Search Results

Search found 17715 results on 709 pages for 'regular language'.

Page 441/709 | < Previous Page | 437 438 439 440 441 442 443 444 445 446 447 448  | Next Page >

  • Flash AS3 and XML: way to fix line breaks in htmlText that uses <b> tags in the xml?

    - by HeroicNate
    I'm importing text in from an xml file and i'm using htmlText to try to keep some styling with tags. I have both the regular and bold face font embedded, and the bolding works fine. The problem is that it ads spaces around the words in bold like a paragraph indent and then makes a line-break after them. What's going on, is there a way to fix? fromxmlText.htmlText = theXML.contenttext; If I pull the text in from a txt file it will work fine, but taking it out of an xml file causing funky formatting. lil' help?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Theory of computation - Using the pumping lemma for context free languages

    - by Tony
    I'm reviewing my notes for my course on theory of computation and I'm having trouble understanding how to complete a certain proof. Here is the question: A = {0^n 1^m 0^n | n>=1, m>=1} Prove that A is not regular. It's pretty obvious that the pumping lemma has to be used for this. So, we have |vy| = 1 |vxy| <= p (p being the pumping length, = 1) uv^ixy^iz exists in A for all i = 0 Trying to think of the correct string to choose seems a bit iffy for this. I was thinking 0^p 1^q 0^p, but I don't know if I can obscurely make a q, and since there is no bound on u, this could make things unruly.. So, how would one go about this?

    Read the article

  • 503 (Server Unavailable) WebException when loading local XHTML file

    - by kcoppock
    Hello! So I'm currently working on an ePub reader application, and I've been reading through a bunch of regular XML files just fine with System.Xml and XmlDocument: XmlDocument xmldoc = new XmlDocument(); xmldoc.Load(Path.Combine(Directory.GetCurrentDirectory(), "META-INF/container.xml")); XmlNodeList xnl = xmldoc.GetElementsByTagName("rootfile"); However, now I'm trying to open the XHTML files that contain the actual book text, and they're XHTML files. Now I don't really know the difference between the two, but I'm getting the following error with this code (in the same document, using the same XmlDocument and XmlNodeList variable) xmldoc.Load(Path.Combine(Directory.GetCurrentDirectory(), "OEBPS/part1.xhtml")); "WebException was unhandled: The remote server returned an error: (503) Server Unavailable" It's a local document, so I'm not understanding why it's giving this error? Any help would be greatly appreciated. :) I've got the full source code here if it helps: http://drop.io/epubtest (I know the ePubConstructor.ParseDocument() method is horribly messy, I'm just trying to get it working at the moment before I split it into classes)

    Read the article

  • [AS3] htmlText not showing bold or italics font

    - by Conor
    So I have a MovieClip asset with a dynamic textfield sitting inside of it. I export my .fla as a .swc to use within Flash Builder 4, and create instances of the asset with code, populating the text dynamically from XML. My issue is that even though I have htmlText enabled, bold and italics tags don't appear to be working. I have a feeling it is because when I created the asset in Flash CS4, the text field makes you specify the font, and the subset of that to use (Regular, Bold, Oblique, etc). Is there any way to get the htmlText to render bold and italics tags properly without having to completely rethink the way I'm creating all these fields?

    Read the article

  • How do you protect code from leaking outside?

    - by cubex
    Besides open-sourcing your project and legislation, are there ways to prevent, or at least minimize the damages of code leaking outside your company/group? We obviously can't block Internet access (to prevent emailing the code) because programmer's need their references. We also can't block peripheral devices (USB, Firewire, etc.) The code matters most when it has some proprietary algorithms and in-house developed knowledge (as opposed to regular routine code to draw GUIs, connect to databases, etc.), but some applications (like accounting software and CRMs) are just that: complex collections of routine code that are simple to develop in principle, but will take years to write from scratch. This is where leaked code will come in handy to competitors. As far as I see it, preventing leakage relies almost entirely on human process. What do you think? What precautions and measures are you taking? And has code leakage affected you before?

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • iphone - passing an object on an UIToolbarButton action

    - by Mike
    Is that possible to make a UIToolbarButton pass an object to its target by using some exoteric method (as it seems not to be possible using regular button use)? I mean something like UIBarButtonItem *Button = [[UIBarButtonItem alloc] initWithImage:buttonImage style:UIBarButtonItemStylePlain target:self action:@selector(doSomething:) **withObject:usingThis**]; I know I can trigger a method that will launch the full method with the object, but for the sake of elegance I was trying to minimize the code... I suspect it is not possible, but as you guys out there are insanely good you may come with an transcendental answer... who knows...

    Read the article

  • Using string.Format for simple things?

    - by Gerrie Schenck
    In my early .Net programming days, I used string.Format() only for complex string concatenations, for example to compile strings as Problem with customer order 234 of date 2/2/2002 and payment id 55543. But now I use string.Format for almost every string concatenation I have to do, also simple ones such as prefixing a string with something. Console.WriteLine(string.Format("\t\t{0}", myString)); Is there any possible overhead on this? Maybe I should use the regular + operator to do these simple operations? What's your opinion on this?

    Read the article

  • Best way to parse command line arguments in C#

    - by Paul Stovell
    When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

    Read the article

  • Transforming a string to a valid PDO_MYSQL DSN

    - by Alix Axel
    What is the most concise way to transform a string in the following format: mysql:[/[/]][user[:pass]@]host[:port]/db[/] Into a usuable PDO connection/instance (using the PDO_MYSQL DSN), some possible examples: $conn = new PDO('mysql:host=host;dbname=db'); $conn = new PDO('mysql:host=host;port=3307;dbname=db'); $conn = new PDO('mysql:host=host;port=3307;dbname=db', 'user'); $conn = new PDO('mysql:host=host;port=3307;dbname=db', 'user', 'pass'); I've been trying some regular expressions (preg_[match|split|replace]) but they either don't work or are too complex, my gut tells me this is not the way to go but nothing else comes to my mind. Any suggestions?

    Read the article

  • C# Threads.Abort()

    - by Betamoo
    If a thread is running a function func1 that calls another function func2 inside it... Then I called thread.Abort() Will this stop func1 only OR func1 and func2 and all the functions func1 has called?? Thanks Edit: Here are more detail: func1 is called in a new thread, it continuously calls func2 on regular basis... func2 begin doing some work only if some array is not null.. it finishes it and return When supervisor wants to save data, it aborts Thread of func1- and then makes array null, saves data, then fill in the array with new one.. and starts Thread with func1 again.. Sometimes exception is raised because array is null in func2.. so func1 abort did not affect func2

    Read the article

  • sharing web user controls across projects.

    - by Kyle
    I've done this using a regular .cs file that just extends System.Web.UI.UserControl and then included the assembly of the project that contains the control into other projects. I've also created .ascx files in one project then copied all ascx files from a specified folder in the properties-Build Events-Pre-build event. Now what I want to do is a combination of those two: I want to be able to use ascx files that I build in one project, in all of my other projects but I want to include them just using assembly references rather than having to copy them to my "secondary" projects as that seems a ghetto way to accomplish what I want to do. It works yes, but it's not very elegant. Can anyone let me know if this even possible, and if so, what the best way to approach this is?

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • php regex to remove HTML

    - by Me1000
    Before we start, strip_tags() doesn't work. now, I've got some data that needs to be parsed, the problem is, I need to get rid of all the HTML that has been formated very strangely. the tags look like this: (notice the spaces) < p > blah blah blah < / p > < a href= " link.html " > blah blah blah < /a > All the regexs I've been trying aren't working, and I don't know enough about regex formating to make them work. I don't care about preserving anything inside of the tags, and would prefer to get rid of the text inside a link if I could. Anyone have any idea? (I really need to just sit down and learn regular expressions one day)

    Read the article

  • DataGridRow Cells property

    - by Michal Krawiec
    I would like to get to DataGridRow Cells property. It's a table of cells in a current DataGrid. But I cannot get access direct from code nor by Reflection: var x = dataGridRow.GetType().GetProperty("Cells") //returns null Is there any way to get this table? And related question - in Watch window (VS2008) regular properties have an icon of a hand pointing on a sheet of paper. But DataGridRow.Cells has an icon of a hand pointing on a sheet of paper with a little yellow envelope in a left bottom corner - what does it mean? Thanks for replies.

    Read the article

  • Django queries Especial Caracters

    - by Jorge Machado
    Hi, I Working on location from google maps and using django to. My question is: I have a String in request.GET['descricao'] lets say it contains "Via rapida". In my database i have store = "Via Rápida" i'm doing : local = Local.objects.filter(name__icontains=request.GET['descricao']) with that i can get everthing fine like "Via Rapida" but the result that have "Via rápida" never get match in the query (ASCI caracter may be ?) what must i do given a string "Via rapida" match "via rápida" and "via rapida" ? Regular Expressions ? how ? Thanks

    Read the article

  • Paypal recuring IPN signals

    - by user1548981
    When creating Paypal recurring payments i don't receive any notifications from IPN that the recurring payments were actually made. I do receive the notifications that recurring profiles are created, that regular payments are made, that profile is canceled and so on. But no notifications when Paypal make the recurring payment. The file that process the ipn notification works fine and i think is bug free.It also send me an email every time he got something from Paypal(with row POST data) so i don't think the problem is here. Does Paypal send these notifications.If i set a daily recurring payment i should get a daily notification that payment was made? From what i read in documentation i should get these signals but.. Thanks

    Read the article

  • Open C: Directly with `FileStream` without `CreateFile` API

    - by DxCK
    I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

    Read the article

  • Multiple Forms on the Same Page with Rails

    - by Eric Koslow
    So I'm building a rails app for high school students and I've hit a problem when it comes to creating users. I want the students to only be able to create accounts if they select their school and type in their school's password correctly. What is the correct / easiest way of doing this? Should I create a gatekeeper to the user#new action that they have to pass first or if their a way that on the same page a student can submit to forms. One would be the regular username, email, password using: form_for @user do ... end But then creating another form for the high-school / high-school password selection. Ideally the controller would be able to get the params of the high-school form, validate those, then go on to create the user from the user params. Is this possible using rails? My setup: Rails 3 and Ruby 1.9.2dev Thank you!

    Read the article

  • How can I build a Truth Table Generator?

    - by KingNestor
    I'm looking to write a Truth Table Generator as a personal project. There are several web-based online ones here and here. (Example screenshot of an existing Truth Table Generator) I have the following questions: How should I go about parsing expressions like: ((P = Q) & (Q = R)) = (P = R) Should I use a parser generator like ANTLr or YACC, or use straight regular expressions? Once I have the expression parsed, how should I go about generating the truth table? Each section of the expression needs to be divided up into its smallest components and re-built from the left side of the table to the right. How would I evaluate something like that? Can anyone provide me with tips concerning the parsing of these arbitrary expressions and eventually evaluating the parsed expression?

    Read the article

  • what the true nature of @ in Transct-SQL

    - by Richard77
    Hello, I reading some old ScottGu's blogs on Linq2SQL. Now I'm doing the SPROC part. I'd like to know what's the exact meaning of @variable. See this from ScottGu's Blog ALTER PROCEDURE dbo.GetCustomersDetails ( @customerID nchar(5), @companyName nvarchar(40) output ) AS SELECT @companyName = CompanyName FROM Customers WHERE CustomerID = @customerID SELECT * FROM Orders WHERE CustomerID = @customerID ORDER BY OrderID I'm kind of lost as, so far, I've though of anything preceded by a '@' as a placeholder for user input. But, in the example above, it looks like '@companyName' is used as a regular variable like in C# for instance (SELECT @companyName = ...). But, @companyName is not known yet. So, what the true nature a something preceded by a '@' like above? a vriable? a simple placeholder to accommodate user entered value? Thanks for helping

    Read the article

  • NSString: EOL and rangeOfString issues

    - by carloe
    Could someone please tell me if I am missing something here... I am trying to parse individual JSON objects out of a data stream. The data stream is buffered in a regular NSString, and the individual JSON objects are delineated by a EOL marker. if([dataBuffer rangeOfString:@"\n"].location != NSNotFound) { NSString *tmp = [dataBuffer stringByReplacingOccurrencesOfString:@"\n" withString:@"NEWLINE"]; NSLog(@"%@", tmp); } The code above outputs "...}NEWLINE{..." as expected. But if I change the @"\n" in the if-statement above to @"}\n", I get nothing.

    Read the article

  • Convert PDF to PDF/A-1

    - by AZtec
    I know this probably is not strictly a programming-question (well maybe it is, i don't know) but i'm having serious problems trying to convert a regular pdf (with hyperlinks, bookmarks, images, embedded fonts etc.) into a PDF/A-1 format. I get all kinds of errors when i check it with pdfaPilot. How can i prepare a pdf so no problems will occur when i try to convert to PDF/A-1. Most problems can be fixed with pdfaPilot but apparently not all. One of the problems i get is with the XMP Metadata which are "not properly defined". Wat exactly does this mean, and can i do something to prevent this. Another one is: "Syntax problem: Array with more than 8191 elements" (i hope this one is solvable) I hope someone can help me out here, since i'm in a tight spot right now with deadlines that are killing me.

    Read the article

  • NVP request - CreateRecurringPaymentsProfile

    - by jiwanje.mp
    Im facing problem with Trail period and first month payemnt. My requirement is users can signup with trial period which allow new users to have a 30 day free trial. This means they will not be charged the monthly price until after the first 30 days the regular amount will be charged to user. but the next billing date should be one month later the profile start date. but next billing data and profile start date shows same when i query by GetRecurringPaymentProfile? Please help me how can i send the Recurring bill payment for this functionality. Thanks in advance, jiwan

    Read the article

< Previous Page | 437 438 439 440 441 442 443 444 445 446 447 448  | Next Page >