Search Results

Search found 77947 results on 3118 pages for 'i dont know'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 451/3118 | < Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >

  • Moving from windows to linux : Understanding - X Window System, X Server, Xorg, Xfree86.

    - by claws
    Hello, I'm a windows developer(Win32api) moving from Windows to Linux. While installing linux there are lot of things to know about X11, X Window System, X Server, Xorg, Xfree86 and what not. How come we aren't aware of such things in windows? Wiki article on these scares me. Can any one explain these things? How they work? Why is it so complicated in linux & not in windows? Any good references are also appreciated. PS: I love to know internals, don't hesitate to go into depth.

    Read the article

  • Dell Vostro 3500 battery life remaining missing from Windows 8?

    - by Misha
    On Windows 7 a Vostro 3500 laptop shows the battery life remaining, while on Windows 8 this information appears to be missing. The percentage is still available, but the life remaining is missing. How is battery life remaining calculated and does this require some level of driver support? Is it a standardized interface? Does anybody know which driver is responsible for handling this feature? I want to force the old Windows 7 driver, but I don't know which driver does battery remaining.

    Read the article

  • Tool to allow Kerberos Authenticated users to modify Firewall settings

    - by Lars Hanke
    I run a firewall on a central router. Recently, several users want to use Skype. Since firewalling Skype virtually means to switch the firewall off, I consider to allow users to temporarily punch holes for their system. Since the users have no accounts on the router, I consider using Kerberos for authentication and authorization. The router is a Debian Squeeze box, with minimal configuration, i.e. no web-server, database or similar gimmicks. Does anyone know an existing solution, which could be used for that purpose? Or does anybody know easy to use and well documented frameworks in say Perl, Python, C, C++, ... making the set-up of a Kerberos authenticated Client and Server application really simple?

    Read the article

  • how to set global PATH on OS X?

    - by lajos
    I'd like to append to the global PATH variable on OS X so that all user shells and GUI applications get the same PATH environment. I know I can append to the path in shell startup scripts, but those settings are not inherited by GUI applications. The only way I found so far is to redefine the PATH environment variable in /etc/launchd.conf: setenv PATH /usr/bin:/bin:/usr/sbin:/sbin:/my/path I coulnd't figure out a way to actually append to PATH in launchd.conf. I'm a bit worried about this method, but so far this is the only thing that works. Does anyone know of a better way?

    Read the article

  • How to setup apache multi-site with multi-domain on ec2

    - by Esh
    Say I have two document roots domain1/ and domain2/ I know how to access those two roots from my own computer if they are hosted on the same computer. My question is that if I want to do the same thing on my ec2 server, how should I configure my elastic ips to those two roots? I know by default the elastic ip will only associate to the root with the name localhost(127.0.0.1). Anyone could give me a detailed answer? An example would help, thanks!

    Read the article

  • MSWord table shading prints too dark

    - by Relaxed1
    My friend has a very light shading in his MSWord tables. However they still print too dark to read the text. When emailed to a colleague using the same printer, it prints light nicely. However they cannot find any setting that is different between them. Any ideas? Thanks! (P.s. for myself this would help for non-tables also, when 'highlighting' text. I do know that 'shading' gives more colour options for non-tables, but it would be nice to know anyway. Thanks)

    Read the article

  • Debugging COM+ applications

    - by cc0
    I have a number of separate COM+ applications that I have to figure out; The COM+ applications respond to a number of scheduled tasks, and I need to know which COM components within which applications are being used when I execute each of these tasks. It is easy to figure out what (if anything) goes wrong in the event log, but as I am working on testing each components compatibility with the others; I need to know which ones I have actually tested by executing the scheduled tasks. Does anyone have some useful tips here? I've been looking into the sysinternals tools, and specifically processmonitor, but I have not found a way to make it monitor the COM+ applications yet. (I initially started this question here, but realized it's probably more suited for serverfault)

    Read the article

  • AD Local Admins without password sharing

    - by Cocoabean
    My team is building out an Active Directory environment in a small grad school with support for general computer labs, and staff/faculty machine and account management. We have a team of student consultants that are hired to do general help desk work. As of now we have a local admin account on every machine. It has the same password and all of us know it. I know it's not best practice and I want to avoid this with the new setup. We want to have local admin accounts in case there are network issues that prevent AD authentication, but we do not want this account to be generic with a shared password. Is there a way we can get each machine to cache the necessary information to authenticate a group of local admins so that if AD is somehow inaccessible, student consultants can still login with their AD admin accounts?

    Read the article

  • Verify linux user passwords

    - by zero_r
    Hi there I got a linux server that has several dozen users. I also have the cleartext password for every user (i know - bad security). I would like to know if the passwords are correct. Since the users are all ftp users and have the nologin shell, I cannot just write a script to check if login works. How can I do a local check on passwords? Script output could look like this: $ check_userpw < user_pw_list.txt user1 ok user2 ok user3 mismatch! user4 ok Thanks

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • I want to easily switch accounts for Twitter - is there a Firefox/Chrome/IE plug-in to do this?

    - by Edelcom
    I have several Twitter accounts to which I post messages. One is a personal, one is a professional, and a couple for each software system I developed. Does any one know of a plug-in for one of the major web browses on Windows or program that allows me to easily login to multiple Twitter accounts and easily switch between them ? I now have the 4 major browsers installed on my computer , each with it's own Twitter account (with the password and login info saved), but I think there must be a better way. On a side note: it is getting harder and harder to know to which StackOverflow alike site a question must be posted. So I hope this question here is considered on-topic.

    Read the article

  • Change Windows 7 Explorer's Details Pane limits

    - by Paul
    For some reason, MS decided to completely kill the status bar's functionality in Win7 (and maybe Vista, but I don't know for sure). I have tried all possible options such as Classic Shell and so on. Basically, the one thing I miss most is seeing at a glance the total size of my selected files. I know I can press Alt+Enter or whatever, but that's not the point. The point is that the so-called 'details' pane stops providing details if more than 15 files are selected! WTH? Cannot understand the reason behind such a stupid arbitrary limit, that doesn't seem to be user-configurable at all. Anyway, what I'm looking for is a way to change that limit, either via the registry or otherwise. Is this at all possible?

    Read the article

  • How to verify if my copy operation is complete in Windows 7?

    - by Tim
    Yesterday, I was leaving some job of copying a directory to run overnight. This morning however, I found the computer had restarted because of Windows Update or something. I was wondering if there is some way to check if the copy is complete? One way I guess would be check the last modified time of the copy, and when the system restarted. But I was wondering where to find the time when the system restarted? I was also wondering if where to find some logging files that have the records. I know Event Viewer, but don't know where to find within it. Other methods are welcome too. I also would like to hear suggestions for other ways to accomplish the copy instead of just simple copy and paste. Thanks and regards!

    Read the article

  • Can I run Ubuntu directly under Windows 8?

    - by huahsin68
    Text below is extract from the article, Windows 8 Tip: Virtualize with Hyper-V. Better still, Windows Virtual PC offered a feature called XP Mode, free for users of Windows 7 Professional, Enterprise, and Ultimate, which included a full working copy of Windows XP with Service Pack 3. But the big deal here is that as you installed applications in the virtual copy of XP, they would be made available through Windows 7’s Start Menu. And you could run these applications, side-by-side, with Windows 7 applications on the Windows 7 desktop. It was a seamless, integrated experience, ideal for those one-off application compatibility issues. I was thinking to install VirtualBox in Windows 8 and then run Ubuntu as guess OS. Since Hyper-V is a Type-0 hipervisor, may I know does this bring the same benefit if I have Ubuntu Linux install as a virtual guess OS? Meaning, if I turning the Ubuntu on (the guess OS), does the Ubuntu still able to access the hardware information like nVidia display card or processor information? I'm just curious to know can this be done?

    Read the article

  • Installing drivers and getting -> Error Code 28

    - by Adrov
    I've recently upgraded mainboard, without reinstalling OS, so I guess that's the issue. I really don't want to install OS at this moment. Issue is I can't install USB drivers, if I right-click uninstall, just installs same driver, which isn't working ofc. and giving error code 28. I fixed such issue once long long time ago, with editing registry, but I really can't remember what and where I have to do, so if anyone know please let me know, I'm also open to all other solutions to this issue. http://i.stack.imgur.com/AuBtB.png

    Read the article

  • determine the archetecture of a mac from the command line or script?

    - by Brian Postow
    I'm writing a shell script, and I need to know the archetecture, ie PPC or Intel. Back in the day, there was a program /bin/arch that told you, but my mac doesn't seem to have it... Is there an easy way I can do this? Grep for something in a logfile? call some other program that spits that out as a side effect? It would be nice to know what OS Version I'm running too, but that may not be necessary. thanks

    Read the article

  • Record Matching Software to Compare two tables and match on % Based

    - by Crazyd
    So I have some table with Name, Address, and Zip with no record data attached; and I have a table which has all the same, but has more information and I need a way to merge the tables when they don't match 100%. How do I match them up if they aren't Identical? I'm a newb @ SQL, but I know they won't match up for the most part and I can't be the only one with this issue. However software which will do this has proven to be difficult. Writing software to do this would even be worse than having to do it in the first place. I know I can do this in excel; kinda, but with the amount of records I have its proving to be difficult over a million.

    Read the article

  • Is it possible to stream music/video from an Apache server?

    - by rphello101
    I'm just starting to get into setting up a server. I've set up a basic Apache server to access some songs and movies. When I click one of the songs though, nothing happens. When I click one of the movies, sometimes it will open a new web page and act as though it is going to start playing, but never does. I know Apache is HTTP, not FTP and read somewhere that that could be a problem, but I'm uncertain of the differences. Anyway, is it possible to click on one of the songs and have it start streaming using, for example, Windows Media Player? If so, might someone either explain how to do so or direct me to where I can find it? Any information on retrieving media from an Apache server at this point would be most appreciated. -Edit- I don't know if it matters, but I'm using Windows 7 and Google Chrome

    Read the article

  • Cannot find grldr in all devices

    - by blockhead
    I'm running wubi on XP machine. Started out originally with 8.04, and gradually upgraded to 10.04. Recently, I was creating linux bootable USB drive, and put it in my system to see if it would work. After booting the LiveOS, and rebooting my machine, I know get the error Cannot find grldr in all devices when booting Ubuntu. I don't know what grldr is, but I assume it is the GRUB Loader. Did booting the LiveOS screw with my MBR perhaps? How can I fix this, and if not, is it possible to reinstall wubi, without losing anything of what I have now?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >