checks for the authentication and login through java code. I have already used jymsg api ,but since yahoo changed its protocol after august 15,2009 i m not able to connect to yahoo server through java code.Is there any api or source available?Do i need to change the authentication method.help in this 2 resolve problem.

    Read the article

  • Can't parse XML effectively using Python

    - by Harshit Sharma
    import urllib import xml.etree.ElementTree as ET def getWeather(city): #create google weather api url url = "http://www.google.com/ig/api?weather=" + urllib.quote(city) try: # open google weather api url f = urllib.urlopen(url) except: # if there was an error opening the url, return return "Error opening url" # read contents to a string s = f.read() tree=ET.parse(s) current= tree.find("current_condition/condition") condition_data = current.get("data") weather = condition_data if weather == "<?xml version=": return "Invalid city" #return the weather condition #return weather def main(): while True: city = raw_input("Give me a city: ") weather = getWeather(city) print(weather) if __name__ == "__main__": main() gives error , I actually wanted to find values from google weather xml site tags

    Read the article

  • yahoo's attribute exchange -> blank data is coming

    - by Gaurav Sharma
    Hello everybody, I am trying to build openid login system for my website. To do this I used JanRain's php openid library v 2.1.3. I am also using openid selector to select the openid provider from the list. I first created the attributes array that I need to fetch from the provider as follows: $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/contact/email',2,1, 'email'); $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/namePerson/first',1,1, 'firstname'); $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/namePerson/last',1,1, 'lastname'); $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/namePerson',1,1, 'fullname'); $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/namePerson/friendly',1,1, 'username'); $ax = new Auth_OpenID_AX_FetchRequest; foreach($attribute as $attr) { $ax-add($attr); } $auth_request-addExtension($ax); and in the finish_auth.php file I wrote this to fetch the attributes returned $ax = new Auth_OpenID_AX_FetchResponse(); $obj = $ax-fromSuccessResponse($response); Google gives me all the attributes requested but yahoo doesn't (as stated here that yahoo now supports attribute exchange). Is there any limitation set by yahoo on attribute exchange too. (they give limited websites access to sreg extension of openid). :( Please help me, I am stuck over here. Thanks

    Read the article

  • How to customize the ColorPicker class in Adobe flex3.0?

    - by Ankur Sharma
    i have to make the colorpiker tool of flex, to be a customized one, i beleive you have seen the color picker tool of flex, when you click on the colorpicker, a swatch panel gets open, right?? now in that swatch, there are three compoenents, one is thw colorbox(on top left), beside right to this is the text field holding the hex code of the color and below these two tools, is the colors present in the small rectangles, now my need is this, i want to add three more buttons on the top empty space after textfield, so that structure of the colors pciker looks like this colorbox | textfield | button1 | button2 | button3 color rectangles, showing all default colors i beleive u understood, what i meant here, so plzz help me out in making a custom colorpciker class, thanx Namaste

    Read the article

  • Flicker, orkut, picasa API for Flex? Need API?Please help?

    - by Ankur Sharma
    hello, I have to work on one new project, there we have to provide an option to download images from any website like, Orkut, picasa etc, so that the user, can view his/her pictures any time and his/her images are accessible any time, so i heard of APIs, that we developer can use. i hope u r getting me, i saw tour de flex, there are few available API like for Flicker, they have ready made API, but i need to work on Facebook, Picasso, Photobucket, etc please if any body of you having any solution on this, then plzz help me out, Thanks in advance

    Read the article

  • An Unexpected HTTP Error occurred during the API request in wordpress

    - by Ram Bhat
    Hey guys I get this error on my wordpress blog hosted on my server each time i search for plugins or try to upgrade wordpress and on the dashboard. I have tried changing the timeout from 5 to 30 in the http.php file in wp-includes. This did NOT help. My blog works perfectly fine. This problem is really annoying as I have to manuall copy plugins and themes and upgrades.

    Read the article

  • How do I invoke a SimpleModal OSX dialog on page load?

    - by Priyank Sharma
    I was wondering if there is a way to invoke the SimpleModal OSX dialog box on page load? I tried http://stackoverflow.com/questions/522864/open-jquery-modal-dialog-on-page-load but wasn't able to make it happen. Currently, the dialog is invoked on clicking a button / link. I would like to invoke it on page load. Please help. :) Thanks! <script type='text/javascript' src='js/jquery.js'></script> <script type='text/javascript' src='js/jquery.simplemodal.js'></script> <script type='text/javascript' src='js/osx.js'></script> <input type='button' name='osx' value='Demo' class='osx demo'/> or <a href='#' class='osx'>Demo</a> <div id="osx-modal-content"> <div id="osx-modal-data"> <h2>Hello! I'm SimpleModal!</h2> <p><button class="simplemodal-close">Close</button> <span>(or press ESC or click the overlay)</span></p> </div> </div>

    Read the article

  • values assigned to Template variables disappear after page refresh in modx

    - by Gaurav Sharma
    Hi all, I created a template variable in modx by the name 'test_var'. Then in the home page resource edit content editor I wrote [*test_var*]. Then I published the resource. Then for checking if it works I executed the page using the preview button. The value appeared fine but when I refreshed the page, the value of the template variable disappeared ? This is very strange. Please help me what I am doing wrong. Thanks

    Read the article

  • System.exit(0) in java

    - by Ram
    I am writing an application program in java. If i need to exit from the application can i use system.exit or should i use some other method, which is good practice. If calling system.exit is not good practice then tell the reason and tell the alternative way to exit from the application.

    Read the article

  • How do I figure out which SOC or SDK board to use?

    - by Ram Bhat
    Hey guys Basically I'm working on a model of an automated vacuum cleaner. I currently have made software simulation of the same. How do I figure out which SOC or SDK board to use for the hardware implementation? My code is mostly written in C. Will this be compatible with the sdk provided by board manufacturers? How do i know what clock speed,memory etc the hardware will need? I'm a software guy and have only basic knowledge about practical hardware implementations. Have some experience in programming the 8086 to carry out basic tasks.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to determine if an event is already subscribed

    - by Ram
    Hi, In my .NET application I am subscribing to events from another class. The subscription is conditional. I am subscribing to events when the control is visible and de-subscribing it when it become invisible. However in some conditions I do not want to de-subscribe the event even if the control is not visible as I want the result of an operation which is happening on background thread . Is there any way through which I can determine if a that class has already subscribed to that event. I know we can do it in the class which will raise that event by checking event with null but I don not know how to do it in a class which will subscribe to that event.

    Read the article

  • How to expose MEX when I need the service to have NTLM authentication

    - by Ram Amos
    I'm developing a WCF service that is RESTful and SOAP, now both of them needs to be with NTLM authentication. I also want to expose a MEX endpoint so that others can easily reference the service and work with it. Now when I set IIS to require windows authentication I can use the REST service and make calls to the service succesfully, but when I want to reference the service with SVCUTIL it throws an error that it requires to be anonymous. Here's my web.config: <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true"/> <bindings> <basicHttpBinding> <binding name="basicHttpBinding" maxReceivedMessageSize="214748563" maxBufferSize="214748563" maxBufferPoolSize="214748563"> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Ntlm"> </transport> </security> </binding> </basicHttpBinding> <webHttpBinding> <binding name="webHttpBinding" maxReceivedMessageSize="214748563" maxBufferSize="214748563" maxBufferPoolSize="214748563"> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Ntlm"> </transport> </security> </binding> </webHttpBinding> <mexHttpBinding> <binding name="mexHttpBinding"></binding> </mexHttpBinding> </bindings> <standardEndpoints> <webHttpEndpoint> <standardEndpoint name="" automaticFormatSelectionEnabled="true" helpEnabled="True"> </standardEndpoint> </webHttpEndpoint> </standardEndpoints> <services> <service name="Intel.ResourceScheduler.Service" behaviorConfiguration="Meta"> <clear /> <endpoint address="soap" name="SOAP" binding="basicHttpBinding" contract="Intel.ResourceScheduler.Service.IResourceSchedulerService" listenUriMode="Explicit" /> <endpoint address="" name="rest" binding="webHttpBinding" behaviorConfiguration="REST" contract="Intel.ResourceScheduler.Service.IResourceSchedulerService" /> <endpoint address="mex" name="mex" binding="mexHttpBinding" behaviorConfiguration="" contract="IMetadataExchange" /> </service> </services> <behaviors> <endpointBehaviors> <behavior name="REST"> <webHttp /> </behavior> <behavior name="WCFBehavior"> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> </endpointBehaviors> <serviceBehaviors> <behavior name="Meta"> <serviceMetadata httpGetEnabled="true"/> </behavior> <behavior name="REST"> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> <behavior name="WCFBehavior"> <serviceMetadata httpGetEnabled="true"/> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> <behavior name=""> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="false" /> </behavior> </serviceBehaviors> </behaviors> Any help will be appreciated.

    Read the article

< Previous Page | 40 41 42 43 44 45 46 47 48 49 50 51  | Next Page >